5HELA

Crystal structure of the n-terminus y153h bromodomain mutant of human brd2
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
119
structure length
119
Chain Sequence
SMKPGRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGTIKRRLENNYYWAASECMQDFNTMFTNCHIYNKPTDDIVLMAQTLEKIFLQKVASMPQEEQEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Bromodomain-containing protein 2
publication title Crystal structure of the N-terminus Y153H bromodomain mutant of human BRD2
rcsb
source organism Homo sapiens
total genus 39
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2016-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5helA00
4NR4A 3HMEA 2F6JA 5FE4A 5CPEA 5I80A 1E6IA 4PCIA 5CTLA 4LRGA 5DKHA 4HBWA 5TB6A 5D3RA 5D25A 4IR6A 4ALGA 5HLSA 5C89A 2OSSA 4QUTA 4YH3A 3O36A 4GPJA 5FE3A 5CQ7A 5D24A 5L99A 5L98A 4XY9A 3LQHA 5FFWA 3O34A 3P1CA 4A9LA 4CUQA 2DVVA 5G4RA 2RO1A 3HMHA 4QSSA 5EWCA 4UITA 5KU3A 5DW2A 4YBTA 4O77A 3UVYA 5BT3A 4LC2A 4QY4A 3IU5A 3HMFA 4TZ8A 5K29A 2F6NA 5I7YA 4QB3A 4TT4A 3Q2FA 5EICA 5FFYA 5AD2A 4LZ2A 5E9MA 4YY6A 4Y03A 1JM4B 4J0RA 5IIDA 4NS5A 4CFKA 4TS8A 5FBXA 5CGPA 4IORA 4X2IA 5II2A 4YY4A 4HBXA 5A82A 4A9OA 4FLPA 4CUTA 5F36A 5I40A 3AADA 5CQ8A 4CURA 2FSAA 4YADA 3UV2A 4AKNA 4OUFA 5DY7A 2E7NA 3SVHA 4O76A 4BW1A 5A5PA 4CFLA 3P5OA 4QYDA 3UVDA 4NUEA 4CLBA 3IU6A 3MXFA 5EISA 2OUOA 4MEOA 5I88A 4O74A 5F62A 5ACYA 4QSTA 5KHMA 5II1A 5EP7A 3QZVA 3MQMA 4UYDA 3P1FA 3P1DA 5I29A 5AD3A 5HELA 4YH4A 5ENBA 3DWYA 3MB3A 3ZYUA 4J3IA 4YYNA 5F25A 5CUDA 5LKXA 4YYHA 4LYSA 2RI7A 5CQAA 4LYWA 4NXJA 4OGJA 3UVWA 4ALHA 4YBSA 4LZRA 5FB0A 4YYKA 5D3PA 5FFVA 5HEMA 5CFWA 5IGMA 4QSXA 5ENFA 4Z1QA 3SVFA 4HXNA 5F3AA 1WUMA 4HBVA 4NUDA 5A5RA 4C66A 5FE8A 3G0LA 4NR6A 5DYUA 5EWWA 2RNWA 5L96A 5DYXA 5HRWA 4XY8A 5ENIA 3JVJA 4UIVA 5EV9A 5DFDA 5HFQA 4XUAA 4UIYA 4UYHA 5D3JA 4QSUA 5D3HA 4IR3A 3DAIA 5DKDA 5LUUA 2YDWA 5CU8A 4UIXA 4IOQA 3U5PA 3MULA 5J0DA 5AMEA 3UV4A 4C67A 5F61A 5IBNA 4LDFA 4MR3A 5ENEA 3U5KA 4WHUA 5IGKA 4YABA 4UIWA 2RNXA 4QSPA 3UV5A 4PKLA 2DVRA 5DYAA 3GG3A 5D0CA 5E7DA 5D3TA 4YYJA 5F60A 2OO1A 5CRMA 5ETDA 4Z93A 5I83A 5CQ6A 4NUCA 5EPRA 2E7OA 5FB1A 5EPSA 5FH8A 5HJCA 3LQIA 5ENGA 2D82A 5E3DA 4O7AA 5FG4A 3U5LA 5A81A 4MR6A 4QSQA 5F1LA 5I89A 4IOOA 3FKMX 4QSRA 5E9LA 1X0JA 3QZTA 5D3NA 4Q0OA 3MB4A 4BW4A 4QEUA 4Q0NA 3G0JA 4NYVA 5CUCA 4TU6A 2MJVB 4QC3A 5D3SA 4BJXA 3NXBA 4Z6HA 5FE7A 4UYEA 2G4AA 2R0YA 4A9IA 1F68A 5D7XA 5A5QA 2YEMA 5G4SA 5C7NA 4O7CA 5FE9A 5DYCA 5DLXA 4N3WA 3SVGA 5FE1A 2N9GA 3Q2EA 5F2PA 3LJWA 3S92A 4QR4A 5EWDA 5H1UA 4RVRA 2DVSA 4LR6A 2DVQA 5LKTA 5I7XA 4HXPA 5FE5A 4A9NA 3I3JA 5EWVA 4A9FA 5DBMA 5TCMA 4QC1A 4XUBA 5DKCA 2L85A 5CUEA 5LKUA 4BW2A 4O7EA 5A5SA 3LQJA 4KV1A 3RCWA 5LKZA 2R10A 2I8NA 5C4QA 5JI8A 2NXBA 4O72A 4CUPA 5F1HA 4N4FA 5LJ2A 5DFCA 4HXLA 4UYFB 5CQ4A 4YYGA 4IR4A 4NQMA 4QSWA 5H85A 3JVKA 4UYFA 4A9JA 5I1QA 3O33A 2RFJA 2WP1A 4CUSA 4ZC9A 4MR5A 4A9KA 4WIVA 4N4IA 4NYWA 5COIA 5A85A 5CZGA 4NYXA 5EWHA 2YYNA 3S91A 5LJ0A 2RS9B 4HXKA 5A5NA 2H60A 1EQFA 5BT4A 5E9YA 5HRVA 5AMFA 3UW9A 4Z1SA 4E96A 2R0VA 4TU4A 4PCEA 4A9HA 4QUUA 2YELA 4N4HA 2D9EA 2GRCA 4UYGA 4QZSA 4PS5A 5I86A 4QR3A 3U5NA 5FE2A 4A9MA 5LVQA 4XYAA 4NRBA 5LVRA 4TYLA 4HXOA 4NR5A 5F63A 4KV4A 5H1VA 3U5OA 3O37A 5C87A 5FG6A 4YC9A 5A5OA 5HQ6A 4N4GA 5DLZA 4OGIA 4YATA 3U5JA 5IG6A 4NR7A 5D3LA 5IGLA 5HENA 4YYDA 4IR5A 5EM3A 5CRZA 4MEPA 5JWMA 2I7KA 3MUKA 4MENA 5D26A 5E9IA 5EQ1A 4MEQA 4BHWA 5L8TA 5FH7A 4LYIA 4O70A 5EI4A 4O75A 4J0SA 4ZW1A 4F3IA 4HBYA 4TT2A 5EA1A 5EU1A 5KTUA 5EGUA 5HFRA 5ENHA 4NRAA 4YYMA 5CQTA 1WUGA 5DFBA 5HCLA 3JVMA 5CUBA 5E74A 3ONIA 4NRCA 5HQ5A 5BT5A 3D7CA 5HM0A 2LSPB 5A83A 4PTBA 4UIUA 5CUAA 5FG5A 2E3KA 2RNYA 5LJ1A 2KTBB 3QZSA 4QNSA 5DW1A 3U5MA 5KO4A 3K2JA 5A7CA 4BW3A 5L8UA 5L97A 1ZS5A 4O71A 5FE0A 2L5EA 4KCXA 5C8GA 5E0RA 4TTEA 4Z6IA 4WHWA 5ENJA 4A9EA 4YBMA 5C85A 4NR8A 2DATA 4YK0A 5EPBA 5CUGA 2YEKA 5FDZA 5E73A 4UIZA 4J1PA 4HXSA 4CUUA 4HXRA 5EK9A 4TQNA 4LZSA 5HRXA 2R0SA 5FH6A 5E9KA 4HXMA 5EVAA 5E9VA 3LXJA 1N72A 3UVXA 5ENCA 4MR4A 5E3GA 3JVLA 4TZ2A 4QEWA 2YQDA 4QEVA 5ETBA 5CQ5A 5CY9A 2WP2A 5CQ3A 1JSPB 4ZQLA 4PY6A 2YW5A 4DONA 5IGNA 5DX4A 4NR9A 4O78A 5CP5A 3P1EA 5KTWA 4QR5A 4YYIA 4CL9A 4O7FA 5KTXA 5HQ7A 5FE6A 5H1TA 5CS8A 3O35A 3TLPA 4QYLA 3AQAA 2DWWA 4TT6A 2DKWA 4QSVA 4O7BA 2L84A 5F5ZA 4YAXA 4QBMA 4NQNA
chains in the Genus database with same CATH superfamily
4NR4A 3HMEA 2F6JA 5FE4A 5CPEA 5I80A 1E6IA 4PCIA 5CTLA 4LRGA 5DKHA 4HBWA 5TB6A 5D3RA 5D25A 4IR6A 4ALGA 5HLSA 5C89A 2OSSA 4QUTA 4YH3A 3O36A 4GPJA 5FE3A 5CQ7A 5D24A 5L99A 5L98A 4XY9A 3LQHA 5FFWA 3O34A 3P1CA 4A9LA 4CUQA 2DVVA 5G4RA 2RO1A 3HMHA 4QSSA 5EWCA 4UITA 5KU3A 5DW2A 4YBTA 4O77A 3UVYA 5BT3A 4LC2A 4QY4A 3IU5A 3HMFA 4TZ8A 5K29A 2F6NA 5I7YA 4QB3A 4TT4A 3Q2FA 5EICA 5FFYA 5AD2A 4LZ2A 5E9MA 4YY6A 4Y03A 1JM4B 4J0RA 5IIDA 4NS5A 4CFKA 4TS8A 5FBXA 5CGPA 4IORA 4X2IA 5II2A 4YY4A 4HBXA 5A82A 4A9OA 4FLPA 4CUTA 5F36A 5I40A 3AADA 5CQ8A 4CURA 2FSAA 4YADA 3UV2A 4AKNA 4OUFA 5DY7A 2E7NA 3SVHA 4O76A 4BW1A 5A5PA 4CFLA 3P5OA 4QYDA 3UVDA 4NUEA 4CLBA 3IU6A 3MXFA 5EISA 2OUOA 4MEOA 5I88A 4O74A 5F62A 5ACYA 4QSTA 5KHMA 5II1A 5EP7A 3QZVA 3MQMA 4UYDA 3P1FA 3P1DA 5I29A 5AD3A 5HELA 4YH4A 5ENBA 3DWYA 3MB3A 3ZYUA 4J3IA 4YYNA 5F25A 5CUDA 3D1BA 4YYHA 5LKXA 4LYSA 2RI7A 5CQAA 4LYWA 4NXJA 4OGJA 3UVWA 4ALHA 4YBSA 4LZRA 5FB0A 4YYKA 5D3PA 5FFVA 5HEMA 5CFWA 5IGMA 4QSXA 5ENFA 4Z1QA 3SVFA 4HXNA 5F3AA 1WUMA 4HBVA 4NUDA 5A5RA 1ZKRA 4C66A 5FE8A 3G0LA 4NR6A 5DYUA 5EWWA 2RNWA 5L96A 5DYXA 5HRWA 4XY8A 5ENIA 3JVJA 4UIVA 5EV9A 5DFDA 5HFQA 4XUAA 1PUOA 4UIYA 4UYHA 5D3JA 4QSUA 5D3HA 4IR3A 3DAIA 5DKDA 5LUUA 2YDWA 5CU8A 4UIXA 4IOQA 3U5PA 3MULA 5J0DA 5AMEA 3UV4A 4C67A 5F61A 5IBNA 4LDFA 4MR3A 5ENEA 3U5KA 4WHUA 5IGKA 4YABA 4UIWA 4AKHA 2RNXA 4QSPA 3UV5A 4PKLA 2DVRA 5DYAA 3GG3A 5D0CA 5E7DA 5D3TA 4YYJA 5F60A 2OO1A 5CRMA 5ETDA 4Z93A 5I83A 5CQ6A 4NUCA 5EPRA 2E7OA 5FB1A 5EPSA 5FH8A 5HJCA 3LQIA 5ENGA 2D82A 5E3DA 4O7AA 5FG4A 3U5LA 5A81A 4MR6A 4QSQA 5F1LA 5I89A 4IOOA 3FKMX 4QSRA 5E9LA 1X0JA 3QZTA 5D3NA 4Q0OA 3MB4A 4BW4A 4QEUA 4Q0NA 3VKGA 3G0JA 4NYVA 5CUCA 4TU6A 2MJVB 4QC3A 5D3SA 4BJXA 3NXBA 4Z6HA 5FE7A 4UYEA 2G4AA 2R0YA 4A9IA 1F68A 3VKHA 5D7XA 4AKGA 5A5QA 2YEMA 5G4SA 5C7NA 4O7CA 5FE9A 5DYCA 5DLXA 4N3WA 3SVGA 5FE1A 2N9GA 3Q2EA 5F2PA 3LJWA 3S92A 4QR4A 5EWDA 5H1UA 4RVRA 2DVSA 4LR6A 2DVQA 5LKTA 5I7XA 4HXPA 5FE5A 4A9NA 3I3JA 5EWVA 4A9FA 5DBMA 5TCMA 4QC1A 4XUBA 5DKCA 2L85A 5CUEA 5LKUA 4BW2A 4O7EA 5A5SA 3LQJA 4KV1A 3RCWA 5LKZA 2R10A 2I8NA 5C4QA 5JI8A 2NXBA 4O72A 4CUPA 5F1HA 4N4FA 5LJ2A 5DFCA 4HXLA 4UYFB 5CQ4A 4YYGA 4IR4A 4NQMA 4QSWA 5H85A 3JVKA 4UYFA 4A9JA 5I1QA 3O33A 2RFJA 2WP1A 4CUSA 4ZC9A 4MR5A 4A9KA 4WIVA 4N4IA 4NYWA 5COIA 5A85A 5CZGA 4NYXA 5EWHA 2YYNA 3S91A 5LJ0A 2RS9B 4HXKA 5A5NA 2H60A 1EQFA 5BT4A 5E9YA 5HRVA 5AMFA 3UW9A 4Z1SA 4E96A 2R0VA 4TU4A 4PCEA 4A9HA 4QUUA 2YELA 4N4HA 2D9EA 2GRCA 4UYGA 4QZSA 4PS5A 5I86A 4QR3A 3U5NA 5FE2A 4A9MA 5LVQA 4XYAA 4NRBA 5LVRA 3D1DA 4TYLA 4HXOA 4NR5A 5F63A 4KV4A 5H1VA 3U5OA 3O37A 5C87A 5FG6A 4YC9A 5A5OA 5HQ6A 4N4GA 5DLZA 4OGIA 4YATA 3U5JA 5IG6A 4NR7A 5D3LA 5IGLA 5HENA 4YYDA 4IR5A 5EM3A 5CRZA 4MEPA 5JWMA 2I7KA 3MUKA 4MENA 5D26A 5E9IA 5EQ1A 4MEQA 4BHWA 5L8TA 5FH7A 4LYIA 4AKIA 4O70A 5EI4A 3ERRA 4J0SA 4O75A 4ZW1A 4F3IA 4HBYA 4TT2A 5EA1A 5EU1A 5KTUA 5EGUA 5HFRA 5ENHA 4NRAA 4YYMA 5CQTA 1WUGA 5DFBA 5HCLA 3JVMA 5CUBA 5E74A 3ONIA 4NRCA 5HQ5A 5BT5A 3D7CA 5HM0A 2LSPB 5A83A 4PTBA 4UIUA 5CUAA 5FG5A 2E3KA 2RNYA 5LJ1A 2KTBB 3QZSA 4QNSA 5DW1A 3U5MA 5KO4A 3K2JA 5A7CA 4BW3A 5L8UA 5L97A 1ZS5A 4O71A 5FE0A 2L5EA 4KCXA 5C8GA 5E0RA 4TTEA 4Z6IA 4WHWA 5ENJA 4A9EA 4YBMA 5C85A 4NR8A 2DATA 4YK0A 5EPBA 5CUGA 2YEKA 5FDZA 5E73A 4UIZA 4J1PA 4HXSA 4CUUA 4HXRA 5EK9A 4TQNA 4LZSA 5HRXA 2R0SA 5FH6A 5E9KA 4HXMA 5EVAA 5E9VA 3LXJA 1N72A 3UVXA 5ENCA 4MR4A 5E3GA 3JVLA 4TZ2A 4QEWA 2YQDA 4QEVA 5ETBA 5CQ5A 5CY9A 2WP2A 5CQ3A 1JSPB 4ZQLA 4PY6A 2YW5A 4DONA 2EJNA 5IGNA 5DX4A 4NR9A 4O78A 5CP5A 3P1EA 5KTWA 4QR5A 4YYIA 4CL9A 4O7FA 5KTXA 5HQ7A 5FE6A 5H1TA 5CS8A 3O35A 3TLPA 4QYLA 4AI6A 3AQAA 2DWWA 4TT6A 2DKWA 4QSVA 4O7BA 2L84A 5F5ZA 4YAXA 4QBMA 4NQNA
chains in the Genus database with same CATH topology
4NR4A 3HMEA 2F6JA 5FE4A 5CPEA 5I80A 1E6IA 4PCIA 5CTLA 4LRGA 5DKHA 4HBWA 5TB6A 5D3RA 5D25A 4IR6A 4ALGA 5HLSA 5C89A 2OSSA 4QUTA 4YH3A 3O36A 4GPJA 5FE3A 5CQ7A 5D24A 5L99A 5L98A 4XY9A 3LQHA 5FFWA 3O34A 3P1CA 4A9LA 4CUQA 2DVVA 5G4RA 2RO1A 3HMHA 4QSSA 5EWCA 4UITA 5KU3A 5DW2A 4YBTA 4O77A 3UVYA 5BT3A 4LC2A 4QY4A 3IU5A 3HMFA 4TZ8A 5K29A 2F6NA 5I7YA 4QB3A 4TT4A 3Q2FA 5EICA 5FFYA 5AD2A 4LZ2A 5E9MA 4YY6A 4Y03A 1JM4B 4J0RA 5IIDA 4NS5A 4CFKA 4TS8A 5FBXA 5CGPA 4IORA 4X2IA 5II2A 4YY4A 4HBXA 5A82A 4A9OA 4FLPA 4CUTA 5F36A 5I40A 3AADA 5CQ8A 4CURA 2FSAA 4YADA 3UV2A 4AKNA 4OUFA 5DY7A 2E7NA 3SVHA 4O76A 4BW1A 5A5PA 4CFLA 3P5OA 4QYDA 3UVDA 4NUEA 4CLBA 3IU6A 3MXFA 5EISA 2OUOA 4MEOA 5I88A 4O74A 5F62A 5ACYA 4QSTA 5KHMA 5II1A 5EP7A 3QZVA 3MQMA 4UYDA 3P1FA 3P1DA 5I29A 5AD3A 5HELA 4YH4A 5ENBA 3DWYA 3MB3A 3ZYUA 4J3IA 4YYNA 5F25A 5CUDA 5LKXA 4YYHA 4LYSA 2RI7A 5CQAA 4LYWA 4NXJA 4OGJA 3UVWA 4ALHA 4YBSA 4LZRA 5FB0A 4YYKA 5D3PA 5FFVA 5HEMA 5CFWA 5IGMA 4QSXA 5ENFA 4Z1QA 3SVFA 4HXNA 5F3AA 1WUMA 4HBVA 4NUDA 5A5RA 4C66A 5FE8A 3G0LA 4NR6A 5DYUA 5EWWA 2RNWA 5L96A 5DYXA 5HRWA 4XY8A 5ENIA 3JVJA 4UIVA 5EV9A 5DFDA 5HFQA 4XUAA 4UIYA 4UYHA 5D3JA 4QSUA 5D3HA 4IR3A 3DAIA 5DKDA 5LUUA 2YDWA 5CU8A 4UIXA 4IOQA 3U5PA 3MULA 5J0DA 5AMEA 3UV4A 4C67A 5F61A 5IBNA 4LDFA 4MR3A 5ENEA 3U5KA 4WHUA 5IGKA 4YABA 4UIWA 2RNXA 4QSPA 3UV5A 4PKLA 2DVRA 5DYAA 3GG3A 5D0CA 5E7DA 5D3TA 4YYJA 5F60A 2OO1A 5CRMA 5ETDA 4Z93A 5I83A 5CQ6A 4NUCA 5EPRA 2E7OA 5FB1A 5EPSA 5FH8A 5HJCA 3LQIA 5ENGA 2D82A 5E3DA 4O7AA 5FG4A 3U5LA 5A81A 4MR6A 4QSQA 5F1LA 5I89A 4IOOA 3FKMX 4QSRA 5E9LA 1X0JA 3QZTA 5D3NA 4Q0OA 3MB4A 4BW4A 4QEUA 4Q0NA 3G0JA 4NYVA 5CUCA 4TU6A 2MJVB 4QC3A 5D3SA 4BJXA 3NXBA 4Z6HA 5FE7A 4UYEA 2G4AA 2R0YA 4A9IA 1F68A 5D7XA 5A5QA 2YEMA 5G4SA 5C7NA 4O7CA 5FE9A 5DYCA 5DLXA 4N3WA 3SVGA 5FE1A 2N9GA 3Q2EA 5F2PA 3LJWA 3S92A 4QR4A 5EWDA 5H1UA 4RVRA 2DVSA 4LR6A 2DVQA 5LKTA 5I7XA 4HXPA 5FE5A 4A9NA 3I3JA 5EWVA 4A9FA 5DBMA 5TCMA 4QC1A 4XUBA 5DKCA 2L85A 5CUEA 5LKUA 4BW2A 4O7EA 5A5SA 3LQJA 4KV1A 3RCWA 5LKZA 2R10A 2I8NA 5C4QA 5JI8A 2NXBA 4O72A 4CUPA 5F1HA 4N4FA 5LJ2A 5DFCA 4HXLA 4UYFB 5CQ4A 4YYGA 4IR4A 4NQMA 4QSWA 5H85A 3JVKA 4UYFA 4A9JA 5I1QA 3O33A 2RFJA 2WP1A 4CUSA 4ZC9A 4MR5A 4A9KA 4WIVA 4N4IA 4NYWA 5COIA 5A85A 5CZGA 4NYXA 5EWHA 2YYNA 3S91A 5LJ0A 2RS9B 4HXKA 5A5NA 2H60A 1EQFA 5BT4A 5E9YA 5HRVA 5AMFA 3UW9A 4Z1SA 4E96A 2R0VA 4TU4A 4PCEA 4A9HA 4QUUA 2YELA 4N4HA 2D9EA 2GRCA 4UYGA 4QZSA 4PS5A 5I86A 4QR3A 3U5NA 5FE2A 4A9MA 5LVQA 4XYAA 4NRBA 5LVRA 4TYLA 4HXOA 4NR5A 5F63A 4KV4A 5H1VA 3U5OA 3O37A 5C87A 5FG6A 4YC9A 5A5OA 5HQ6A 4N4GA 5DLZA 4OGIA 4YATA 3U5JA 5IG6A 4NR7A 5D3LA 5IGLA 5HENA 4YYDA 4IR5A 5EM3A 5CRZA 4MEPA 5JWMA 2I7KA 3MUKA 4MENA 5D26A 5E9IA 5EQ1A 4MEQA 4BHWA 5L8TA 5FH7A 4LYIA 4O70A 5EI4A 4O75A 4J0SA 4ZW1A 4F3IA 4HBYA 4TT2A 5EA1A 5EU1A 5KTUA 5EGUA 5HFRA 5ENHA 4NRAA 4YYMA 5CQTA 1WUGA 5DFBA 5HCLA 3JVMA 5CUBA 5E74A 3ONIA 4NRCA 5HQ5A 5BT5A 3D7CA 5HM0A 2LSPB 5A83A 4PTBA 4UIUA 5CUAA 5FG5A 2E3KA 2RNYA 5LJ1A 2KTBB 3QZSA 4QNSA 5DW1A 3U5MA 5KO4A 3K2JA 5A7CA 4BW3A 5L8UA 5L97A 1ZS5A 4O71A 5FE0A 2L5EA 4KCXA 5C8GA 5E0RA 4TTEA 4Z6IA 4WHWA 5ENJA 4A9EA 4YBMA 5C85A 4NR8A 2DATA 4YK0A 5EPBA 5CUGA 2YEKA 5FDZA 5E73A 4UIZA 4J1PA 4HXSA 4CUUA 4HXRA 5EK9A 4TQNA 4LZSA 5HRXA 2R0SA 5FH6A 5E9KA 4HXMA 5EVAA 5E9VA 3LXJA 1N72A 3UVXA 5ENCA 4MR4A 5E3GA 3JVLA 4TZ2A 4QEWA 2YQDA 4QEVA 5ETBA 5CQ5A 5CY9A 2WP2A 5CQ3A 1JSPB 4ZQLA 4PY6A 2YW5A 4DONA 5IGNA 5DX4A 4NR9A 4O78A 5CP5A 3P1EA 5KTWA 4QR5A 4YYIA 4CL9A 4O7FA 5KTXA 5HQ7A 5FE6A 5H1TA 5CS8A 3O35A 3TLPA 4QYLA 3AQAA 2DWWA 4TT6A 2DKWA 4QSVA 4O7BA 2L84A 5F5ZA 4YAXA 4QBMA 4NQNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NR4 A;  3HME A;  2F6J A;  5FE4 A;  5CPE A;  5I80 A;  1E6I A;  4PCI A;  5CTL A;  4LRG A;  5DKH A;  4HBW A;  5TB6 A;  5D3R A;  5D25 A;  4IR6 A;  4ALG A;  5HLS A;  5C89 A;  2OSS A;  4QUT A;  4YH3 A;  3O36 A;  4GPJ A;  5FE3 A;  5CQ7 A;  5D24 A;  5L99 A;  5L98 A;  4XY9 A;  3LQH A;  5FFW A;  3O34 A;  3P1C A;  4A9L A;  4CUQ A;  2DVV A;  5G4R A;  2RO1 A;  3HMH A;  4QSS A;  5EWC A;  4UIT A;  5KU3 A;  5DW2 A;  4YBT A;  4O77 A;  3UVY A;  5BT3 A;  4LC2 A;  4QY4 A;  3IU5 A;  3HMF A;  4TZ8 A;  5K29 A;  2F6N A;  5I7Y A;  4QB3 A;  4TT4 A;  3Q2F A;  5EIC A;  5FFY A;  5AD2 A;  4LZ2 A;  5E9M A;  4YY6 A;  4Y03 A;  1JM4 B;  4J0R A;  5IID A;  4NS5 A;  4CFK A;  4TS8 A;  5FBX A;  5CGP A;  4IOR A;  4X2I A;  5II2 A;  4YY4 A;  4HBX A;  5A82 A;  4A9O A;  4FLP A;  4CUT A;  5F36 A;  5I40 A;  3AAD A;  5CQ8 A;  4CUR A;  2FSA A;  4YAD A;  3UV2 A;  4AKN A;  4OUF A;  5DY7 A;  2E7N A;  3SVH A;  4O76 A;  4BW1 A;  5A5P A;  4CFL A;  3P5O A;  4QYD A;  3UVD A;  4NUE A;  4CLB A;  3IU6 A;  3MXF A;  5EIS A;  2OUO A;  4MEO A;  5I88 A;  4O74 A;  5F62 A;  5ACY A;  4QST A;  5KHM A;  5II1 A;  5EP7 A;  3QZV A;  3MQM A;  4UYD A;  3P1F A;  3P1D A;  5I29 A;  5AD3 A;  5HEL A;  4YH4 A;  5ENB A;  3DWY A;  3MB3 A;  3ZYU A;  4J3I A;  4YYN A;  5F25 A;  5CUD A;  5LKX A;  4YYH A;  4LYS A;  2RI7 A;  5CQA A;  4LYW A;  4NXJ A;  4OGJ A;  3UVW A;  4ALH A;  4YBS A;  4LZR A;  5FB0 A;  4YYK A;  5D3P A;  5FFV A;  5HEM A;  5CFW A;  5IGM A;  4QSX A;  5ENF A;  4Z1Q A;  3SVF A;  4HXN A;  5F3A A;  1WUM A;  4HBV A;  4NUD A;  5A5R A;  4C66 A;  5FE8 A;  3G0L A;  4NR6 A;  5DYU A;  5EWW A;  2RNW A;  5L96 A;  5DYX A;  5HRW A;  4XY8 A;  5ENI A;  3JVJ A;  4UIV A;  5EV9 A;  5DFD A;  5HFQ A;  4XUA A;  4UIY A;  4UYH A;  5D3J A;  4QSU A;  5D3H A;  4IR3 A;  3DAI A;  5DKD A;  5LUU A;  2YDW A;  5CU8 A;  4UIX A;  4IOQ A;  3U5P A;  3MUL A;  5J0D A;  5AME A;  3UV4 A;  4C67 A;  5F61 A;  5IBN A;  4LDF A;  4MR3 A;  5ENE A;  3U5K A;  4WHU A;  5IGK A;  4YAB A;  4UIW A;  2RNX A;  4QSP A;  3UV5 A;  4PKL A;  2DVR A;  5DYA A;  3GG3 A;  5D0C A;  5E7D A;  5D3T A;  4YYJ A;  5F60 A;  2OO1 A;  5CRM A;  5ETD A;  4Z93 A;  5I83 A;  5CQ6 A;  4NUC A;  5EPR A;  2E7O A;  5FB1 A;  5EPS A;  5FH8 A;  5HJC A;  3LQI A;  5ENG A;  2D82 A;  5E3D A;  4O7A A;  5FG4 A;  3U5L A;  5A81 A;  4MR6 A;  4QSQ A;  5F1L A;  5I89 A;  4IOO A;  3FKM X;  4QSR A;  5E9L A;  1X0J A;  3QZT A;  5D3N A;  4Q0O A;  3MB4 A;  4BW4 A;  4QEU A;  4Q0N A;  3G0J A;  4NYV A;  5CUC A;  4TU6 A;  2MJV B;  4QC3 A;  5D3S A;  4BJX A;  3NXB A;  4Z6H A;  5FE7 A;  4UYE A;  2G4A A;  2R0Y A;  4A9I A;  1F68 A;  5D7X A;  5A5Q A;  2YEM A;  5G4S A;  5C7N A;  4O7C A;  5FE9 A;  5DYC A;  5DLX A;  4N3W A;  3SVG A;  5FE1 A;  2N9G A;  3Q2E A;  5F2P A;  3LJW A;  3S92 A;  4QR4 A;  5EWD A;  5H1U A;  4RVR A;  2DVS A;  4LR6 A;  2DVQ A;  5LKT A;  5I7X A;  4HXP A;  5FE5 A;  4A9N A;  3I3J A;  5EWV A;  4A9F A;  5DBM A;  5TCM A;  4QC1 A;  4XUB A;  5DKC A;  2L85 A;  5CUE A;  5LKU A;  4BW2 A;  4O7E A;  5A5S A;  3LQJ A;  4KV1 A;  3RCW A;  5LKZ A;  2R10 A;  2I8N A;  5C4Q A;  5JI8 A;  2NXB A;  4O72 A;  4CUP A;  5F1H A;  4N4F A;  5LJ2 A;  5DFC A;  4HXL A;  4UYF B;  5CQ4 A;  4YYG A;  4IR4 A;  4NQM A;  4QSW A;  5H85 A;  3JVK A;  4UYF A;  4A9J A;  5I1Q A;  3O33 A;  2RFJ A;  2WP1 A;  4CUS A;  4ZC9 A;  4MR5 A;  4A9K A;  4WIV A;  4N4I A;  4NYW A;  5COI A;  5A85 A;  5CZG A;  4NYX A;  5EWH A;  2YYN A;  3S91 A;  5LJ0 A;  2RS9 B;  4HXK A;  5A5N A;  2H60 A;  1EQF A;  5BT4 A;  5E9Y A;  5HRV A;  5AMF A;  3UW9 A;  4Z1S A;  4E96 A;  2R0V A;  4TU4 A;  4PCE A;  4A9H A;  4QUU A;  2YEL A;  4N4H A;  2D9E A;  2GRC A;  4UYG A;  4QZS A;  4PS5 A;  5I86 A;  4QR3 A;  3U5N A;  5FE2 A;  4A9M A;  5LVQ A;  4XYA A;  4NRB A;  5LVR A;  4TYL A;  4HXO A;  4NR5 A;  5F63 A;  4KV4 A;  5H1V A;  3U5O A;  3O37 A;  5C87 A;  5FG6 A;  4YC9 A;  5A5O A;  5HQ6 A;  4N4G A;  5DLZ A;  4OGI A;  4YAT A;  3U5J A;  5IG6 A;  4NR7 A;  5D3L A;  5IGL A;  5HEN A;  4YYD A;  4IR5 A;  5EM3 A;  5CRZ A;  4MEP A;  5JWM A;  2I7K A;  3MUK A;  4MEN A;  5D26 A;  5E9I A;  5EQ1 A;  4MEQ A;  4BHW A;  5L8T A;  5FH7 A;  4LYI A;  4O70 A;  5EI4 A;  4O75 A;  4J0S A;  4ZW1 A;  4F3I A;  4HBY A;  4TT2 A;  5EA1 A;  5EU1 A;  5KTU A;  5EGU A;  5HFR A;  5ENH A;  4NRA A;  4YYM A;  5CQT A;  1WUG A;  5DFB A;  5HCL A;  3JVM A;  5CUB A;  5E74 A;  3ONI A;  4NRC A;  5HQ5 A;  5BT5 A;  3D7C A;  5HM0 A;  2LSP B;  5A83 A;  4PTB A;  4UIU A;  5CUA A;  5FG5 A;  2E3K A;  2RNY A;  5LJ1 A;  2KTB B;  3QZS A;  4QNS A;  5DW1 A;  3U5M A;  5KO4 A;  3K2J A;  5A7C A;  4BW3 A;  5L8U A;  5L97 A;  1ZS5 A;  4O71 A;  5FE0 A;  2L5E A;  4KCX A;  5C8G A;  5E0R A;  4TTE A;  4Z6I A;  4WHW A;  5ENJ A;  4A9E A;  4YBM A;  5C85 A;  4NR8 A;  2DAT A;  4YK0 A;  5EPB A;  5CUG A;  2YEK A;  5FDZ A;  5E73 A;  4UIZ A;  4J1P A;  4HXS A;  4CUU A;  4HXR A;  5EK9 A;  4TQN A;  4LZS A;  5HRX A;  2R0S A;  5FH6 A;  5E9K A;  4HXM A;  5EVA A;  5E9V A;  3LXJ A;  1N72 A;  3UVX A;  5ENC A;  4MR4 A;  5E3G A;  3JVL A;  4TZ2 A;  4QEW A;  2YQD A;  4QEV A;  5ETB A;  5CQ5 A;  5CY9 A;  2WP2 A;  5CQ3 A;  1JSP B;  4ZQL A;  4PY6 A;  2YW5 A;  4DON A;  5IGN A;  5DX4 A;  4NR9 A;  4O78 A;  5CP5 A;  3P1E A;  5KTW A;  4QR5 A;  4YYI A;  4CL9 A;  4O7F A;  5KTX A;  5HQ7 A;  5FE6 A;  5H1T A;  5CS8 A;  3O35 A;  3TLP A;  4QYL A;  3AQA A;  2DWW A;  4TT6 A;  2DKW A;  4QSV A;  4O7B A;  2L84 A;  5F5Z A;  4YAX A;  4QBM A;  4NQN A; 
#chains in the Genus database with same CATH topology
 4NR4 A;  3HME A;  2F6J A;  5FE4 A;  5CPE A;  5I80 A;  1E6I A;  4PCI A;  5CTL A;  4LRG A;  5DKH A;  4HBW A;  5TB6 A;  5D3R A;  5D25 A;  4IR6 A;  4ALG A;  5HLS A;  5C89 A;  2OSS A;  4QUT A;  4YH3 A;  3O36 A;  4GPJ A;  5FE3 A;  5CQ7 A;  5D24 A;  5L99 A;  5L98 A;  4XY9 A;  3LQH A;  5FFW A;  3O34 A;  3P1C A;  4A9L A;  4CUQ A;  2DVV A;  5G4R A;  2RO1 A;  3HMH A;  4QSS A;  5EWC A;  4UIT A;  5KU3 A;  5DW2 A;  4YBT A;  4O77 A;  3UVY A;  5BT3 A;  4LC2 A;  4QY4 A;  3IU5 A;  3HMF A;  4TZ8 A;  5K29 A;  2F6N A;  5I7Y A;  4QB3 A;  4TT4 A;  3Q2F A;  5EIC A;  5FFY A;  5AD2 A;  4LZ2 A;  5E9M A;  4YY6 A;  4Y03 A;  1JM4 B;  4J0R A;  5IID A;  4NS5 A;  4CFK A;  4TS8 A;  5FBX A;  5CGP A;  4IOR A;  4X2I A;  5II2 A;  4YY4 A;  4HBX A;  5A82 A;  4A9O A;  4FLP A;  4CUT A;  5F36 A;  5I40 A;  3AAD A;  5CQ8 A;  4CUR A;  2FSA A;  4YAD A;  3UV2 A;  4AKN A;  4OUF A;  5DY7 A;  2E7N A;  3SVH A;  4O76 A;  4BW1 A;  5A5P A;  4CFL A;  3P5O A;  4QYD A;  3UVD A;  4NUE A;  4CLB A;  3IU6 A;  3MXF A;  5EIS A;  2OUO A;  4MEO A;  5I88 A;  4O74 A;  5F62 A;  5ACY A;  4QST A;  5KHM A;  5II1 A;  5EP7 A;  3QZV A;  3MQM A;  4UYD A;  3P1F A;  3P1D A;  5I29 A;  5AD3 A;  5HEL A;  4YH4 A;  5ENB A;  3DWY A;  3MB3 A;  3ZYU A;  4J3I A;  4YYN A;  5F25 A;  5CUD A;  3D1B A;  4YYH A;  5LKX A;  4LYS A;  2RI7 A;  5CQA A;  4LYW A;  4NXJ A;  4OGJ A;  3UVW A;  4ALH A;  4YBS A;  4LZR A;  5FB0 A;  4YYK A;  5D3P A;  5FFV A;  5HEM A;  5CFW A;  5IGM A;  4QSX A;  5ENF A;  4Z1Q A;  3SVF A;  4HXN A;  5F3A A;  1WUM A;  4HBV A;  4NUD A;  5A5R A;  1ZKR A;  4C66 A;  5FE8 A;  3G0L A;  4NR6 A;  5DYU A;  5EWW A;  2RNW A;  5L96 A;  5DYX A;  5HRW A;  4XY8 A;  5ENI A;  3JVJ A;  4UIV A;  5EV9 A;  5DFD A;  5HFQ A;  4XUA A;  1PUO A;  4UIY A;  4UYH A;  5D3J A;  4QSU A;  5D3H A;  4IR3 A;  3DAI A;  5DKD A;  5LUU A;  2YDW A;  5CU8 A;  4UIX A;  4IOQ A;  3U5P A;  3MUL A;  5J0D A;  5AME A;  3UV4 A;  4C67 A;  5F61 A;  5IBN A;  4LDF A;  4MR3 A;  5ENE A;  3U5K A;  4WHU A;  5IGK A;  4YAB A;  4UIW A;  4AKH A;  2RNX A;  4QSP A;  3UV5 A;  4PKL A;  2DVR A;  5DYA A;  3GG3 A;  5D0C A;  5E7D A;  5D3T A;  4YYJ A;  5F60 A;  2OO1 A;  5CRM A;  5ETD A;  4Z93 A;  5I83 A;  5CQ6 A;  4NUC A;  5EPR A;  2E7O A;  5FB1 A;  5EPS A;  5FH8 A;  5HJC A;  3LQI A;  5ENG A;  2D82 A;  5E3D A;  4O7A A;  5FG4 A;  3U5L A;  5A81 A;  4MR6 A;  4QSQ A;  5F1L A;  5I89 A;  4IOO A;  3FKM X;  4QSR A;  5E9L A;  1X0J A;  3QZT A;  5D3N A;  4Q0O A;  3MB4 A;  4BW4 A;  4QEU A;  4Q0N A;  3VKG A;  3G0J A;  4NYV A;  5CUC A;  4TU6 A;  2MJV B;  4QC3 A;  5D3S A;  4BJX A;  3NXB A;  4Z6H A;  5FE7 A;  4UYE A;  2G4A A;  2R0Y A;  4A9I A;  1F68 A;  3VKH A;  5D7X A;  4AKG A;  5A5Q A;  2YEM A;  5G4S A;  5C7N A;  4O7C A;  5FE9 A;  5DYC A;  5DLX A;  4N3W A;  3SVG A;  5FE1 A;  2N9G A;  3Q2E A;  5F2P A;  3LJW A;  3S92 A;  4QR4 A;  5EWD A;  5H1U A;  4RVR A;  2DVS A;  4LR6 A;  2DVQ A;  5LKT A;  5I7X A;  4HXP A;  5FE5 A;  4A9N A;  3I3J A;  5EWV A;  4A9F A;  5DBM A;  5TCM A;  4QC1 A;  4XUB A;  5DKC A;  2L85 A;  5CUE A;  5LKU A;  4BW2 A;  4O7E A;  5A5S A;  3LQJ A;  4KV1 A;  3RCW A;  5LKZ A;  2R10 A;  2I8N A;  5C4Q A;  5JI8 A;  2NXB A;  4O72 A;  4CUP A;  5F1H A;  4N4F A;  5LJ2 A;  5DFC A;  4HXL A;  4UYF B;  5CQ4 A;  4YYG A;  4IR4 A;  4NQM A;  4QSW A;  5H85 A;  3JVK A;  4UYF A;  4A9J A;  5I1Q A;  3O33 A;  2RFJ A;  2WP1 A;  4CUS A;  4ZC9 A;  4MR5 A;  4A9K A;  4WIV A;  4N4I A;  4NYW A;  5COI A;  5A85 A;  5CZG A;  4NYX A;  5EWH A;  2YYN A;  3S91 A;  5LJ0 A;  2RS9 B;  4HXK A;  5A5N A;  2H60 A;  1EQF A;  5BT4 A;  5E9Y A;  5HRV A;  5AMF A;  3UW9 A;  4Z1S A;  4E96 A;  2R0V A;  4TU4 A;  4PCE A;  4A9H A;  4QUU A;  2YEL A;  4N4H A;  2D9E A;  2GRC A;  4UYG A;  4QZS A;  4PS5 A;  5I86 A;  4QR3 A;  3U5N A;  5FE2 A;  4A9M A;  5LVQ A;  4XYA A;  4NRB A;  5LVR A;  3D1D A;  4TYL A;  4HXO A;  4NR5 A;  5F63 A;  4KV4 A;  5H1V A;  3U5O A;  3O37 A;  5C87 A;  5FG6 A;  4YC9 A;  5A5O A;  5HQ6 A;  4N4G A;  5DLZ A;  4OGI A;  4YAT A;  3U5J A;  5IG6 A;  4NR7 A;  5D3L A;  5IGL A;  5HEN A;  4YYD A;  4IR5 A;  5EM3 A;  5CRZ A;  4MEP A;  5JWM A;  2I7K A;  3MUK A;  4MEN A;  5D26 A;  5E9I A;  5EQ1 A;  4MEQ A;  4BHW A;  5L8T A;  5FH7 A;  4LYI A;  4AKI A;  4O70 A;  5EI4 A;  3ERR A;  4J0S A;  4O75 A;  4ZW1 A;  4F3I A;  4HBY A;  4TT2 A;  5EA1 A;  5EU1 A;  5KTU A;  5EGU A;  5HFR A;  5ENH A;  4NRA A;  4YYM A;  5CQT A;  1WUG A;  5DFB A;  5HCL A;  3JVM A;  5CUB A;  5E74 A;  3ONI A;  4NRC A;  5HQ5 A;  5BT5 A;  3D7C A;  5HM0 A;  2LSP B;  5A83 A;  4PTB A;  4UIU A;  5CUA A;  5FG5 A;  2E3K A;  2RNY A;  5LJ1 A;  2KTB B;  3QZS A;  4QNS A;  5DW1 A;  3U5M A;  5KO4 A;  3K2J A;  5A7C A;  4BW3 A;  5L8U A;  5L97 A;  1ZS5 A;  4O71 A;  5FE0 A;  2L5E A;  4KCX A;  5C8G A;  5E0R A;  4TTE A;  4Z6I A;  4WHW A;  5ENJ A;  4A9E A;  4YBM A;  5C85 A;  4NR8 A;  2DAT A;  4YK0 A;  5EPB A;  5CUG A;  2YEK A;  5FDZ A;  5E73 A;  4UIZ A;  4J1P A;  4HXS A;  4CUU A;  4HXR A;  5EK9 A;  4TQN A;  4LZS A;  5HRX A;  2R0S A;  5FH6 A;  5E9K A;  4HXM A;  5EVA A;  5E9V A;  3LXJ A;  1N72 A;  3UVX A;  5ENC A;  4MR4 A;  5E3G A;  3JVL A;  4TZ2 A;  4QEW A;  2YQD A;  4QEV A;  5ETB A;  5CQ5 A;  5CY9 A;  2WP2 A;  5CQ3 A;  1JSP B;  4ZQL A;  4PY6 A;  2YW5 A;  4DON A;  2EJN A;  5IGN A;  5DX4 A;  4NR9 A;  4O78 A;  5CP5 A;  3P1E A;  5KTW A;  4QR5 A;  4YYI A;  4CL9 A;  4O7F A;  5KTX A;  5HQ7 A;  5FE6 A;  5H1T A;  5CS8 A;  3O35 A;  3TLP A;  4QYL A;  4AI6 A;  3AQA A;  2DWW A;  4TT6 A;  2DKW A;  4QSV A;  4O7B A;  2L84 A;  5F5Z A;  4YAX A;  4QBM A;  4NQN A; 
#chains in the Genus database with same CATH homology
 4NR4 A;  3HME A;  2F6J A;  5FE4 A;  5CPE A;  5I80 A;  1E6I A;  4PCI A;  5CTL A;  4LRG A;  5DKH A;  4HBW A;  5TB6 A;  5D3R A;  5D25 A;  4IR6 A;  4ALG A;  5HLS A;  5C89 A;  2OSS A;  4QUT A;  4YH3 A;  3O36 A;  4GPJ A;  5FE3 A;  5CQ7 A;  5D24 A;  5L99 A;  5L98 A;  4XY9 A;  3LQH A;  5FFW A;  3O34 A;  3P1C A;  4A9L A;  4CUQ A;  2DVV A;  5G4R A;  2RO1 A;  3HMH A;  4QSS A;  5EWC A;  4UIT A;  5KU3 A;  5DW2 A;  4YBT A;  4O77 A;  3UVY A;  5BT3 A;  4LC2 A;  4QY4 A;  3IU5 A;  3HMF A;  4TZ8 A;  5K29 A;  2F6N A;  5I7Y A;  4QB3 A;  4TT4 A;  3Q2F A;  5EIC A;  5FFY A;  5AD2 A;  4LZ2 A;  5E9M A;  4YY6 A;  4Y03 A;  1JM4 B;  4J0R A;  5IID A;  4NS5 A;  4CFK A;  4TS8 A;  5FBX A;  5CGP A;  4IOR A;  4X2I A;  5II2 A;  4YY4 A;  4HBX A;  5A82 A;  4A9O A;  4FLP A;  4CUT A;  5F36 A;  5I40 A;  3AAD A;  5CQ8 A;  4CUR A;  2FSA A;  4YAD A;  3UV2 A;  4AKN A;  4OUF A;  5DY7 A;  2E7N A;  3SVH A;  4O76 A;  4BW1 A;  5A5P A;  4CFL A;  3P5O A;  4QYD A;  3UVD A;  4NUE A;  4CLB A;  3IU6 A;  3MXF A;  5EIS A;  2OUO A;  4MEO A;  5I88 A;  4O74 A;  5F62 A;  5ACY A;  4QST A;  5KHM A;  5II1 A;  5EP7 A;  3QZV A;  3MQM A;  4UYD A;  3P1F A;  3P1D A;  5I29 A;  5AD3 A;  5HEL A;  4YH4 A;  5ENB A;  3DWY A;  3MB3 A;  3ZYU A;  4J3I A;  4YYN A;  5F25 A;  5CUD A;  5LKX A;  4YYH A;  4LYS A;  2RI7 A;  5CQA A;  4LYW A;  4NXJ A;  4OGJ A;  3UVW A;  4ALH A;  4YBS A;  4LZR A;  5FB0 A;  4YYK A;  5D3P A;  5FFV A;  5HEM A;  5CFW A;  5IGM A;  4QSX A;  5ENF A;  4Z1Q A;  3SVF A;  4HXN A;  5F3A A;  1WUM A;  4HBV A;  4NUD A;  5A5R A;  4C66 A;  5FE8 A;  3G0L A;  4NR6 A;  5DYU A;  5EWW A;  2RNW A;  5L96 A;  5DYX A;  5HRW A;  4XY8 A;  5ENI A;  3JVJ A;  4UIV A;  5EV9 A;  5DFD A;  5HFQ A;  4XUA A;  4UIY A;  4UYH A;  5D3J A;  4QSU A;  5D3H A;  4IR3 A;  3DAI A;  5DKD A;  5LUU A;  2YDW A;  5CU8 A;  4UIX A;  4IOQ A;  3U5P A;  3MUL A;  5J0D A;  5AME A;  3UV4 A;  4C67 A;  5F61 A;  5IBN A;  4LDF A;  4MR3 A;  5ENE A;  3U5K A;  4WHU A;  5IGK A;  4YAB A;  4UIW A;  2RNX A;  4QSP A;  3UV5 A;  4PKL A;  2DVR A;  5DYA A;  3GG3 A;  5D0C A;  5E7D A;  5D3T A;  4YYJ A;  5F60 A;  2OO1 A;  5CRM A;  5ETD A;  4Z93 A;  5I83 A;  5CQ6 A;  4NUC A;  5EPR A;  2E7O A;  5FB1 A;  5EPS A;  5FH8 A;  5HJC A;  3LQI A;  5ENG A;  2D82 A;  5E3D A;  4O7A A;  5FG4 A;  3U5L A;  5A81 A;  4MR6 A;  4QSQ A;  5F1L A;  5I89 A;  4IOO A;  3FKM X;  4QSR A;  5E9L A;  1X0J A;  3QZT A;  5D3N A;  4Q0O A;  3MB4 A;  4BW4 A;  4QEU A;  4Q0N A;  3G0J A;  4NYV A;  5CUC A;  4TU6 A;  2MJV B;  4QC3 A;  5D3S A;  4BJX A;  3NXB A;  4Z6H A;  5FE7 A;  4UYE A;  2G4A A;  2R0Y A;  4A9I A;  1F68 A;  5D7X A;  5A5Q A;  2YEM A;  5G4S A;  5C7N A;  4O7C A;  5FE9 A;  5DYC A;  5DLX A;  4N3W A;  3SVG A;  5FE1 A;  2N9G A;  3Q2E A;  5F2P A;  3LJW A;  3S92 A;  4QR4 A;  5EWD A;  5H1U A;  4RVR A;  2DVS A;  4LR6 A;  2DVQ A;  5LKT A;  5I7X A;  4HXP A;  5FE5 A;  4A9N A;  3I3J A;  5EWV A;  4A9F A;  5DBM A;  5TCM A;  4QC1 A;  4XUB A;  5DKC A;  2L85 A;  5CUE A;  5LKU A;  4BW2 A;  4O7E A;  5A5S A;  3LQJ A;  4KV1 A;  3RCW A;  5LKZ A;  2R10 A;  2I8N A;  5C4Q A;  5JI8 A;  2NXB A;  4O72 A;  4CUP A;  5F1H A;  4N4F A;  5LJ2 A;  5DFC A;  4HXL A;  4UYF B;  5CQ4 A;  4YYG A;  4IR4 A;  4NQM A;  4QSW A;  5H85 A;  3JVK A;  4UYF A;  4A9J A;  5I1Q A;  3O33 A;  2RFJ A;  2WP1 A;  4CUS A;  4ZC9 A;  4MR5 A;  4A9K A;  4WIV A;  4N4I A;  4NYW A;  5COI A;  5A85 A;  5CZG A;  4NYX A;  5EWH A;  2YYN A;  3S91 A;  5LJ0 A;  2RS9 B;  4HXK A;  5A5N A;  2H60 A;  1EQF A;  5BT4 A;  5E9Y A;  5HRV A;  5AMF A;  3UW9 A;  4Z1S A;  4E96 A;  2R0V A;  4TU4 A;  4PCE A;  4A9H A;  4QUU A;  2YEL A;  4N4H A;  2D9E A;  2GRC A;  4UYG A;  4QZS A;  4PS5 A;  5I86 A;  4QR3 A;  3U5N A;  5FE2 A;  4A9M A;  5LVQ A;  4XYA A;  4NRB A;  5LVR A;  4TYL A;  4HXO A;  4NR5 A;  5F63 A;  4KV4 A;  5H1V A;  3U5O A;  3O37 A;  5C87 A;  5FG6 A;  4YC9 A;  5A5O A;  5HQ6 A;  4N4G A;  5DLZ A;  4OGI A;  4YAT A;  3U5J A;  5IG6 A;  4NR7 A;  5D3L A;  5IGL A;  5HEN A;  4YYD A;  4IR5 A;  5EM3 A;  5CRZ A;  4MEP A;  5JWM A;  2I7K A;  3MUK A;  4MEN A;  5D26 A;  5E9I A;  5EQ1 A;  4MEQ A;  4BHW A;  5L8T A;  5FH7 A;  4LYI A;  4O70 A;  5EI4 A;  4O75 A;  4J0S A;  4ZW1 A;  4F3I A;  4HBY A;  4TT2 A;  5EA1 A;  5EU1 A;  5KTU A;  5EGU A;  5HFR A;  5ENH A;  4NRA A;  4YYM A;  5CQT A;  1WUG A;  5DFB A;  5HCL A;  3JVM A;  5CUB A;  5E74 A;  3ONI A;  4NRC A;  5HQ5 A;  5BT5 A;  3D7C A;  5HM0 A;  2LSP B;  5A83 A;  4PTB A;  4UIU A;  5CUA A;  5FG5 A;  2E3K A;  2RNY A;  5LJ1 A;  2KTB B;  3QZS A;  4QNS A;  5DW1 A;  3U5M A;  5KO4 A;  3K2J A;  5A7C A;  4BW3 A;  5L8U A;  5L97 A;  1ZS5 A;  4O71 A;  5FE0 A;  2L5E A;  4KCX A;  5C8G A;  5E0R A;  4TTE A;  4Z6I A;  4WHW A;  5ENJ A;  4A9E A;  4YBM A;  5C85 A;  4NR8 A;  2DAT A;  4YK0 A;  5EPB A;  5CUG A;  2YEK A;  5FDZ A;  5E73 A;  4UIZ A;  4J1P A;  4HXS A;  4CUU A;  4HXR A;  5EK9 A;  4TQN A;  4LZS A;  5HRX A;  2R0S A;  5FH6 A;  5E9K A;  4HXM A;  5EVA A;  5E9V A;  3LXJ A;  1N72 A;  3UVX A;  5ENC A;  4MR4 A;  5E3G A;  3JVL A;  4TZ2 A;  4QEW A;  2YQD A;  4QEV A;  5ETB A;  5CQ5 A;  5CY9 A;  2WP2 A;  5CQ3 A;  1JSP B;  4ZQL A;  4PY6 A;  2YW5 A;  4DON A;  5IGN A;  5DX4 A;  4NR9 A;  4O78 A;  5CP5 A;  3P1E A;  5KTW A;  4QR5 A;  4YYI A;  4CL9 A;  4O7F A;  5KTX A;  5HQ7 A;  5FE6 A;  5H1T A;  5CS8 A;  3O35 A;  3TLP A;  4QYL A;  3AQA A;  2DWW A;  4TT6 A;  2DKW A;  4QSV A;  4O7B A;  2L84 A;  5F5Z A;  4YAX A;  4QBM A;  4NQN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...