5HELA

Crystal structure of the n-terminus y153h bromodomain mutant of human brd2
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
119
structure length
119
Chain Sequence
SMKPGRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGTIKRRLENNYYWAASECMQDFNTMFTNCHIYNKPTDDIVLMAQTLEKIFLQKVASMPQEEQEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bromodomain-containing protein 2
publication title Crystal structure of the N-terminus Y153H bromodomain mutant of human BRD2
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 39
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2016-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5helA00
2YEKA 5DLXA 4N3WA 4NQNA 2R0VA 3MB4A 4CFLA 5HENA 3UVWA 3UV4A 4LYWA 4UYHA 4CUTA 3ZYUA 4YYIA 5DYXA 2E3KA 4QSXA 5I83A 4QEUA 5A83A 4CUSA 3S91A 2L84A 5FDZA 4MEQA 5ENGA 5A5PA 5TCMA 5D3JA 5D7XA 4QSPA 4FLPA 5CUCA 5KO4A 4YATA 4IOOA 4O7FA 4TU6A 4XUBA 3IU5A 4QB3A 4YBTA 5KU3A 4QUTA 4IR5A 4NR8A 2R0SA 4LYSA 5CRMA 1X0JA 5CQAA 4N4IA 4HXOA 2NXBA 4HXSA 5I80A 5EI4A 5FFWA 5FFVA 3U5MA 5F3AA 5EVAA 5H1VA 5EWHA 5I86A 5K29A 3LXJA 2DVSA 4MENA 5HFQA 5LKTA 5FE2A 3MXFA 5D3HA 5A5NA 3UVDA 5C87A 4UYFB 2F6JA 4PKLA 3P1CA 4QNSA 5CRZA 5CUAA 5ENFA 5ENIA 5D25A 5HQ6A 5EWCA 4NRBA 2DWWA 2RS9B 3MB3A 2FSAA 3LQIA 4XY9A 3QZSA 5EPBA 5C4QA 5HRVA 4NUDA 4AKNA 5I29A 4O7BA 3UVYA 1F68A 4QR4A 4OUFA 4ALHA 5J0DA 4X2IA 3IU6A 1JSPB 2WP2A 4Z6HA 4Z93A 5EPSA 4NUEA 5F60A 5HEMA 5E74A 5KTXA 5DW2A 5EV9A 1WUGA 5G4SA 5DFBA 4XUAA 5DFCA 3HMHA 1EQFA 4GPJA 4O7EA 2D82A 4N4HA 4ALGA 4YYMA 3O34A 2GRCA 5E3DA 5EICA 5F1LA 5I88A 3U5JA 4UIXA 5LUUA 2YW5A 5HJCA 4WHUA 4IORA 3Q2FA 5A82A 4TQNA 5CQ4A 2OUOA 5BT5A 2YDWA 4RVRA 5HQ7A 2R10A 4KV4A 5HQ5A 5D26A 3G0JA 5EP7A 5F36A 4NYVA 3JVLA 4O77A 5II2A 5D3SA 5ENCA 3P5OA 2I8NA 4ZC9A 4LZSA 5II1A 5L99A 4PCEA 4Z1SA 3LQHA 4LZ2A 3RCWA 2YQDA 5AD3A 5F5ZA 4NR6A 4XY8A 4TYLA 5CFWA 3Q2EA 4IR3A 5TB6A 4XYAA 4A9KA 5HCLA 5LJ1A 3UV5A 5D24A 5L97A 3I3JA 5E9IA 4QSQA 5CTLA 3UV2A 5E9VA 2DVRA 5BT4A 5FE8A 4DONA 4QR5A 5FE5A 4J0SA 5FFYA 2D9EA 5IBNA 5LJ2A 4YYNA 4CFKA 4YBMA 5CP5A 5CPEA 4OGJA 4YK0A 4BJXA 1ZS5A 5FE9A 3DWYA 4QSRA 5JI8A 5ENEA 4QZSA 2I7KA 4YY6A 5FB1A 3D7CA 5F25A 5LKXA 3GG3A 4A9JA 5ACYA 4TTEA 3SVGA 4C67A 4BW3A 5A85A 3JVMA 5HLSA 4CUQA 5DX4A 4TT6A 5CU8A 5EQ1A 3DAIA 3S92A 4A9MA 3MUKA 4BHWA 5HRXA 5CZGA 4TZ8A 4YADA 4O72A 4N4FA 5E9KA 4BW2A 4WIVA 4NQMA 2RO1A 4Z6IA 3UW9A 5A7CA 4OGIA 4UIYA 5D3RA 2DVVA 2RNWA 3LQJA 4NR4A 5E0RA 5KHMA 4ZW1A 4YY4A 4QUUA 5CQ6A 4MR5A 5CS8A 5H1UA 5IGKA 4QSWA 4TT2A 5EU1A 5EWVA 5HFRA 5H85A 3UVXA 3ONIA 4A9HA 5C85A 4LR6A 4O74A 4YYDA 5A5QA 3AQAA 5C89A 4J3IA 2YELA 4UIZA 5DYCA 5HELA 4F3IA 4UIVA 4PCIA 4YC9A 5CQ3A 4E96A 5HM0A 2DVQA 5EPRA 4QC3A 4NYWA 3U5NA 5FG4A 4O76A 2E7NA 4O7AA 5EGUA 4O78A 4YH4A 4MR4A 4HBWA 5DY7A 5EWWA 2DATA 5F1HA 5DYUA 5BT3A 4UIWA 4IR4A 2R0YA 4QSUA 4NRAA 3O36A 4YBSA 4Q0NA 3QZTA 5EA1A 5CQ8A 4QR3A 4Y03A 4NR9A 2OSSA 3JVJA 4A9IA 4Q0OA 4LC2A 4A9LA 3MQMA 4LYIA 5FE0A 3P1EA 5CUGA 5HRWA 2RNXA 5E73A 5FH8A 4IR6A 4QY4A 2L85A 5ENHA 4NR7A 3SVHA 4CLBA 5ETDA 5A5OA 2H60A 3QZVA 2OO1A 5F62A 5CQ7A 4CUUA 5FG5A 5I1QA 1JM4B 5DLZA 4LZRA 2G4AA 4YYKA 4UITA 5CUEA 5CQ5A 3U5LA 5EM3A 4UYGA 4WHWA 4TS8A 5D3PA 5CUDA 3NXBA 4C66A 4CUPA 4NYXA 5I7XA 4HXNA 3LJWA 5C7NA 4YH3A 5FG6A 4NS5A 5C8GA 5FE6A 5DFDA 4NUCA 4Z1QA 5LVRA 3FKMX 5G4RA 4N4GA 5D0CA 4J1PA 5FE1A 5A81A 5L8TA 5L96A 4KCXA 5IIDA 4A9EA 5E9MA 4O70A 5KTWA 4MR6A 4CURA 5FB0A 4QEVA 3P1DA 5CY9A 5I89A 2KTBB 5I40A 4NR5A 4QYDA 4KV1A 2L5EA 5EISA 3SVFA 2RI7A 4HBYA 5IGMA 5F61A 5D3NA 4O7CA 1E6IA 3O33A 3K2JA 4YYHA 4QEWA 4UYFA 5DBMA 3U5PA 5JWMA 2DKWA 5LJ0A 5DYAA 4QSSA 5CQTA 5F63A 5IGLA 4A9NA 5A5RA 3O35A 5LVQA 3TLPA 1N72A 1WUMA 5AD2A 4PTBA 5FH7A 5D3LA 4YYGA 4HXKA 4YABA 4NRCA 5E3GA 4ZQLA 5L8UA 5I7YA 4BW4A 3O37A 5FE3A 4HBXA 2E7OA 4PY6A 4QYLA 4MR3A 5DW1A 4BW1A 5EK9A 3P1FA 2LSPB 5L98A 4MEOA 3AADA 5CUBA 3G0LA 5FE7A 3HMEA 5FE4A 2RFJA 4QSTA 5E9YA 5DKDA 4TZ2A 3JVKA 4YAXA 5ETBA 4MEPA 5ENJA 4IOQA 4O71A 4PS5A 4HXPA 2N9GA 4QSVA 5F2PA 2F6NA 5DKCA 4UYDA 4TT4A 4LDFA 5FH6A 4A9FA 4J0RA 4QBMA 5E7DA 4YYJA 5EWDA 4UIUA 5IGNA 4HXLA 2YYNA 5H1TA 4QC1A 4UYEA 5ENBA 5AMEA 3U5KA 5FBXA 5A5SA 4TU4A 4A9OA 2WP1A 3U5OA 5DKHA 2RNYA 4HXMA 3MULA 4NXJA 5CGPA 5COIA 2MJVB 4CL9A 5LKUA 5E9LA 4LRGA 5KTUA 5LKZA 5AMFA 4O75A 3HMFA 2YEMA 5D3TA 4HXRA 5IG6A 4HBVA
chains in the Genus database with same CATH superfamily
2YEKA 5DLXA 4N3WA 4NQNA 2R0VA 3MB4A 4CFLA 5HENA 3UVWA 3UV4A 4LYWA 4UYHA 4CUTA 3ZYUA 4YYIA 5DYXA 2E3KA 4QSXA 5I83A 4QEUA 5A83A 4CUSA 3S91A 2L84A 5FDZA 4MEQA 5ENGA 5A5PA 5TCMA 5D3JA 5D7XA 4QSPA 4FLPA 5CUCA 5KO4A 4YATA 4IOOA 4O7FA 4TU6A 4XUBA 3IU5A 4QB3A 4YBTA 5KU3A 4QUTA 4IR5A 4NR8A 2R0SA 4LYSA 5CRMA 1X0JA 5CQAA 4N4IA 4HXOA 2NXBA 4HXSA 5I80A 5EI4A 5FFWA 5FFVA 3U5MA 5F3AA 5EVAA 5H1VA 5EWHA 5I86A 5K29A 3LXJA 2DVSA 4MENA 5HFQA 5LKTA 5FE2A 3MXFA 5D3HA 5A5NA 3UVDA 5C87A 4UYFB 2F6JA 4PKLA 3P1CA 4QNSA 5CRZA 5CUAA 5ENFA 5ENIA 5D25A 5HQ6A 5EWCA 4NRBA 2DWWA 2RS9B 3ERRA 2FSAA 3LQIA 3MB3A 3QZSA 4XY9A 5EPBA 5C4QA 5HRVA 4NUDA 4AKNA 5I29A 4O7BA 3UVYA 1F68A 4QR4A 4OUFA 4ALHA 5J0DA 4X2IA 3IU6A 1JSPB 2WP2A 4Z6HA 4Z93A 5EPSA 4NUEA 5F60A 5HEMA 5E74A 5KTXA 5DW2A 5EV9A 1WUGA 5G4SA 5DFBA 4XUAA 5DFCA 3HMHA 1EQFA 4GPJA 4O7EA 2D82A 4N4HA 4ALGA 3VKHA 4YYMA 3O34A 2GRCA 5E3DA 5EICA 5F1LA 5I88A 3U5JA 4UIXA 5LUUA 2YW5A 5HJCA 4WHUA 4IORA 3Q2FA 5A82A 4TQNA 5CQ4A 2OUOA 5BT5A 2YDWA 4RVRA 5HQ7A 2R10A 4KV4A 5HQ5A 5D26A 3G0JA 5EP7A 4AI6A 5F36A 4NYVA 3JVLA 4O77A 5II2A 5D3SA 5ENCA 3P5OA 2I8NA 4ZC9A 4LZSA 5II1A 5L99A 4PCEA 4Z1SA 3LQHA 4LZ2A 3RCWA 2YQDA 5AD3A 5F5ZA 4NR6A 4XY8A 4TYLA 5CFWA 3Q2EA 4IR3A 5TB6A 4XYAA 4A9KA 5HCLA 5LJ1A 3UV5A 5D24A 5L97A 3I3JA 5E9IA 4QSQA 5CTLA 3D1BA 3UV2A 5E9VA 2DVRA 5BT4A 5FE8A 4DONA 4QR5A 5FE5A 4J0SA 5FFYA 2D9EA 4AKGA 5IBNA 5LJ2A 4YYNA 4CFKA 4YBMA 5CP5A 5CPEA 4OGJA 4YK0A 4AKHA 4BJXA 1ZS5A 5FE9A 3DWYA 4QSRA 5JI8A 5ENEA 4QZSA 2I7KA 4YY6A 5FB1A 3D7CA 5F25A 5LKXA 3GG3A 4A9JA 5ACYA 4TTEA 3SVGA 4C67A 4BW3A 5A85A 3JVMA 5HLSA 4CUQA 5DX4A 4TT6A 5CU8A 5EQ1A 3DAIA 3S92A 4A9MA 3MUKA 4BHWA 5HRXA 5CZGA 2EJNA 4TZ8A 4YADA 4O72A 4N4FA 5E9KA 4BW2A 4WIVA 4NQMA 2RO1A 4Z6IA 3UW9A 5A7CA 4OGIA 4UIYA 5D3RA 2DVVA 2RNWA 3LQJA 4NR4A 5E0RA 5KHMA 4ZW1A 4YY4A 4QUUA 5CQ6A 4MR5A 5CS8A 5H1UA 5IGKA 4QSWA 4TT2A 5EU1A 5EWVA 5HFRA 5H85A 3UVXA 3ONIA 4A9HA 5C85A 4LR6A 4O74A 4YYDA 5A5QA 3AQAA 5C89A 4J3IA 2YELA 4UIZA 5DYCA 5HELA 4F3IA 4UIVA 4PCIA 4YC9A 5CQ3A 4E96A 5HM0A 2DVQA 5EPRA 4QC3A 4NYWA 3U5NA 5FG4A 4O76A 2E7NA 4O7AA 5EGUA 4O78A 4YH4A 4MR4A 4HBWA 5DY7A 5EWWA 2DATA 5F1HA 5DYUA 5BT3A 4UIWA 4IR4A 2R0YA 4QSUA 4NRAA 3O36A 4YBSA 4Q0NA 3QZTA 5EA1A 5CQ8A 4QR3A 4Y03A 4NR9A 2OSSA 3JVJA 4A9IA 4Q0OA 4LC2A 4A9LA 3MQMA 4LYIA 5FE0A 3P1EA 5CUGA 5HRWA 2RNXA 5E73A 5FH8A 4IR6A 4QY4A 2L85A 5ENHA 4NR7A 3SVHA 4CLBA 5ETDA 5A5OA 2H60A 3QZVA 2OO1A 5F62A 5CQ7A 4CUUA 5FG5A 5I1QA 1JM4B 5DLZA 4LZRA 2G4AA 4YYKA 4UITA 5CUEA 5CQ5A 3U5LA 5EM3A 4UYGA 4WHWA 4TS8A 5D3PA 5CUDA 3NXBA 4C66A 4CUPA 4NYXA 5I7XA 4HXNA 3LJWA 5C7NA 4YH3A 5FG6A 4NS5A 5C8GA 5FE6A 5DFDA 4NUCA 4Z1QA 1ZKRA 5LVRA 3FKMX 5G4RA 4N4GA 5D0CA 4J1PA 5FE1A 5A81A 5L8TA 5L96A 4KCXA 5IIDA 4A9EA 5E9MA 4O70A 5KTWA 4MR6A 4CURA 5FB0A 4QEVA 3P1DA 5CY9A 5I89A 2KTBB 5I40A 4NR5A 4QYDA 4KV1A 2L5EA 5EISA 3SVFA 2RI7A 4HBYA 5IGMA 5F61A 5D3NA 4O7CA 1E6IA 3O33A 3K2JA 4YYHA 4QEWA 4UYFA 5DBMA 3U5PA 5JWMA 2DKWA 5LJ0A 5DYAA 4QSSA 5CQTA 5F63A 5IGLA 4A9NA 5A5RA 3O35A 5LVQA 3TLPA 1N72A 1PUOA 1WUMA 5AD2A 4PTBA 5FH7A 5D3LA 4YYGA 4HXKA 4YABA 4NRCA 5E3GA 4ZQLA 5L8UA 5I7YA 4BW4A 3O37A 3D1DA 5FE3A 4HBXA 2E7OA 4PY6A 4QYLA 4MR3A 5DW1A 4BW1A 5EK9A 3P1FA 2LSPB 5L98A 4MEOA 3AADA 5CUBA 3G0LA 5FE7A 3HMEA 5FE4A 2RFJA 4QSTA 5E9YA 5DKDA 4TZ2A 3JVKA 4YAXA 5ETBA 4MEPA 5ENJA 4IOQA 4O71A 4PS5A 4HXPA 2N9GA 4QSVA 5F2PA 2F6NA 5DKCA 4UYDA 4TT4A 4LDFA 5FH6A 3VKGA 4A9FA 4J0RA 4QBMA 5E7DA 4YYJA 5EWDA 4UIUA 5IGNA 4HXLA 2YYNA 5H1TA 4QC1A 4UYEA 5ENBA 5AMEA 3U5KA 4AKIA 5FBXA 5A5SA 4TU4A 4A9OA 2WP1A 3U5OA 5DKHA 2RNYA 4HXMA 3MULA 4NXJA 5CGPA 5COIA 2MJVB 4CL9A 5LKUA 5E9LA 4LRGA 5KTUA 5LKZA 5AMFA 4O75A 3HMFA 2YEMA 5D3TA 4HXRA 5IG6A 4HBVA
chains in the Genus database with same CATH topology
2YEKA 5DLXA 4N3WA 4NQNA 2R0VA 3MB4A 4CFLA 5HENA 3UVWA 3UV4A 4LYWA 4UYHA 4CUTA 3ZYUA 4YYIA 5DYXA 2E3KA 4QSXA 5I83A 4QEUA 5A83A 4CUSA 3S91A 2L84A 5FDZA 4MEQA 5ENGA 5A5PA 5TCMA 5D3JA 5D7XA 4QSPA 4FLPA 5CUCA 5KO4A 4YATA 4IOOA 4O7FA 4TU6A 4XUBA 3IU5A 4QB3A 4YBTA 5KU3A 4QUTA 4IR5A 4NR8A 2R0SA 4LYSA 5CRMA 1X0JA 5CQAA 4N4IA 4HXOA 2NXBA 4HXSA 5I80A 5EI4A 5FFWA 5FFVA 3U5MA 5F3AA 5EVAA 5H1VA 5EWHA 5I86A 5K29A 3LXJA 2DVSA 4MENA 5HFQA 5LKTA 5FE2A 3MXFA 5D3HA 5A5NA 3UVDA 5C87A 4UYFB 2F6JA 4PKLA 3P1CA 4QNSA 5CRZA 5CUAA 5ENFA 5ENIA 5D25A 5HQ6A 5EWCA 4NRBA 2DWWA 2RS9B 3MB3A 2FSAA 3LQIA 4XY9A 3QZSA 5EPBA 5C4QA 5HRVA 4NUDA 4AKNA 5I29A 4O7BA 3UVYA 1F68A 4QR4A 4OUFA 4ALHA 5J0DA 4X2IA 3IU6A 1JSPB 2WP2A 4Z6HA 4Z93A 5EPSA 4NUEA 5F60A 5HEMA 5E74A 5KTXA 5DW2A 5EV9A 1WUGA 5G4SA 5DFBA 4XUAA 5DFCA 3HMHA 1EQFA 4GPJA 4O7EA 2D82A 4N4HA 4ALGA 4YYMA 3O34A 2GRCA 5E3DA 5EICA 5F1LA 5I88A 3U5JA 4UIXA 5LUUA 2YW5A 5HJCA 4WHUA 4IORA 3Q2FA 5A82A 4TQNA 5CQ4A 2OUOA 5BT5A 2YDWA 4RVRA 5HQ7A 2R10A 4KV4A 5HQ5A 5D26A 3G0JA 5EP7A 5F36A 4NYVA 3JVLA 4O77A 5II2A 5D3SA 5ENCA 3P5OA 2I8NA 4ZC9A 4LZSA 5II1A 5L99A 4PCEA 4Z1SA 3LQHA 4LZ2A 3RCWA 2YQDA 5AD3A 5F5ZA 4NR6A 4XY8A 4TYLA 5CFWA 3Q2EA 4IR3A 5TB6A 4XYAA 4A9KA 5HCLA 5LJ1A 3UV5A 5D24A 5L97A 3I3JA 5E9IA 4QSQA 5CTLA 3UV2A 5E9VA 2DVRA 5BT4A 5FE8A 4DONA 4QR5A 5FE5A 4J0SA 5FFYA 2D9EA 5IBNA 5LJ2A 4YYNA 4CFKA 4YBMA 5CP5A 5CPEA 4OGJA 4YK0A 4BJXA 1ZS5A 5FE9A 3DWYA 4QSRA 5JI8A 5ENEA 4QZSA 2I7KA 4YY6A 5FB1A 3D7CA 5F25A 5LKXA 3GG3A 4A9JA 5ACYA 4TTEA 3SVGA 4C67A 4BW3A 5A85A 3JVMA 5HLSA 4CUQA 5DX4A 4TT6A 5CU8A 5EQ1A 3DAIA 3S92A 4A9MA 3MUKA 4BHWA 5HRXA 5CZGA 4TZ8A 4YADA 4O72A 4N4FA 5E9KA 4BW2A 4WIVA 4NQMA 2RO1A 4Z6IA 3UW9A 5A7CA 4OGIA 4UIYA 5D3RA 2DVVA 2RNWA 3LQJA 4NR4A 5E0RA 5KHMA 4ZW1A 4YY4A 4QUUA 5CQ6A 4MR5A 5CS8A 5H1UA 5IGKA 4QSWA 4TT2A 5EU1A 5EWVA 5HFRA 5H85A 3UVXA 3ONIA 4A9HA 5C85A 4LR6A 4O74A 4YYDA 5A5QA 3AQAA 5C89A 4J3IA 2YELA 4UIZA 5DYCA 5HELA 4F3IA 4UIVA 4PCIA 4YC9A 5CQ3A 4E96A 5HM0A 2DVQA 5EPRA 4QC3A 4NYWA 3U5NA 5FG4A 4O76A 2E7NA 4O7AA 5EGUA 4O78A 4YH4A 4MR4A 4HBWA 5DY7A 5EWWA 2DATA 5F1HA 5DYUA 5BT3A 4UIWA 4IR4A 2R0YA 4QSUA 4NRAA 3O36A 4YBSA 4Q0NA 3QZTA 5EA1A 5CQ8A 4QR3A 4Y03A 4NR9A 2OSSA 3JVJA 4A9IA 4Q0OA 4LC2A 4A9LA 3MQMA 4LYIA 5FE0A 3P1EA 5CUGA 5HRWA 2RNXA 5E73A 5FH8A 4IR6A 4QY4A 2L85A 5ENHA 4NR7A 3SVHA 4CLBA 5ETDA 5A5OA 2H60A 3QZVA 2OO1A 5F62A 5CQ7A 4CUUA 5FG5A 5I1QA 1JM4B 5DLZA 4LZRA 2G4AA 4YYKA 4UITA 5CUEA 5CQ5A 3U5LA 5EM3A 4UYGA 4WHWA 4TS8A 5D3PA 5CUDA 3NXBA 4C66A 4CUPA 4NYXA 5I7XA 4HXNA 3LJWA 5C7NA 4YH3A 5FG6A 4NS5A 5C8GA 5FE6A 5DFDA 4NUCA 4Z1QA 5LVRA 3FKMX 5G4RA 4N4GA 5D0CA 4J1PA 5FE1A 5A81A 5L8TA 5L96A 4KCXA 5IIDA 4A9EA 5E9MA 4O70A 5KTWA 4MR6A 4CURA 5FB0A 4QEVA 3P1DA 5CY9A 5I89A 2KTBB 5I40A 4NR5A 4QYDA 4KV1A 2L5EA 5EISA 3SVFA 2RI7A 4HBYA 5IGMA 5F61A 5D3NA 4O7CA 1E6IA 3O33A 3K2JA 4YYHA 4QEWA 4UYFA 5DBMA 3U5PA 5JWMA 2DKWA 5LJ0A 5DYAA 4QSSA 5CQTA 5F63A 5IGLA 4A9NA 5A5RA 3O35A 5LVQA 3TLPA 1N72A 1WUMA 5AD2A 4PTBA 5FH7A 5D3LA 4YYGA 4HXKA 4YABA 4NRCA 5E3GA 4ZQLA 5L8UA 5I7YA 4BW4A 3O37A 5FE3A 4HBXA 2E7OA 4PY6A 4QYLA 4MR3A 5DW1A 4BW1A 5EK9A 3P1FA 2LSPB 5L98A 4MEOA 3AADA 5CUBA 3G0LA 5FE7A 3HMEA 5FE4A 2RFJA 4QSTA 5E9YA 5DKDA 4TZ2A 3JVKA 4YAXA 5ETBA 4MEPA 5ENJA 4IOQA 4O71A 4PS5A 4HXPA 2N9GA 4QSVA 5F2PA 2F6NA 5DKCA 4UYDA 4TT4A 4LDFA 5FH6A 4A9FA 4J0RA 4QBMA 5E7DA 4YYJA 5EWDA 4UIUA 5IGNA 4HXLA 2YYNA 5H1TA 4QC1A 4UYEA 5ENBA 5AMEA 3U5KA 5FBXA 5A5SA 4TU4A 4A9OA 2WP1A 3U5OA 5DKHA 2RNYA 4HXMA 3MULA 4NXJA 5CGPA 5COIA 2MJVB 4CL9A 5LKUA 5E9LA 4LRGA 5KTUA 5LKZA 5AMFA 4O75A 3HMFA 2YEMA 5D3TA 4HXRA 5IG6A 4HBVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YEK A;  5DLX A;  4N3W A;  4NQN A;  2R0V A;  3MB4 A;  4CFL A;  5HEN A;  3UVW A;  3UV4 A;  4LYW A;  4UYH A;  4CUT A;  3ZYU A;  4YYI A;  5DYX A;  2E3K A;  4QSX A;  5I83 A;  4QEU A;  5A83 A;  4CUS A;  3S91 A;  2L84 A;  5FDZ A;  4MEQ A;  5ENG A;  5A5P A;  5TCM A;  5D3J A;  5D7X A;  4QSP A;  4FLP A;  5CUC A;  5KO4 A;  4YAT A;  4IOO A;  4O7F A;  4TU6 A;  4XUB A;  3IU5 A;  4QB3 A;  4YBT A;  5KU3 A;  4QUT A;  4IR5 A;  4NR8 A;  2R0S A;  4LYS A;  5CRM A;  1X0J A;  5CQA A;  4N4I A;  4HXO A;  2NXB A;  4HXS A;  5I80 A;  5EI4 A;  5FFW A;  5FFV A;  3U5M A;  5F3A A;  5EVA A;  5H1V A;  5EWH A;  5I86 A;  5K29 A;  3LXJ A;  2DVS A;  4MEN A;  5HFQ A;  5LKT A;  5FE2 A;  3MXF A;  5D3H A;  5A5N A;  3UVD A;  5C87 A;  4UYF B;  2F6J A;  4PKL A;  3P1C A;  4QNS A;  5CRZ A;  5CUA A;  5ENF A;  5ENI A;  5D25 A;  5HQ6 A;  5EWC A;  4NRB A;  2DWW A;  2RS9 B;  3MB3 A;  2FSA A;  3LQI A;  4XY9 A;  3QZS A;  5EPB A;  5C4Q A;  5HRV A;  4NUD A;  4AKN A;  5I29 A;  4O7B A;  3UVY A;  1F68 A;  4QR4 A;  4OUF A;  4ALH A;  5J0D A;  4X2I A;  3IU6 A;  1JSP B;  2WP2 A;  4Z6H A;  4Z93 A;  5EPS A;  4NUE A;  5F60 A;  5HEM A;  5E74 A;  5KTX A;  5DW2 A;  5EV9 A;  1WUG A;  5G4S A;  5DFB A;  4XUA A;  5DFC A;  3HMH A;  1EQF A;  4GPJ A;  4O7E A;  2D82 A;  4N4H A;  4ALG A;  4YYM A;  3O34 A;  2GRC A;  5E3D A;  5EIC A;  5F1L A;  5I88 A;  3U5J A;  4UIX A;  5LUU A;  2YW5 A;  5HJC A;  4WHU A;  4IOR A;  3Q2F A;  5A82 A;  4TQN A;  5CQ4 A;  2OUO A;  5BT5 A;  2YDW A;  4RVR A;  5HQ7 A;  2R10 A;  4KV4 A;  5HQ5 A;  5D26 A;  3G0J A;  5EP7 A;  5F36 A;  4NYV A;  3JVL A;  4O77 A;  5II2 A;  5D3S A;  5ENC A;  3P5O A;  2I8N A;  4ZC9 A;  4LZS A;  5II1 A;  5L99 A;  4PCE A;  4Z1S A;  3LQH A;  4LZ2 A;  3RCW A;  2YQD A;  5AD3 A;  5F5Z A;  4NR6 A;  4XY8 A;  4TYL A;  5CFW A;  3Q2E A;  4IR3 A;  5TB6 A;  4XYA A;  4A9K A;  5HCL A;  5LJ1 A;  3UV5 A;  5D24 A;  5L97 A;  3I3J A;  5E9I A;  4QSQ A;  5CTL A;  3UV2 A;  5E9V A;  2DVR A;  5BT4 A;  5FE8 A;  4DON A;  4QR5 A;  5FE5 A;  4J0S A;  5FFY A;  2D9E A;  5IBN A;  5LJ2 A;  4YYN A;  4CFK A;  4YBM A;  5CP5 A;  5CPE A;  4OGJ A;  4YK0 A;  4BJX A;  1ZS5 A;  5FE9 A;  3DWY A;  4QSR A;  5JI8 A;  5ENE A;  4QZS A;  2I7K A;  4YY6 A;  5FB1 A;  3D7C A;  5F25 A;  5LKX A;  3GG3 A;  4A9J A;  5ACY A;  4TTE A;  3SVG A;  4C67 A;  4BW3 A;  5A85 A;  3JVM A;  5HLS A;  4CUQ A;  5DX4 A;  4TT6 A;  5CU8 A;  5EQ1 A;  3DAI A;  3S92 A;  4A9M A;  3MUK A;  4BHW A;  5HRX A;  5CZG A;  4TZ8 A;  4YAD A;  4O72 A;  4N4F A;  5E9K A;  4BW2 A;  4WIV A;  4NQM A;  2RO1 A;  4Z6I A;  3UW9 A;  5A7C A;  4OGI A;  4UIY A;  5D3R A;  2DVV A;  2RNW A;  3LQJ A;  4NR4 A;  5E0R A;  5KHM A;  4ZW1 A;  4YY4 A;  4QUU A;  5CQ6 A;  4MR5 A;  5CS8 A;  5H1U A;  5IGK A;  4QSW A;  4TT2 A;  5EU1 A;  5EWV A;  5HFR A;  5H85 A;  3UVX A;  3ONI A;  4A9H A;  5C85 A;  4LR6 A;  4O74 A;  4YYD A;  5A5Q A;  3AQA A;  5C89 A;  4J3I A;  2YEL A;  4UIZ A;  5DYC A;  5HEL A;  4F3I A;  4UIV A;  4PCI A;  4YC9 A;  5CQ3 A;  4E96 A;  5HM0 A;  2DVQ A;  5EPR A;  4QC3 A;  4NYW A;  3U5N A;  5FG4 A;  4O76 A;  2E7N A;  4O7A A;  5EGU A;  4O78 A;  4YH4 A;  4MR4 A;  4HBW A;  5DY7 A;  5EWW A;  2DAT A;  5F1H A;  5DYU A;  5BT3 A;  4UIW A;  4IR4 A;  2R0Y A;  4QSU A;  4NRA A;  3O36 A;  4YBS A;  4Q0N A;  3QZT A;  5EA1 A;  5CQ8 A;  4QR3 A;  4Y03 A;  4NR9 A;  2OSS A;  3JVJ A;  4A9I A;  4Q0O A;  4LC2 A;  4A9L A;  3MQM A;  4LYI A;  5FE0 A;  3P1E A;  5CUG A;  5HRW A;  2RNX A;  5E73 A;  5FH8 A;  4IR6 A;  4QY4 A;  2L85 A;  5ENH A;  4NR7 A;  3SVH A;  4CLB A;  5ETD A;  5A5O A;  2H60 A;  3QZV A;  2OO1 A;  5F62 A;  5CQ7 A;  4CUU A;  5FG5 A;  5I1Q A;  1JM4 B;  5DLZ A;  4LZR A;  2G4A A;  4YYK A;  4UIT A;  5CUE A;  5CQ5 A;  3U5L A;  5EM3 A;  4UYG A;  4WHW A;  4TS8 A;  5D3P A;  5CUD A;  3NXB A;  4C66 A;  4CUP A;  4NYX A;  5I7X A;  4HXN A;  3LJW A;  5C7N A;  4YH3 A;  5FG6 A;  4NS5 A;  5C8G A;  5FE6 A;  5DFD A;  4NUC A;  4Z1Q A;  5LVR A;  3FKM X;  5G4R A;  4N4G A;  5D0C A;  4J1P A;  5FE1 A;  5A81 A;  5L8T A;  5L96 A;  4KCX A;  5IID A;  4A9E A;  5E9M A;  4O70 A;  5KTW A;  4MR6 A;  4CUR A;  5FB0 A;  4QEV A;  3P1D A;  5CY9 A;  5I89 A;  2KTB B;  5I40 A;  4NR5 A;  4QYD A;  4KV1 A;  2L5E A;  5EIS A;  3SVF A;  2RI7 A;  4HBY A;  5IGM A;  5F61 A;  5D3N A;  4O7C A;  1E6I A;  3O33 A;  3K2J A;  4YYH A;  4QEW A;  4UYF A;  5DBM A;  3U5P A;  5JWM A;  2DKW A;  5LJ0 A;  5DYA A;  4QSS A;  5CQT A;  5F63 A;  5IGL A;  4A9N A;  5A5R A;  3O35 A;  5LVQ A;  3TLP A;  1N72 A;  1WUM A;  5AD2 A;  4PTB A;  5FH7 A;  5D3L A;  4YYG A;  4HXK A;  4YAB A;  4NRC A;  5E3G A;  4ZQL A;  5L8U A;  5I7Y A;  4BW4 A;  3O37 A;  5FE3 A;  4HBX A;  2E7O A;  4PY6 A;  4QYL A;  4MR3 A;  5DW1 A;  4BW1 A;  5EK9 A;  3P1F A;  2LSP B;  5L98 A;  4MEO A;  3AAD A;  5CUB A;  3G0L A;  5FE7 A;  3HME A;  5FE4 A;  2RFJ A;  4QST A;  5E9Y A;  5DKD A;  4TZ2 A;  3JVK A;  4YAX A;  5ETB A;  4MEP A;  5ENJ A;  4IOQ A;  4O71 A;  4PS5 A;  4HXP A;  2N9G A;  4QSV A;  5F2P A;  2F6N A;  5DKC A;  4UYD A;  4TT4 A;  4LDF A;  5FH6 A;  4A9F A;  4J0R A;  4QBM A;  5E7D A;  4YYJ A;  5EWD A;  4UIU A;  5IGN A;  4HXL A;  2YYN A;  5H1T A;  4QC1 A;  4UYE A;  5ENB A;  5AME A;  3U5K A;  5FBX A;  5A5S A;  4TU4 A;  4A9O A;  2WP1 A;  3U5O A;  5DKH A;  2RNY A;  4HXM A;  3MUL A;  4NXJ A;  5CGP A;  5COI A;  2MJV B;  4CL9 A;  5LKU A;  5E9L A;  4LRG A;  5KTU A;  5LKZ A;  5AMF A;  4O75 A;  3HMF A;  2YEM A;  5D3T A;  4HXR A;  5IG6 A;  4HBV A; 
#chains in the Genus database with same CATH topology
 2YEK A;  5DLX A;  4N3W A;  4NQN A;  2R0V A;  3MB4 A;  4CFL A;  5HEN A;  3UVW A;  3UV4 A;  4LYW A;  4UYH A;  4CUT A;  3ZYU A;  4YYI A;  5DYX A;  2E3K A;  4QSX A;  5I83 A;  4QEU A;  5A83 A;  4CUS A;  3S91 A;  2L84 A;  5FDZ A;  4MEQ A;  5ENG A;  5A5P A;  5TCM A;  5D3J A;  5D7X A;  4QSP A;  4FLP A;  5CUC A;  5KO4 A;  4YAT A;  4IOO A;  4O7F A;  4TU6 A;  4XUB A;  3IU5 A;  4QB3 A;  4YBT A;  5KU3 A;  4QUT A;  4IR5 A;  4NR8 A;  2R0S A;  4LYS A;  5CRM A;  1X0J A;  5CQA A;  4N4I A;  4HXO A;  2NXB A;  4HXS A;  5I80 A;  5EI4 A;  5FFW A;  5FFV A;  3U5M A;  5F3A A;  5EVA A;  5H1V A;  5EWH A;  5I86 A;  5K29 A;  3LXJ A;  2DVS A;  4MEN A;  5HFQ A;  5LKT A;  5FE2 A;  3MXF A;  5D3H A;  5A5N A;  3UVD A;  5C87 A;  4UYF B;  2F6J A;  4PKL A;  3P1C A;  4QNS A;  5CRZ A;  5CUA A;  5ENF A;  5ENI A;  5D25 A;  5HQ6 A;  5EWC A;  4NRB A;  2DWW A;  2RS9 B;  3ERR A;  2FSA A;  3LQI A;  3MB3 A;  3QZS A;  4XY9 A;  5EPB A;  5C4Q A;  5HRV A;  4NUD A;  4AKN A;  5I29 A;  4O7B A;  3UVY A;  1F68 A;  4QR4 A;  4OUF A;  4ALH A;  5J0D A;  4X2I A;  3IU6 A;  1JSP B;  2WP2 A;  4Z6H A;  4Z93 A;  5EPS A;  4NUE A;  5F60 A;  5HEM A;  5E74 A;  5KTX A;  5DW2 A;  5EV9 A;  1WUG A;  5G4S A;  5DFB A;  4XUA A;  5DFC A;  3HMH A;  1EQF A;  4GPJ A;  4O7E A;  2D82 A;  4N4H A;  4ALG A;  3VKH A;  4YYM A;  3O34 A;  2GRC A;  5E3D A;  5EIC A;  5F1L A;  5I88 A;  3U5J A;  4UIX A;  5LUU A;  2YW5 A;  5HJC A;  4WHU A;  4IOR A;  3Q2F A;  5A82 A;  4TQN A;  5CQ4 A;  2OUO A;  5BT5 A;  2YDW A;  4RVR A;  5HQ7 A;  2R10 A;  4KV4 A;  5HQ5 A;  5D26 A;  3G0J A;  5EP7 A;  4AI6 A;  5F36 A;  4NYV A;  3JVL A;  4O77 A;  5II2 A;  5D3S A;  5ENC A;  3P5O A;  2I8N A;  4ZC9 A;  4LZS A;  5II1 A;  5L99 A;  4PCE A;  4Z1S A;  3LQH A;  4LZ2 A;  3RCW A;  2YQD A;  5AD3 A;  5F5Z A;  4NR6 A;  4XY8 A;  4TYL A;  5CFW A;  3Q2E A;  4IR3 A;  5TB6 A;  4XYA A;  4A9K A;  5HCL A;  5LJ1 A;  3UV5 A;  5D24 A;  5L97 A;  3I3J A;  5E9I A;  4QSQ A;  5CTL A;  3D1B A;  3UV2 A;  5E9V A;  2DVR A;  5BT4 A;  5FE8 A;  4DON A;  4QR5 A;  5FE5 A;  4J0S A;  5FFY A;  2D9E A;  4AKG A;  5IBN A;  5LJ2 A;  4YYN A;  4CFK A;  4YBM A;  5CP5 A;  5CPE A;  4OGJ A;  4YK0 A;  4AKH A;  4BJX A;  1ZS5 A;  5FE9 A;  3DWY A;  4QSR A;  5JI8 A;  5ENE A;  4QZS A;  2I7K A;  4YY6 A;  5FB1 A;  3D7C A;  5F25 A;  5LKX A;  3GG3 A;  4A9J A;  5ACY A;  4TTE A;  3SVG A;  4C67 A;  4BW3 A;  5A85 A;  3JVM A;  5HLS A;  4CUQ A;  5DX4 A;  4TT6 A;  5CU8 A;  5EQ1 A;  3DAI A;  3S92 A;  4A9M A;  3MUK A;  4BHW A;  5HRX A;  5CZG A;  2EJN A;  4TZ8 A;  4YAD A;  4O72 A;  4N4F A;  5E9K A;  4BW2 A;  4WIV A;  4NQM A;  2RO1 A;  4Z6I A;  3UW9 A;  5A7C A;  4OGI A;  4UIY A;  5D3R A;  2DVV A;  2RNW A;  3LQJ A;  4NR4 A;  5E0R A;  5KHM A;  4ZW1 A;  4YY4 A;  4QUU A;  5CQ6 A;  4MR5 A;  5CS8 A;  5H1U A;  5IGK A;  4QSW A;  4TT2 A;  5EU1 A;  5EWV A;  5HFR A;  5H85 A;  3UVX A;  3ONI A;  4A9H A;  5C85 A;  4LR6 A;  4O74 A;  4YYD A;  5A5Q A;  3AQA A;  5C89 A;  4J3I A;  2YEL A;  4UIZ A;  5DYC A;  5HEL A;  4F3I A;  4UIV A;  4PCI A;  4YC9 A;  5CQ3 A;  4E96 A;  5HM0 A;  2DVQ A;  5EPR A;  4QC3 A;  4NYW A;  3U5N A;  5FG4 A;  4O76 A;  2E7N A;  4O7A A;  5EGU A;  4O78 A;  4YH4 A;  4MR4 A;  4HBW A;  5DY7 A;  5EWW A;  2DAT A;  5F1H A;  5DYU A;  5BT3 A;  4UIW A;  4IR4 A;  2R0Y A;  4QSU A;  4NRA A;  3O36 A;  4YBS A;  4Q0N A;  3QZT A;  5EA1 A;  5CQ8 A;  4QR3 A;  4Y03 A;  4NR9 A;  2OSS A;  3JVJ A;  4A9I A;  4Q0O A;  4LC2 A;  4A9L A;  3MQM A;  4LYI A;  5FE0 A;  3P1E A;  5CUG A;  5HRW A;  2RNX A;  5E73 A;  5FH8 A;  4IR6 A;  4QY4 A;  2L85 A;  5ENH A;  4NR7 A;  3SVH A;  4CLB A;  5ETD A;  5A5O A;  2H60 A;  3QZV A;  2OO1 A;  5F62 A;  5CQ7 A;  4CUU A;  5FG5 A;  5I1Q A;  1JM4 B;  5DLZ A;  4LZR A;  2G4A A;  4YYK A;  4UIT A;  5CUE A;  5CQ5 A;  3U5L A;  5EM3 A;  4UYG A;  4WHW A;  4TS8 A;  5D3P A;  5CUD A;  3NXB A;  4C66 A;  4CUP A;  4NYX A;  5I7X A;  4HXN A;  3LJW A;  5C7N A;  4YH3 A;  5FG6 A;  4NS5 A;  5C8G A;  5FE6 A;  5DFD A;  4NUC A;  4Z1Q A;  1ZKR A;  5LVR A;  3FKM X;  5G4R A;  4N4G A;  5D0C A;  4J1P A;  5FE1 A;  5A81 A;  5L8T A;  5L96 A;  4KCX A;  5IID A;  4A9E A;  5E9M A;  4O70 A;  5KTW A;  4MR6 A;  4CUR A;  5FB0 A;  4QEV A;  3P1D A;  5CY9 A;  5I89 A;  2KTB B;  5I40 A;  4NR5 A;  4QYD A;  4KV1 A;  2L5E A;  5EIS A;  3SVF A;  2RI7 A;  4HBY A;  5IGM A;  5F61 A;  5D3N A;  4O7C A;  1E6I A;  3O33 A;  3K2J A;  4YYH A;  4QEW A;  4UYF A;  5DBM A;  3U5P A;  5JWM A;  2DKW A;  5LJ0 A;  5DYA A;  4QSS A;  5CQT A;  5F63 A;  5IGL A;  4A9N A;  5A5R A;  3O35 A;  5LVQ A;  3TLP A;  1N72 A;  1PUO A;  1WUM A;  5AD2 A;  4PTB A;  5FH7 A;  5D3L A;  4YYG A;  4HXK A;  4YAB A;  4NRC A;  5E3G A;  4ZQL A;  5L8U A;  5I7Y A;  4BW4 A;  3O37 A;  3D1D A;  5FE3 A;  4HBX A;  2E7O A;  4PY6 A;  4QYL A;  4MR3 A;  5DW1 A;  4BW1 A;  5EK9 A;  3P1F A;  2LSP B;  5L98 A;  4MEO A;  3AAD A;  5CUB A;  3G0L A;  5FE7 A;  3HME A;  5FE4 A;  2RFJ A;  4QST A;  5E9Y A;  5DKD A;  4TZ2 A;  3JVK A;  4YAX A;  5ETB A;  4MEP A;  5ENJ A;  4IOQ A;  4O71 A;  4PS5 A;  4HXP A;  2N9G A;  4QSV A;  5F2P A;  2F6N A;  5DKC A;  4UYD A;  4TT4 A;  4LDF A;  5FH6 A;  3VKG A;  4A9F A;  4J0R A;  4QBM A;  5E7D A;  4YYJ A;  5EWD A;  4UIU A;  5IGN A;  4HXL A;  2YYN A;  5H1T A;  4QC1 A;  4UYE A;  5ENB A;  5AME A;  3U5K A;  4AKI A;  5FBX A;  5A5S A;  4TU4 A;  4A9O A;  2WP1 A;  3U5O A;  5DKH A;  2RNY A;  4HXM A;  3MUL A;  4NXJ A;  5CGP A;  5COI A;  2MJV B;  4CL9 A;  5LKU A;  5E9L A;  4LRG A;  5KTU A;  5LKZ A;  5AMF A;  4O75 A;  3HMF A;  2YEM A;  5D3T A;  4HXR A;  5IG6 A;  4HBV A; 
#chains in the Genus database with same CATH homology
 2YEK A;  5DLX A;  4N3W A;  4NQN A;  2R0V A;  3MB4 A;  4CFL A;  5HEN A;  3UVW A;  3UV4 A;  4LYW A;  4UYH A;  4CUT A;  3ZYU A;  4YYI A;  5DYX A;  2E3K A;  4QSX A;  5I83 A;  4QEU A;  5A83 A;  4CUS A;  3S91 A;  2L84 A;  5FDZ A;  4MEQ A;  5ENG A;  5A5P A;  5TCM A;  5D3J A;  5D7X A;  4QSP A;  4FLP A;  5CUC A;  5KO4 A;  4YAT A;  4IOO A;  4O7F A;  4TU6 A;  4XUB A;  3IU5 A;  4QB3 A;  4YBT A;  5KU3 A;  4QUT A;  4IR5 A;  4NR8 A;  2R0S A;  4LYS A;  5CRM A;  1X0J A;  5CQA A;  4N4I A;  4HXO A;  2NXB A;  4HXS A;  5I80 A;  5EI4 A;  5FFW A;  5FFV A;  3U5M A;  5F3A A;  5EVA A;  5H1V A;  5EWH A;  5I86 A;  5K29 A;  3LXJ A;  2DVS A;  4MEN A;  5HFQ A;  5LKT A;  5FE2 A;  3MXF A;  5D3H A;  5A5N A;  3UVD A;  5C87 A;  4UYF B;  2F6J A;  4PKL A;  3P1C A;  4QNS A;  5CRZ A;  5CUA A;  5ENF A;  5ENI A;  5D25 A;  5HQ6 A;  5EWC A;  4NRB A;  2DWW A;  2RS9 B;  3MB3 A;  2FSA A;  3LQI A;  4XY9 A;  3QZS A;  5EPB A;  5C4Q A;  5HRV A;  4NUD A;  4AKN A;  5I29 A;  4O7B A;  3UVY A;  1F68 A;  4QR4 A;  4OUF A;  4ALH A;  5J0D A;  4X2I A;  3IU6 A;  1JSP B;  2WP2 A;  4Z6H A;  4Z93 A;  5EPS A;  4NUE A;  5F60 A;  5HEM A;  5E74 A;  5KTX A;  5DW2 A;  5EV9 A;  1WUG A;  5G4S A;  5DFB A;  4XUA A;  5DFC A;  3HMH A;  1EQF A;  4GPJ A;  4O7E A;  2D82 A;  4N4H A;  4ALG A;  4YYM A;  3O34 A;  2GRC A;  5E3D A;  5EIC A;  5F1L A;  5I88 A;  3U5J A;  4UIX A;  5LUU A;  2YW5 A;  5HJC A;  4WHU A;  4IOR A;  3Q2F A;  5A82 A;  4TQN A;  5CQ4 A;  2OUO A;  5BT5 A;  2YDW A;  4RVR A;  5HQ7 A;  2R10 A;  4KV4 A;  5HQ5 A;  5D26 A;  3G0J A;  5EP7 A;  5F36 A;  4NYV A;  3JVL A;  4O77 A;  5II2 A;  5D3S A;  5ENC A;  3P5O A;  2I8N A;  4ZC9 A;  4LZS A;  5II1 A;  5L99 A;  4PCE A;  4Z1S A;  3LQH A;  4LZ2 A;  3RCW A;  2YQD A;  5AD3 A;  5F5Z A;  4NR6 A;  4XY8 A;  4TYL A;  5CFW A;  3Q2E A;  4IR3 A;  5TB6 A;  4XYA A;  4A9K A;  5HCL A;  5LJ1 A;  3UV5 A;  5D24 A;  5L97 A;  3I3J A;  5E9I A;  4QSQ A;  5CTL A;  3UV2 A;  5E9V A;  2DVR A;  5BT4 A;  5FE8 A;  4DON A;  4QR5 A;  5FE5 A;  4J0S A;  5FFY A;  2D9E A;  5IBN A;  5LJ2 A;  4YYN A;  4CFK A;  4YBM A;  5CP5 A;  5CPE A;  4OGJ A;  4YK0 A;  4BJX A;  1ZS5 A;  5FE9 A;  3DWY A;  4QSR A;  5JI8 A;  5ENE A;  4QZS A;  2I7K A;  4YY6 A;  5FB1 A;  3D7C A;  5F25 A;  5LKX A;  3GG3 A;  4A9J A;  5ACY A;  4TTE A;  3SVG A;  4C67 A;  4BW3 A;  5A85 A;  3JVM A;  5HLS A;  4CUQ A;  5DX4 A;  4TT6 A;  5CU8 A;  5EQ1 A;  3DAI A;  3S92 A;  4A9M A;  3MUK A;  4BHW A;  5HRX A;  5CZG A;  4TZ8 A;  4YAD A;  4O72 A;  4N4F A;  5E9K A;  4BW2 A;  4WIV A;  4NQM A;  2RO1 A;  4Z6I A;  3UW9 A;  5A7C A;  4OGI A;  4UIY A;  5D3R A;  2DVV A;  2RNW A;  3LQJ A;  4NR4 A;  5E0R A;  5KHM A;  4ZW1 A;  4YY4 A;  4QUU A;  5CQ6 A;  4MR5 A;  5CS8 A;  5H1U A;  5IGK A;  4QSW A;  4TT2 A;  5EU1 A;  5EWV A;  5HFR A;  5H85 A;  3UVX A;  3ONI A;  4A9H A;  5C85 A;  4LR6 A;  4O74 A;  4YYD A;  5A5Q A;  3AQA A;  5C89 A;  4J3I A;  2YEL A;  4UIZ A;  5DYC A;  5HEL A;  4F3I A;  4UIV A;  4PCI A;  4YC9 A;  5CQ3 A;  4E96 A;  5HM0 A;  2DVQ A;  5EPR A;  4QC3 A;  4NYW A;  3U5N A;  5FG4 A;  4O76 A;  2E7N A;  4O7A A;  5EGU A;  4O78 A;  4YH4 A;  4MR4 A;  4HBW A;  5DY7 A;  5EWW A;  2DAT A;  5F1H A;  5DYU A;  5BT3 A;  4UIW A;  4IR4 A;  2R0Y A;  4QSU A;  4NRA A;  3O36 A;  4YBS A;  4Q0N A;  3QZT A;  5EA1 A;  5CQ8 A;  4QR3 A;  4Y03 A;  4NR9 A;  2OSS A;  3JVJ A;  4A9I A;  4Q0O A;  4LC2 A;  4A9L A;  3MQM A;  4LYI A;  5FE0 A;  3P1E A;  5CUG A;  5HRW A;  2RNX A;  5E73 A;  5FH8 A;  4IR6 A;  4QY4 A;  2L85 A;  5ENH A;  4NR7 A;  3SVH A;  4CLB A;  5ETD A;  5A5O A;  2H60 A;  3QZV A;  2OO1 A;  5F62 A;  5CQ7 A;  4CUU A;  5FG5 A;  5I1Q A;  1JM4 B;  5DLZ A;  4LZR A;  2G4A A;  4YYK A;  4UIT A;  5CUE A;  5CQ5 A;  3U5L A;  5EM3 A;  4UYG A;  4WHW A;  4TS8 A;  5D3P A;  5CUD A;  3NXB A;  4C66 A;  4CUP A;  4NYX A;  5I7X A;  4HXN A;  3LJW A;  5C7N A;  4YH3 A;  5FG6 A;  4NS5 A;  5C8G A;  5FE6 A;  5DFD A;  4NUC A;  4Z1Q A;  5LVR A;  3FKM X;  5G4R A;  4N4G A;  5D0C A;  4J1P A;  5FE1 A;  5A81 A;  5L8T A;  5L96 A;  4KCX A;  5IID A;  4A9E A;  5E9M A;  4O70 A;  5KTW A;  4MR6 A;  4CUR A;  5FB0 A;  4QEV A;  3P1D A;  5CY9 A;  5I89 A;  2KTB B;  5I40 A;  4NR5 A;  4QYD A;  4KV1 A;  2L5E A;  5EIS A;  3SVF A;  2RI7 A;  4HBY A;  5IGM A;  5F61 A;  5D3N A;  4O7C A;  1E6I A;  3O33 A;  3K2J A;  4YYH A;  4QEW A;  4UYF A;  5DBM A;  3U5P A;  5JWM A;  2DKW A;  5LJ0 A;  5DYA A;  4QSS A;  5CQT A;  5F63 A;  5IGL A;  4A9N A;  5A5R A;  3O35 A;  5LVQ A;  3TLP A;  1N72 A;  1WUM A;  5AD2 A;  4PTB A;  5FH7 A;  5D3L A;  4YYG A;  4HXK A;  4YAB A;  4NRC A;  5E3G A;  4ZQL A;  5L8U A;  5I7Y A;  4BW4 A;  3O37 A;  5FE3 A;  4HBX A;  2E7O A;  4PY6 A;  4QYL A;  4MR3 A;  5DW1 A;  4BW1 A;  5EK9 A;  3P1F A;  2LSP B;  5L98 A;  4MEO A;  3AAD A;  5CUB A;  3G0L A;  5FE7 A;  3HME A;  5FE4 A;  2RFJ A;  4QST A;  5E9Y A;  5DKD A;  4TZ2 A;  3JVK A;  4YAX A;  5ETB A;  4MEP A;  5ENJ A;  4IOQ A;  4O71 A;  4PS5 A;  4HXP A;  2N9G A;  4QSV A;  5F2P A;  2F6N A;  5DKC A;  4UYD A;  4TT4 A;  4LDF A;  5FH6 A;  4A9F A;  4J0R A;  4QBM A;  5E7D A;  4YYJ A;  5EWD A;  4UIU A;  5IGN A;  4HXL A;  2YYN A;  5H1T A;  4QC1 A;  4UYE A;  5ENB A;  5AME A;  3U5K A;  5FBX A;  5A5S A;  4TU4 A;  4A9O A;  2WP1 A;  3U5O A;  5DKH A;  2RNY A;  4HXM A;  3MUL A;  4NXJ A;  5CGP A;  5COI A;  2MJV B;  4CL9 A;  5LKU A;  5E9L A;  4LRG A;  5KTU A;  5LKZ A;  5AMF A;  4O75 A;  3HMF A;  2YEM A;  5D3T A;  4HXR A;  5IG6 A;  4HBV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...