5HELA

Crystal structure of the n-terminus y153h bromodomain mutant of human brd2
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
119
structure length
119
Chain Sequence
SMKPGRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGTIKRRLENNYYWAASECMQDFNTMFTNCHIYNKPTDDIVLMAQTLEKIFLQKVASMPQEEQEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bromodomain-containing protein 2
publication title Crystal structure of the N-terminus Y153H bromodomain mutant of human BRD2
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 39
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2016-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5helA00
2RO1A 5FFWA 3U5JA 4QC3A 5LJ0A 4QEVA 5EPRA 4F3IA 1JSPB 4N4FA 5DBMA 5BT5A 4BW4A 3U5OA 5LKZA 5L8UA 5KTUA 5E3DA 5ENFA 4LYIA 5A5PA 4NR8A 4J0SA 4Y03A 5A82A 5EWCA 5HQ6A 5KHMA 4YH3A 4A9HA 5CQ3A 3LQHA 5HFRA 5JWMA 5FE7A 5H1VA 4UYDA 4MENA 3SVGA 5I80A 2OUOA 4BW3A 4WIVA 3SVHA 4UYEA 4YBTA 4UIWA 4QR5A 4IORA 5CUCA 5CQ7A 3UW9A 4TT6A 2RFJA 4XUAA 5L98A 4CFKA 5IG6A 5F25A 5FFYA 5BT3A 5F63A 5D24A 5D26A 3K2JA 5HCLA 5CP5A 5FE8A 4TZ8A 5EICA 2OSSA 4UITA 4QZSA 4UIVA 5I83A 3G0LA 5EISA 5HJCA 5DYUA 4ZW1A 4QUUA 5D3LA 5DYXA 4LC2A 4O72A 4QY4A 4O77A 2GRCA 2LSPB 4LZSA 3HMEA 3D7CA 5D25A 5DY7A 5E9KA 2DVQA 4YYKA 3O37A 4Z1SA 2RNWA 1E6IA 5CQ6A 5D3TA 2L5EA 4YYHA 1EQFA 5CQAA 4CURA 4YYIA 5C7NA 4IR3A 5IBNA 5HRXA 4YY4A 5BT4A 3S92A 2DATA 3DAIA 4TZ2A 4QNSA 4IOQA 5L96A 5KTXA 3G0JA 2E7OA 5CUAA 5DFDA 5EWDA 4QUTA 4YBMA 3ZYUA 5D3JA 4LRGA 5CGPA 4O78A 5A5SA 4A9OA 5IGLA 4MR5A 2F6NA 5LKXA 4CLBA 5LJ1A 4PY6A 5EI4A 4HBWA 4HXKA 4LYWA 4BW2A 5ENEA 5I89A 4YYJA 4NR6A 5L99A 3JVKA 4PKLA 4MR4A 5D3NA 4QSVA 2R10A 4TU6A 5HRWA 3MB4A 2YW5A 5ENGA 3LQIA 4N4HA 5E74A 4QSPA 5CQTA 5A5OA 3UVWA 3UVDA 4HXRA 4PCEA 4LZRA 5A81A 4IR4A 5KTWA 3P1CA 4LR6A 2OO1A 4UYGA 4YYMA 3ONIA 2WP2A 5FE2A 5HELA 5DLXA 2RI7A 4O71A 3P1DA 2DKWA 5E9MA 3I3JA 5EK9A 5DX4A 4OGJA 4NR4A 4BW1A 4KV1A 2KTBB 4NRAA 2D82A 5D3PA 5IGMA 4YATA 4LDFA 4MR6A 4MEPA 2E7NA 4J3IA 4IR6A 5EM3A 5CRZA 5DW1A 5F62A 5ENCA 5CFWA 5I86A 3UV2A 5FG4A 4Q0OA 5I88A 2DVVA 4ZC9A 5LUUA 4O7BA 5COIA 5F2PA 5G4RA 5FFVA 3P1FA 4HXSA 5E9LA 4YY6A 5IIDA 5DYCA 2DVSA 4ALHA 2R0VA 3U5NA 4QR4A 4CFLA 4PS5A 4QC1A 4KV4A 5FE6A 5FBXA 4UYHA 5E9YA 5K29A 5A5RA 4XY9A 5FG6A 4LZ2A 5DKCA 3UV5A 5CPEA 2DVRA 5CUGA 4YH4A 3RCWA 5FB0A 3MB3A 4CUTA 5HLSA 4HBVA 4NRBA 3GG3A 4LYSA 4O7FA 5A83A 5C87A 5FDZA 3MXFA 4X2IA 5DKHA 4N3WA 4NR5A 4TTEA 4UIZA 4ALGA 5II1A 4YAXA 4O7CA 5CUBA 4N4GA 5AD2A 5DFBA 4QEWA 3HMHA 5ACYA 3LJWA 4Z6HA 5E9IA 5EWWA 5D3HA 4QEUA 3JVJA 4A9JA 4YK0A 4Q0NA 4NQNA 5HENA 4OUFA 2DWWA 2L85A 2N9GA 3JVLA 5CRMA 5DW2A 5LKUA 5ETDA 4QYDA 3JVMA 4NUCA 5FH6A 4IOOA 5LVRA 5L97A 3QZVA 4A9IA 3SVFA 4QYLA 4OGIA 3MULA 3FKMX 1WUGA 4HXOA 5FE4A 4NRCA 4O70A 4UIXA 5E3GA 3P1EA 4BHWA 4C66A 2R0YA 5EV9A 3TLPA 4Z6IA 2MJVB 5D3RA 3AADA 5DFCA 4QSXA 4TU4A 1N72A 5HM0A 5F1HA 3Q2EA 2L84A 4J0RA 5CUDA 4TT2A 3UV4A 2YQDA 5IGNA 5L8TA 5E73A 5ENJA 4CUPA 4Z93A 5J0DA 4IR5A 4QSTA 4NUEA 4RVRA 1WUMA 5D0CA 2E3KA 3LQJA 5FE9A 3IU6A 4HXMA 5KO4A 5EU1A 3QZSA 5H85A 5LKTA 4J1PA 5ENBA 1JM4B 2F6JA 2WP1A 3O35A 5A85A 4ZQLA 5CQ8A 4A9MA 5I7YA 5A5NA 3O34A 4A9KA 5ENHA 5E0RA 5A5QA 5F1LA 4UIUA 4PCIA 3Q2FA 5II2A 1X0JA 3MQMA 4UIYA 3U5LA 5DKDA 5EP7A 5EWHA 5CTLA 5EWVA 4DONA 2RS9B 5A7CA 5FE0A 4QSWA 5HQ7A 5I7XA 5DYAA 5I40A 4TT4A 2YYNA 4XUBA 5TCMA 4N4IA 2H60A 4QBMA 4E96A 4FLPA 4O76A 4WHUA 4CUQA 4A9FA 5FE5A 4TQNA 5F3AA 3U5MA 3U5PA 3DWYA 5FB1A 4MEQA 4HBXA 4NQMA 4MEOA 5AMFA 5CY9A 4QSSA 4UYFA 5E9VA 2YDWA 2D9EA 5I29A 3QZTA 3UVYA 5F60A 5C8GA 4O7EA 2YEKA 4XYAA 4YABA 5H1UA 4YC9A 5AMEA 5I1QA 4CUSA 3S91A 3P5OA 5CS8A 5D3SA 4YYGA 4WHWA 5HQ5A 4HXPA 4XY8A 4HXNA 1F68A 4NR9A 5DLZA 5C4QA 3AQAA 5FH8A 5H1TA 5LJ2A 4O74A 5FG5A 4TYLA 5CU8A 4YADA 3LXJA 5CQ4A 4HBYA 4PTBA 4NUDA 1ZS5A 4AKNA 5EVAA 3UVXA 5EGUA 2G4AA 4O7AA 4QSRA 3O33A 4A9EA 5C85A 4CL9A 4MR3A 5EA1A 4NS5A 5ENIA 4GPJA 4QSUA 5HEMA 4YYNA 4NYWA 5CZGA 5G4SA 5EQ1A 2NXBA 5HRVA 5D7XA 4HXLA 2I8NA 5FE1A 4NYVA 2YELA 4UYFB 4BJXA 4CUUA 5JI8A 2RNYA 4QSQA 5F36A 5LVQA 5FH7A 4C67A 3U5KA 5KU3A 5HFQA 4YBSA 2RNXA 2YEMA 5IGKA 3NXBA 5AD3A 3IU5A 4KCXA 3HMFA 4NXJA 5TB6A 4NYXA 2R0SA 5E7DA 5F5ZA 3O36A 5CUEA 5ETBA 5C89A 2I7KA 4O75A 4A9LA 2FSAA 5EPSA 4YYDA 4NR7A 5CQ5A 4QB3A 5F61A 3MUKA 5FE3A 4TS8A 5EPBA 4QR3A 4Z1QA 4A9NA
chains in the Genus database with same CATH superfamily
2RO1A 5FFWA 3U5JA 4QC3A 5LJ0A 4QEVA 5EPRA 4F3IA 1JSPB 4N4FA 5DBMA 5BT5A 4BW4A 3U5OA 5LKZA 5L8UA 5KTUA 5E3DA 5ENFA 4LYIA 5A5PA 4NR8A 4J0SA 4Y03A 5A82A 5EWCA 5HQ6A 5KHMA 4YH3A 4A9HA 5CQ3A 3LQHA 5HFRA 5JWMA 5FE7A 5H1VA 4UYDA 4MENA 3SVGA 5I80A 2OUOA 4BW3A 4WIVA 3SVHA 4UYEA 4YBTA 4UIWA 4QR5A 4IORA 5CUCA 5CQ7A 3UW9A 4TT6A 2RFJA 4XUAA 5L98A 4CFKA 5IG6A 5F25A 5FFYA 5BT3A 5F63A 5D24A 5D26A 3K2JA 5HCLA 5CP5A 5FE8A 4TZ8A 5EICA 2OSSA 4UITA 4QZSA 4UIVA 5I83A 3G0LA 5EISA 5HJCA 5DYUA 4ZW1A 4QUUA 5D3LA 5DYXA 4LC2A 4O72A 4QY4A 4O77A 2GRCA 2LSPB 4LZSA 3HMEA 3D7CA 5D25A 5DY7A 5E9KA 2DVQA 4YYKA 3O37A 4Z1SA 2RNWA 1E6IA 5CQ6A 5D3TA 2L5EA 4YYHA 1EQFA 5CQAA 4CURA 4YYIA 5C7NA 4IR3A 5IBNA 5HRXA 4YY4A 5BT4A 3S92A 2DATA 3DAIA 4TZ2A 4QNSA 4IOQA 5L96A 5KTXA 3G0JA 2E7OA 5CUAA 5DFDA 5EWDA 4QUTA 4YBMA 3ZYUA 5D3JA 4LRGA 5CGPA 4O78A 5A5SA 4A9OA 5IGLA 4MR5A 2F6NA 5LKXA 4CLBA 5LJ1A 4PY6A 5EI4A 4HBWA 4HXKA 4LYWA 4BW2A 5ENEA 5I89A 4YYJA 4NR6A 5L99A 3JVKA 4PKLA 4MR4A 5D3NA 4QSVA 2R10A 4TU6A 5HRWA 3MB4A 2YW5A 5ENGA 3LQIA 4N4HA 5E74A 4QSPA 5CQTA 5A5OA 3UVWA 3UVDA 4HXRA 4PCEA 4LZRA 5A81A 4IR4A 5KTWA 3P1CA 4LR6A 2OO1A 4UYGA 4YYMA 3ONIA 2WP2A 5FE2A 5HELA 5DLXA 2RI7A 4O71A 3P1DA 2DKWA 3D1BA 5E9MA 3I3JA 5EK9A 5DX4A 4OGJA 4NR4A 4BW1A 4KV1A 2KTBB 4NRAA 2D82A 5D3PA 2EJNA 5IGMA 4YATA 4LDFA 4MR6A 4MEPA 2E7NA 4J3IA 4IR6A 5EM3A 5CRZA 5DW1A 5F62A 5ENCA 5CFWA 5I86A 3UV2A 4AKGA 5FG4A 4Q0OA 5I88A 2DVVA 4ZC9A 5LUUA 4O7BA 5COIA 5F2PA 5G4RA 5FFVA 3P1FA 4HXSA 5E9LA 4YY6A 5IIDA 4AKIA 5DYCA 2DVSA 4ALHA 2R0VA 3U5NA 4QR4A 4CFLA 4PS5A 4QC1A 4KV4A 5FE6A 5FBXA 4UYHA 5E9YA 5K29A 5A5RA 4XY9A 5FG6A 4LZ2A 5DKCA 3UV5A 1PUOA 5CPEA 2DVRA 5CUGA 4YH4A 3RCWA 5FB0A 3D1DA 3MB3A 4CUTA 5HLSA 4HBVA 4NRBA 3GG3A 4LYSA 4O7FA 5A83A 5C87A 5FDZA 3MXFA 4X2IA 5DKHA 4N3WA 4NR5A 4TTEA 4UIZA 4ALGA 5II1A 4YAXA 4O7CA 5CUBA 4N4GA 5AD2A 5DFBA 4QEWA 3HMHA 5ACYA 3LJWA 4Z6HA 5E9IA 5EWWA 5D3HA 4QEUA 3JVJA 4A9JA 4YK0A 4Q0NA 4NQNA 5HENA 4OUFA 2DWWA 2L85A 2N9GA 3JVLA 5CRMA 5DW2A 5LKUA 5ETDA 4QYDA 3JVMA 4NUCA 5FH6A 4IOOA 5LVRA 5L97A 3QZVA 4A9IA 3SVFA 3VKHA 4QYLA 4OGIA 4AKHA 1ZKRA 3MULA 3FKMX 1WUGA 4HXOA 5FE4A 4NRCA 4O70A 4UIXA 5E3GA 3P1EA 4BHWA 4C66A 2R0YA 5EV9A 3TLPA 4Z6IA 2MJVB 5D3RA 3AADA 5DFCA 4QSXA 4TU4A 1N72A 5HM0A 5F1HA 3Q2EA 2L84A 4J0RA 5CUDA 4TT2A 3UV4A 2YQDA 5IGNA 5L8TA 3VKGA 5E73A 5ENJA 4CUPA 4Z93A 5J0DA 4IR5A 4QSTA 4NUEA 4RVRA 1WUMA 5D0CA 2E3KA 3LQJA 5FE9A 3IU6A 4HXMA 4AI6A 5KO4A 5EU1A 3QZSA 5H85A 5LKTA 4J1PA 5ENBA 1JM4B 2F6JA 2WP1A 3O35A 5A85A 4ZQLA 5CQ8A 4A9MA 5I7YA 5A5NA 3O34A 4A9KA 5ENHA 5E0RA 5A5QA 5F1LA 4UIUA 4PCIA 3Q2FA 5II2A 1X0JA 3MQMA 4UIYA 3U5LA 5DKDA 5EP7A 5EWHA 5CTLA 5EWVA 4DONA 2RS9B 5A7CA 5FE0A 4QSWA 5HQ7A 5I7XA 3ERRA 5DYAA 5I40A 4TT4A 2YYNA 4XUBA 5TCMA 4N4IA 2H60A 4QBMA 4E96A 4FLPA 4O76A 4WHUA 4CUQA 4A9FA 5FE5A 4TQNA 5F3AA 3U5MA 3U5PA 3DWYA 5FB1A 4MEQA 4HBXA 4NQMA 4MEOA 5AMFA 5CY9A 4QSSA 4UYFA 5E9VA 2YDWA 2D9EA 5I29A 3QZTA 3UVYA 5F60A 5C8GA 4O7EA 2YEKA 4XYAA 4YABA 5H1UA 4YC9A 5AMEA 5I1QA 4CUSA 3S91A 3P5OA 5CS8A 5D3SA 4YYGA 4WHWA 5HQ5A 4HXPA 4XY8A 4HXNA 1F68A 4NR9A 5DLZA 5C4QA 3AQAA 5FH8A 5H1TA 5LJ2A 4O74A 5FG5A 4TYLA 5CU8A 4YADA 3LXJA 5CQ4A 4HBYA 4PTBA 4NUDA 1ZS5A 4AKNA 5EVAA 3UVXA 5EGUA 2G4AA 4O7AA 4QSRA 3O33A 4A9EA 5C85A 4CL9A 4MR3A 5EA1A 4NS5A 5ENIA 4GPJA 4QSUA 5HEMA 4YYNA 4NYWA 5CZGA 5G4SA 5EQ1A 2NXBA 5HRVA 5D7XA 4HXLA 2I8NA 5FE1A 4NYVA 2YELA 4UYFB 4BJXA 4CUUA 5JI8A 2RNYA 4QSQA 5F36A 5LVQA 5FH7A 4C67A 3U5KA 5KU3A 5HFQA 4YBSA 2RNXA 2YEMA 5IGKA 3NXBA 5AD3A 3IU5A 4KCXA 3HMFA 4NXJA 5TB6A 4NYXA 2R0SA 5E7DA 5F5ZA 3O36A 5CUEA 5ETBA 5C89A 2I7KA 4O75A 4A9LA 2FSAA 5EPSA 4YYDA 4NR7A 5CQ5A 4QB3A 5F61A 3MUKA 5FE3A 4TS8A 5EPBA 4QR3A 4Z1QA 4A9NA
chains in the Genus database with same CATH topology
2RO1A 5FFWA 3U5JA 4QC3A 5LJ0A 4QEVA 5EPRA 4F3IA 1JSPB 4N4FA 5DBMA 5BT5A 4BW4A 3U5OA 5LKZA 5L8UA 5KTUA 5E3DA 5ENFA 4LYIA 5A5PA 4NR8A 4J0SA 4Y03A 5A82A 5EWCA 5HQ6A 5KHMA 4YH3A 4A9HA 5CQ3A 3LQHA 5HFRA 5JWMA 5FE7A 5H1VA 4UYDA 4MENA 3SVGA 5I80A 2OUOA 4BW3A 4WIVA 3SVHA 4UYEA 4YBTA 4UIWA 4QR5A 4IORA 5CUCA 5CQ7A 3UW9A 4TT6A 2RFJA 4XUAA 5L98A 4CFKA 5IG6A 5F25A 5FFYA 5BT3A 5F63A 5D24A 5D26A 3K2JA 5HCLA 5CP5A 5FE8A 4TZ8A 5EICA 2OSSA 4UITA 4QZSA 4UIVA 5I83A 3G0LA 5EISA 5HJCA 5DYUA 4ZW1A 4QUUA 5D3LA 5DYXA 4LC2A 4O72A 4QY4A 4O77A 2GRCA 2LSPB 4LZSA 3HMEA 3D7CA 5D25A 5DY7A 5E9KA 2DVQA 4YYKA 3O37A 4Z1SA 2RNWA 1E6IA 5CQ6A 5D3TA 2L5EA 4YYHA 1EQFA 5CQAA 4CURA 4YYIA 5C7NA 4IR3A 5IBNA 5HRXA 4YY4A 5BT4A 3S92A 2DATA 3DAIA 4TZ2A 4QNSA 4IOQA 5L96A 5KTXA 3G0JA 2E7OA 5CUAA 5DFDA 5EWDA 4QUTA 4YBMA 3ZYUA 5D3JA 4LRGA 5CGPA 4O78A 5A5SA 4A9OA 5IGLA 4MR5A 2F6NA 5LKXA 4CLBA 5LJ1A 4PY6A 5EI4A 4HBWA 4HXKA 4LYWA 4BW2A 5ENEA 5I89A 4YYJA 4NR6A 5L99A 3JVKA 4PKLA 4MR4A 5D3NA 4QSVA 2R10A 4TU6A 5HRWA 3MB4A 2YW5A 5ENGA 3LQIA 4N4HA 5E74A 4QSPA 5CQTA 5A5OA 3UVWA 3UVDA 4HXRA 4PCEA 4LZRA 5A81A 4IR4A 5KTWA 3P1CA 4LR6A 2OO1A 4UYGA 4YYMA 3ONIA 2WP2A 5FE2A 5HELA 5DLXA 2RI7A 4O71A 3P1DA 2DKWA 5E9MA 3I3JA 5EK9A 5DX4A 4OGJA 4NR4A 4BW1A 4KV1A 2KTBB 4NRAA 2D82A 5D3PA 5IGMA 4YATA 4LDFA 4MR6A 4MEPA 2E7NA 4J3IA 4IR6A 5EM3A 5CRZA 5DW1A 5F62A 5ENCA 5CFWA 5I86A 3UV2A 5FG4A 4Q0OA 5I88A 2DVVA 4ZC9A 5LUUA 4O7BA 5COIA 5F2PA 5G4RA 5FFVA 3P1FA 4HXSA 5E9LA 4YY6A 5IIDA 5DYCA 2DVSA 4ALHA 2R0VA 3U5NA 4QR4A 4CFLA 4PS5A 4QC1A 4KV4A 5FE6A 5FBXA 4UYHA 5E9YA 5K29A 5A5RA 4XY9A 5FG6A 4LZ2A 5DKCA 3UV5A 5CPEA 2DVRA 5CUGA 4YH4A 3RCWA 5FB0A 3MB3A 4CUTA 5HLSA 4HBVA 4NRBA 3GG3A 4LYSA 4O7FA 5A83A 5C87A 5FDZA 3MXFA 4X2IA 5DKHA 4N3WA 4NR5A 4TTEA 4UIZA 4ALGA 5II1A 4YAXA 4O7CA 5CUBA 4N4GA 5AD2A 5DFBA 4QEWA 3HMHA 5ACYA 3LJWA 4Z6HA 5E9IA 5EWWA 5D3HA 4QEUA 3JVJA 4A9JA 4YK0A 4Q0NA 4NQNA 5HENA 4OUFA 2DWWA 2L85A 2N9GA 3JVLA 5CRMA 5DW2A 5LKUA 5ETDA 4QYDA 3JVMA 4NUCA 5FH6A 4IOOA 5LVRA 5L97A 3QZVA 4A9IA 3SVFA 4QYLA 4OGIA 3MULA 3FKMX 1WUGA 4HXOA 5FE4A 4NRCA 4O70A 4UIXA 5E3GA 3P1EA 4BHWA 4C66A 2R0YA 5EV9A 3TLPA 4Z6IA 2MJVB 5D3RA 3AADA 5DFCA 4QSXA 4TU4A 1N72A 5HM0A 5F1HA 3Q2EA 2L84A 4J0RA 5CUDA 4TT2A 3UV4A 2YQDA 5IGNA 5L8TA 5E73A 5ENJA 4CUPA 4Z93A 5J0DA 4IR5A 4QSTA 4NUEA 4RVRA 1WUMA 5D0CA 2E3KA 3LQJA 5FE9A 3IU6A 4HXMA 5KO4A 5EU1A 3QZSA 5H85A 5LKTA 4J1PA 5ENBA 1JM4B 2F6JA 2WP1A 3O35A 5A85A 4ZQLA 5CQ8A 4A9MA 5I7YA 5A5NA 3O34A 4A9KA 5ENHA 5E0RA 5A5QA 5F1LA 4UIUA 4PCIA 3Q2FA 5II2A 1X0JA 3MQMA 4UIYA 3U5LA 5DKDA 5EP7A 5EWHA 5CTLA 5EWVA 4DONA 2RS9B 5A7CA 5FE0A 4QSWA 5HQ7A 5I7XA 5DYAA 5I40A 4TT4A 2YYNA 4XUBA 5TCMA 4N4IA 2H60A 4QBMA 4E96A 4FLPA 4O76A 4WHUA 4CUQA 4A9FA 5FE5A 4TQNA 5F3AA 3U5MA 3U5PA 3DWYA 5FB1A 4MEQA 4HBXA 4NQMA 4MEOA 5AMFA 5CY9A 4QSSA 4UYFA 5E9VA 2YDWA 2D9EA 5I29A 3QZTA 3UVYA 5F60A 5C8GA 4O7EA 2YEKA 4XYAA 4YABA 5H1UA 4YC9A 5AMEA 5I1QA 4CUSA 3S91A 3P5OA 5CS8A 5D3SA 4YYGA 4WHWA 5HQ5A 4HXPA 4XY8A 4HXNA 1F68A 4NR9A 5DLZA 5C4QA 3AQAA 5FH8A 5H1TA 5LJ2A 4O74A 5FG5A 4TYLA 5CU8A 4YADA 3LXJA 5CQ4A 4HBYA 4PTBA 4NUDA 1ZS5A 4AKNA 5EVAA 3UVXA 5EGUA 2G4AA 4O7AA 4QSRA 3O33A 4A9EA 5C85A 4CL9A 4MR3A 5EA1A 4NS5A 5ENIA 4GPJA 4QSUA 5HEMA 4YYNA 4NYWA 5CZGA 5G4SA 5EQ1A 2NXBA 5HRVA 5D7XA 4HXLA 2I8NA 5FE1A 4NYVA 2YELA 4UYFB 4BJXA 4CUUA 5JI8A 2RNYA 4QSQA 5F36A 5LVQA 5FH7A 4C67A 3U5KA 5KU3A 5HFQA 4YBSA 2RNXA 2YEMA 5IGKA 3NXBA 5AD3A 3IU5A 4KCXA 3HMFA 4NXJA 5TB6A 4NYXA 2R0SA 5E7DA 5F5ZA 3O36A 5CUEA 5ETBA 5C89A 2I7KA 4O75A 4A9LA 2FSAA 5EPSA 4YYDA 4NR7A 5CQ5A 4QB3A 5F61A 3MUKA 5FE3A 4TS8A 5EPBA 4QR3A 4Z1QA 4A9NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RO1 A;  5FFW A;  3U5J A;  4QC3 A;  5LJ0 A;  4QEV A;  5EPR A;  4F3I A;  1JSP B;  4N4F A;  5DBM A;  5BT5 A;  4BW4 A;  3U5O A;  5LKZ A;  5L8U A;  5KTU A;  5E3D A;  5ENF A;  4LYI A;  5A5P A;  4NR8 A;  4J0S A;  4Y03 A;  5A82 A;  5EWC A;  5HQ6 A;  5KHM A;  4YH3 A;  4A9H A;  5CQ3 A;  3LQH A;  5HFR A;  5JWM A;  5FE7 A;  5H1V A;  4UYD A;  4MEN A;  3SVG A;  5I80 A;  2OUO A;  4BW3 A;  4WIV A;  3SVH A;  4UYE A;  4YBT A;  4UIW A;  4QR5 A;  4IOR A;  5CUC A;  5CQ7 A;  3UW9 A;  4TT6 A;  2RFJ A;  4XUA A;  5L98 A;  4CFK A;  5IG6 A;  5F25 A;  5FFY A;  5BT3 A;  5F63 A;  5D24 A;  5D26 A;  3K2J A;  5HCL A;  5CP5 A;  5FE8 A;  4TZ8 A;  5EIC A;  2OSS A;  4UIT A;  4QZS A;  4UIV A;  5I83 A;  3G0L A;  5EIS A;  5HJC A;  5DYU A;  4ZW1 A;  4QUU A;  5D3L A;  5DYX A;  4LC2 A;  4O72 A;  4QY4 A;  4O77 A;  2GRC A;  2LSP B;  4LZS A;  3HME A;  3D7C A;  5D25 A;  5DY7 A;  5E9K A;  2DVQ A;  4YYK A;  3O37 A;  4Z1S A;  2RNW A;  1E6I A;  5CQ6 A;  5D3T A;  2L5E A;  4YYH A;  1EQF A;  5CQA A;  4CUR A;  4YYI A;  5C7N A;  4IR3 A;  5IBN A;  5HRX A;  4YY4 A;  5BT4 A;  3S92 A;  2DAT A;  3DAI A;  4TZ2 A;  4QNS A;  4IOQ A;  5L96 A;  5KTX A;  3G0J A;  2E7O A;  5CUA A;  5DFD A;  5EWD A;  4QUT A;  4YBM A;  3ZYU A;  5D3J A;  4LRG A;  5CGP A;  4O78 A;  5A5S A;  4A9O A;  5IGL A;  4MR5 A;  2F6N A;  5LKX A;  4CLB A;  5LJ1 A;  4PY6 A;  5EI4 A;  4HBW A;  4HXK A;  4LYW A;  4BW2 A;  5ENE A;  5I89 A;  4YYJ A;  4NR6 A;  5L99 A;  3JVK A;  4PKL A;  4MR4 A;  5D3N A;  4QSV A;  2R10 A;  4TU6 A;  5HRW A;  3MB4 A;  2YW5 A;  5ENG A;  3LQI A;  4N4H A;  5E74 A;  4QSP A;  5CQT A;  5A5O A;  3UVW A;  3UVD A;  4HXR A;  4PCE A;  4LZR A;  5A81 A;  4IR4 A;  5KTW A;  3P1C A;  4LR6 A;  2OO1 A;  4UYG A;  4YYM A;  3ONI A;  2WP2 A;  5FE2 A;  5HEL A;  5DLX A;  2RI7 A;  4O71 A;  3P1D A;  2DKW A;  5E9M A;  3I3J A;  5EK9 A;  5DX4 A;  4OGJ A;  4NR4 A;  4BW1 A;  4KV1 A;  2KTB B;  4NRA A;  2D82 A;  5D3P A;  5IGM A;  4YAT A;  4LDF A;  4MR6 A;  4MEP A;  2E7N A;  4J3I A;  4IR6 A;  5EM3 A;  5CRZ A;  5DW1 A;  5F62 A;  5ENC A;  5CFW A;  5I86 A;  3UV2 A;  5FG4 A;  4Q0O A;  5I88 A;  2DVV A;  4ZC9 A;  5LUU A;  4O7B A;  5COI A;  5F2P A;  5G4R A;  5FFV A;  3P1F A;  4HXS A;  5E9L A;  4YY6 A;  5IID A;  5DYC A;  2DVS A;  4ALH A;  2R0V A;  3U5N A;  4QR4 A;  4CFL A;  4PS5 A;  4QC1 A;  4KV4 A;  5FE6 A;  5FBX A;  4UYH A;  5E9Y A;  5K29 A;  5A5R A;  4XY9 A;  5FG6 A;  4LZ2 A;  5DKC A;  3UV5 A;  5CPE A;  2DVR A;  5CUG A;  4YH4 A;  3RCW A;  5FB0 A;  3MB3 A;  4CUT A;  5HLS A;  4HBV A;  4NRB A;  3GG3 A;  4LYS A;  4O7F A;  5A83 A;  5C87 A;  5FDZ A;  3MXF A;  4X2I A;  5DKH A;  4N3W A;  4NR5 A;  4TTE A;  4UIZ A;  4ALG A;  5II1 A;  4YAX A;  4O7C A;  5CUB A;  4N4G A;  5AD2 A;  5DFB A;  4QEW A;  3HMH A;  5ACY A;  3LJW A;  4Z6H A;  5E9I A;  5EWW A;  5D3H A;  4QEU A;  3JVJ A;  4A9J A;  4YK0 A;  4Q0N A;  4NQN A;  5HEN A;  4OUF A;  2DWW A;  2L85 A;  2N9G A;  3JVL A;  5CRM A;  5DW2 A;  5LKU A;  5ETD A;  4QYD A;  3JVM A;  4NUC A;  5FH6 A;  4IOO A;  5LVR A;  5L97 A;  3QZV A;  4A9I A;  3SVF A;  4QYL A;  4OGI A;  3MUL A;  3FKM X;  1WUG A;  4HXO A;  5FE4 A;  4NRC A;  4O70 A;  4UIX A;  5E3G A;  3P1E A;  4BHW A;  4C66 A;  2R0Y A;  5EV9 A;  3TLP A;  4Z6I A;  2MJV B;  5D3R A;  3AAD A;  5DFC A;  4QSX A;  4TU4 A;  1N72 A;  5HM0 A;  5F1H A;  3Q2E A;  2L84 A;  4J0R A;  5CUD A;  4TT2 A;  3UV4 A;  2YQD A;  5IGN A;  5L8T A;  5E73 A;  5ENJ A;  4CUP A;  4Z93 A;  5J0D A;  4IR5 A;  4QST A;  4NUE A;  4RVR A;  1WUM A;  5D0C A;  2E3K A;  3LQJ A;  5FE9 A;  3IU6 A;  4HXM A;  5KO4 A;  5EU1 A;  3QZS A;  5H85 A;  5LKT A;  4J1P A;  5ENB A;  1JM4 B;  2F6J A;  2WP1 A;  3O35 A;  5A85 A;  4ZQL A;  5CQ8 A;  4A9M A;  5I7Y A;  5A5N A;  3O34 A;  4A9K A;  5ENH A;  5E0R A;  5A5Q A;  5F1L A;  4UIU A;  4PCI A;  3Q2F A;  5II2 A;  1X0J A;  3MQM A;  4UIY A;  3U5L A;  5DKD A;  5EP7 A;  5EWH A;  5CTL A;  5EWV A;  4DON A;  2RS9 B;  5A7C A;  5FE0 A;  4QSW A;  5HQ7 A;  5I7X A;  5DYA A;  5I40 A;  4TT4 A;  2YYN A;  4XUB A;  5TCM A;  4N4I A;  2H60 A;  4QBM A;  4E96 A;  4FLP A;  4O76 A;  4WHU A;  4CUQ A;  4A9F A;  5FE5 A;  4TQN A;  5F3A A;  3U5M A;  3U5P A;  3DWY A;  5FB1 A;  4MEQ A;  4HBX A;  4NQM A;  4MEO A;  5AMF A;  5CY9 A;  4QSS A;  4UYF A;  5E9V A;  2YDW A;  2D9E A;  5I29 A;  3QZT A;  3UVY A;  5F60 A;  5C8G A;  4O7E A;  2YEK A;  4XYA A;  4YAB A;  5H1U A;  4YC9 A;  5AME A;  5I1Q A;  4CUS A;  3S91 A;  3P5O A;  5CS8 A;  5D3S A;  4YYG A;  4WHW A;  5HQ5 A;  4HXP A;  4XY8 A;  4HXN A;  1F68 A;  4NR9 A;  5DLZ A;  5C4Q A;  3AQA A;  5FH8 A;  5H1T A;  5LJ2 A;  4O74 A;  5FG5 A;  4TYL A;  5CU8 A;  4YAD A;  3LXJ A;  5CQ4 A;  4HBY A;  4PTB A;  4NUD A;  1ZS5 A;  4AKN A;  5EVA A;  3UVX A;  5EGU A;  2G4A A;  4O7A A;  4QSR A;  3O33 A;  4A9E A;  5C85 A;  4CL9 A;  4MR3 A;  5EA1 A;  4NS5 A;  5ENI A;  4GPJ A;  4QSU A;  5HEM A;  4YYN A;  4NYW A;  5CZG A;  5G4S A;  5EQ1 A;  2NXB A;  5HRV A;  5D7X A;  4HXL A;  2I8N A;  5FE1 A;  4NYV A;  2YEL A;  4UYF B;  4BJX A;  4CUU A;  5JI8 A;  2RNY A;  4QSQ A;  5F36 A;  5LVQ A;  5FH7 A;  4C67 A;  3U5K A;  5KU3 A;  5HFQ A;  4YBS A;  2RNX A;  2YEM A;  5IGK A;  3NXB A;  5AD3 A;  3IU5 A;  4KCX A;  3HMF A;  4NXJ A;  5TB6 A;  4NYX A;  2R0S A;  5E7D A;  5F5Z A;  3O36 A;  5CUE A;  5ETB A;  5C89 A;  2I7K A;  4O75 A;  4A9L A;  2FSA A;  5EPS A;  4YYD A;  4NR7 A;  5CQ5 A;  4QB3 A;  5F61 A;  3MUK A;  5FE3 A;  4TS8 A;  5EPB A;  4QR3 A;  4Z1Q A;  4A9N A; 
#chains in the Genus database with same CATH topology
 2RO1 A;  5FFW A;  3U5J A;  4QC3 A;  5LJ0 A;  4QEV A;  5EPR A;  4F3I A;  1JSP B;  4N4F A;  5DBM A;  5BT5 A;  4BW4 A;  3U5O A;  5LKZ A;  5L8U A;  5KTU A;  5E3D A;  5ENF A;  4LYI A;  5A5P A;  4NR8 A;  4J0S A;  4Y03 A;  5A82 A;  5EWC A;  5HQ6 A;  5KHM A;  4YH3 A;  4A9H A;  5CQ3 A;  3LQH A;  5HFR A;  5JWM A;  5FE7 A;  5H1V A;  4UYD A;  4MEN A;  3SVG A;  5I80 A;  2OUO A;  4BW3 A;  4WIV A;  3SVH A;  4UYE A;  4YBT A;  4UIW A;  4QR5 A;  4IOR A;  5CUC A;  5CQ7 A;  3UW9 A;  4TT6 A;  2RFJ A;  4XUA A;  5L98 A;  4CFK A;  5IG6 A;  5F25 A;  5FFY A;  5BT3 A;  5F63 A;  5D24 A;  5D26 A;  3K2J A;  5HCL A;  5CP5 A;  5FE8 A;  4TZ8 A;  5EIC A;  2OSS A;  4UIT A;  4QZS A;  4UIV A;  5I83 A;  3G0L A;  5EIS A;  5HJC A;  5DYU A;  4ZW1 A;  4QUU A;  5D3L A;  5DYX A;  4LC2 A;  4O72 A;  4QY4 A;  4O77 A;  2GRC A;  2LSP B;  4LZS A;  3HME A;  3D7C A;  5D25 A;  5DY7 A;  5E9K A;  2DVQ A;  4YYK A;  3O37 A;  4Z1S A;  2RNW A;  1E6I A;  5CQ6 A;  5D3T A;  2L5E A;  4YYH A;  1EQF A;  5CQA A;  4CUR A;  4YYI A;  5C7N A;  4IR3 A;  5IBN A;  5HRX A;  4YY4 A;  5BT4 A;  3S92 A;  2DAT A;  3DAI A;  4TZ2 A;  4QNS A;  4IOQ A;  5L96 A;  5KTX A;  3G0J A;  2E7O A;  5CUA A;  5DFD A;  5EWD A;  4QUT A;  4YBM A;  3ZYU A;  5D3J A;  4LRG A;  5CGP A;  4O78 A;  5A5S A;  4A9O A;  5IGL A;  4MR5 A;  2F6N A;  5LKX A;  4CLB A;  5LJ1 A;  4PY6 A;  5EI4 A;  4HBW A;  4HXK A;  4LYW A;  4BW2 A;  5ENE A;  5I89 A;  4YYJ A;  4NR6 A;  5L99 A;  3JVK A;  4PKL A;  4MR4 A;  5D3N A;  4QSV A;  2R10 A;  4TU6 A;  5HRW A;  3MB4 A;  2YW5 A;  5ENG A;  3LQI A;  4N4H A;  5E74 A;  4QSP A;  5CQT A;  5A5O A;  3UVW A;  3UVD A;  4HXR A;  4PCE A;  4LZR A;  5A81 A;  4IR4 A;  5KTW A;  3P1C A;  4LR6 A;  2OO1 A;  4UYG A;  4YYM A;  3ONI A;  2WP2 A;  5FE2 A;  5HEL A;  5DLX A;  2RI7 A;  4O71 A;  3P1D A;  2DKW A;  3D1B A;  5E9M A;  3I3J A;  5EK9 A;  5DX4 A;  4OGJ A;  4NR4 A;  4BW1 A;  4KV1 A;  2KTB B;  4NRA A;  2D82 A;  5D3P A;  2EJN A;  5IGM A;  4YAT A;  4LDF A;  4MR6 A;  4MEP A;  2E7N A;  4J3I A;  4IR6 A;  5EM3 A;  5CRZ A;  5DW1 A;  5F62 A;  5ENC A;  5CFW A;  5I86 A;  3UV2 A;  4AKG A;  5FG4 A;  4Q0O A;  5I88 A;  2DVV A;  4ZC9 A;  5LUU A;  4O7B A;  5COI A;  5F2P A;  5G4R A;  5FFV A;  3P1F A;  4HXS A;  5E9L A;  4YY6 A;  5IID A;  4AKI A;  5DYC A;  2DVS A;  4ALH A;  2R0V A;  3U5N A;  4QR4 A;  4CFL A;  4PS5 A;  4QC1 A;  4KV4 A;  5FE6 A;  5FBX A;  4UYH A;  5E9Y A;  5K29 A;  5A5R A;  4XY9 A;  5FG6 A;  4LZ2 A;  5DKC A;  3UV5 A;  1PUO A;  5CPE A;  2DVR A;  5CUG A;  4YH4 A;  3RCW A;  5FB0 A;  3D1D A;  3MB3 A;  4CUT A;  5HLS A;  4HBV A;  4NRB A;  3GG3 A;  4LYS A;  4O7F A;  5A83 A;  5C87 A;  5FDZ A;  3MXF A;  4X2I A;  5DKH A;  4N3W A;  4NR5 A;  4TTE A;  4UIZ A;  4ALG A;  5II1 A;  4YAX A;  4O7C A;  5CUB A;  4N4G A;  5AD2 A;  5DFB A;  4QEW A;  3HMH A;  5ACY A;  3LJW A;  4Z6H A;  5E9I A;  5EWW A;  5D3H A;  4QEU A;  3JVJ A;  4A9J A;  4YK0 A;  4Q0N A;  4NQN A;  5HEN A;  4OUF A;  2DWW A;  2L85 A;  2N9G A;  3JVL A;  5CRM A;  5DW2 A;  5LKU A;  5ETD A;  4QYD A;  3JVM A;  4NUC A;  5FH6 A;  4IOO A;  5LVR A;  5L97 A;  3QZV A;  4A9I A;  3SVF A;  3VKH A;  4QYL A;  4OGI A;  4AKH A;  1ZKR A;  3MUL A;  3FKM X;  1WUG A;  4HXO A;  5FE4 A;  4NRC A;  4O70 A;  4UIX A;  5E3G A;  3P1E A;  4BHW A;  4C66 A;  2R0Y A;  5EV9 A;  3TLP A;  4Z6I A;  2MJV B;  5D3R A;  3AAD A;  5DFC A;  4QSX A;  4TU4 A;  1N72 A;  5HM0 A;  5F1H A;  3Q2E A;  2L84 A;  4J0R A;  5CUD A;  4TT2 A;  3UV4 A;  2YQD A;  5IGN A;  5L8T A;  3VKG A;  5E73 A;  5ENJ A;  4CUP A;  4Z93 A;  5J0D A;  4IR5 A;  4QST A;  4NUE A;  4RVR A;  1WUM A;  5D0C A;  2E3K A;  3LQJ A;  5FE9 A;  3IU6 A;  4HXM A;  4AI6 A;  5KO4 A;  5EU1 A;  3QZS A;  5H85 A;  5LKT A;  4J1P A;  5ENB A;  1JM4 B;  2F6J A;  2WP1 A;  3O35 A;  5A85 A;  4ZQL A;  5CQ8 A;  4A9M A;  5I7Y A;  5A5N A;  3O34 A;  4A9K A;  5ENH A;  5E0R A;  5A5Q A;  5F1L A;  4UIU A;  4PCI A;  3Q2F A;  5II2 A;  1X0J A;  3MQM A;  4UIY A;  3U5L A;  5DKD A;  5EP7 A;  5EWH A;  5CTL A;  5EWV A;  4DON A;  2RS9 B;  5A7C A;  5FE0 A;  4QSW A;  5HQ7 A;  5I7X A;  3ERR A;  5DYA A;  5I40 A;  4TT4 A;  2YYN A;  4XUB A;  5TCM A;  4N4I A;  2H60 A;  4QBM A;  4E96 A;  4FLP A;  4O76 A;  4WHU A;  4CUQ A;  4A9F A;  5FE5 A;  4TQN A;  5F3A A;  3U5M A;  3U5P A;  3DWY A;  5FB1 A;  4MEQ A;  4HBX A;  4NQM A;  4MEO A;  5AMF A;  5CY9 A;  4QSS A;  4UYF A;  5E9V A;  2YDW A;  2D9E A;  5I29 A;  3QZT A;  3UVY A;  5F60 A;  5C8G A;  4O7E A;  2YEK A;  4XYA A;  4YAB A;  5H1U A;  4YC9 A;  5AME A;  5I1Q A;  4CUS A;  3S91 A;  3P5O A;  5CS8 A;  5D3S A;  4YYG A;  4WHW A;  5HQ5 A;  4HXP A;  4XY8 A;  4HXN A;  1F68 A;  4NR9 A;  5DLZ A;  5C4Q A;  3AQA A;  5FH8 A;  5H1T A;  5LJ2 A;  4O74 A;  5FG5 A;  4TYL A;  5CU8 A;  4YAD A;  3LXJ A;  5CQ4 A;  4HBY A;  4PTB A;  4NUD A;  1ZS5 A;  4AKN A;  5EVA A;  3UVX A;  5EGU A;  2G4A A;  4O7A A;  4QSR A;  3O33 A;  4A9E A;  5C85 A;  4CL9 A;  4MR3 A;  5EA1 A;  4NS5 A;  5ENI A;  4GPJ A;  4QSU A;  5HEM A;  4YYN A;  4NYW A;  5CZG A;  5G4S A;  5EQ1 A;  2NXB A;  5HRV A;  5D7X A;  4HXL A;  2I8N A;  5FE1 A;  4NYV A;  2YEL A;  4UYF B;  4BJX A;  4CUU A;  5JI8 A;  2RNY A;  4QSQ A;  5F36 A;  5LVQ A;  5FH7 A;  4C67 A;  3U5K A;  5KU3 A;  5HFQ A;  4YBS A;  2RNX A;  2YEM A;  5IGK A;  3NXB A;  5AD3 A;  3IU5 A;  4KCX A;  3HMF A;  4NXJ A;  5TB6 A;  4NYX A;  2R0S A;  5E7D A;  5F5Z A;  3O36 A;  5CUE A;  5ETB A;  5C89 A;  2I7K A;  4O75 A;  4A9L A;  2FSA A;  5EPS A;  4YYD A;  4NR7 A;  5CQ5 A;  4QB3 A;  5F61 A;  3MUK A;  5FE3 A;  4TS8 A;  5EPB A;  4QR3 A;  4Z1Q A;  4A9N A; 
#chains in the Genus database with same CATH homology
 2RO1 A;  5FFW A;  3U5J A;  4QC3 A;  5LJ0 A;  4QEV A;  5EPR A;  4F3I A;  1JSP B;  4N4F A;  5DBM A;  5BT5 A;  4BW4 A;  3U5O A;  5LKZ A;  5L8U A;  5KTU A;  5E3D A;  5ENF A;  4LYI A;  5A5P A;  4NR8 A;  4J0S A;  4Y03 A;  5A82 A;  5EWC A;  5HQ6 A;  5KHM A;  4YH3 A;  4A9H A;  5CQ3 A;  3LQH A;  5HFR A;  5JWM A;  5FE7 A;  5H1V A;  4UYD A;  4MEN A;  3SVG A;  5I80 A;  2OUO A;  4BW3 A;  4WIV A;  3SVH A;  4UYE A;  4YBT A;  4UIW A;  4QR5 A;  4IOR A;  5CUC A;  5CQ7 A;  3UW9 A;  4TT6 A;  2RFJ A;  4XUA A;  5L98 A;  4CFK A;  5IG6 A;  5F25 A;  5FFY A;  5BT3 A;  5F63 A;  5D24 A;  5D26 A;  3K2J A;  5HCL A;  5CP5 A;  5FE8 A;  4TZ8 A;  5EIC A;  2OSS A;  4UIT A;  4QZS A;  4UIV A;  5I83 A;  3G0L A;  5EIS A;  5HJC A;  5DYU A;  4ZW1 A;  4QUU A;  5D3L A;  5DYX A;  4LC2 A;  4O72 A;  4QY4 A;  4O77 A;  2GRC A;  2LSP B;  4LZS A;  3HME A;  3D7C A;  5D25 A;  5DY7 A;  5E9K A;  2DVQ A;  4YYK A;  3O37 A;  4Z1S A;  2RNW A;  1E6I A;  5CQ6 A;  5D3T A;  2L5E A;  4YYH A;  1EQF A;  5CQA A;  4CUR A;  4YYI A;  5C7N A;  4IR3 A;  5IBN A;  5HRX A;  4YY4 A;  5BT4 A;  3S92 A;  2DAT A;  3DAI A;  4TZ2 A;  4QNS A;  4IOQ A;  5L96 A;  5KTX A;  3G0J A;  2E7O A;  5CUA A;  5DFD A;  5EWD A;  4QUT A;  4YBM A;  3ZYU A;  5D3J A;  4LRG A;  5CGP A;  4O78 A;  5A5S A;  4A9O A;  5IGL A;  4MR5 A;  2F6N A;  5LKX A;  4CLB A;  5LJ1 A;  4PY6 A;  5EI4 A;  4HBW A;  4HXK A;  4LYW A;  4BW2 A;  5ENE A;  5I89 A;  4YYJ A;  4NR6 A;  5L99 A;  3JVK A;  4PKL A;  4MR4 A;  5D3N A;  4QSV A;  2R10 A;  4TU6 A;  5HRW A;  3MB4 A;  2YW5 A;  5ENG A;  3LQI A;  4N4H A;  5E74 A;  4QSP A;  5CQT A;  5A5O A;  3UVW A;  3UVD A;  4HXR A;  4PCE A;  4LZR A;  5A81 A;  4IR4 A;  5KTW A;  3P1C A;  4LR6 A;  2OO1 A;  4UYG A;  4YYM A;  3ONI A;  2WP2 A;  5FE2 A;  5HEL A;  5DLX A;  2RI7 A;  4O71 A;  3P1D A;  2DKW A;  5E9M A;  3I3J A;  5EK9 A;  5DX4 A;  4OGJ A;  4NR4 A;  4BW1 A;  4KV1 A;  2KTB B;  4NRA A;  2D82 A;  5D3P A;  5IGM A;  4YAT A;  4LDF A;  4MR6 A;  4MEP A;  2E7N A;  4J3I A;  4IR6 A;  5EM3 A;  5CRZ A;  5DW1 A;  5F62 A;  5ENC A;  5CFW A;  5I86 A;  3UV2 A;  5FG4 A;  4Q0O A;  5I88 A;  2DVV A;  4ZC9 A;  5LUU A;  4O7B A;  5COI A;  5F2P A;  5G4R A;  5FFV A;  3P1F A;  4HXS A;  5E9L A;  4YY6 A;  5IID A;  5DYC A;  2DVS A;  4ALH A;  2R0V A;  3U5N A;  4QR4 A;  4CFL A;  4PS5 A;  4QC1 A;  4KV4 A;  5FE6 A;  5FBX A;  4UYH A;  5E9Y A;  5K29 A;  5A5R A;  4XY9 A;  5FG6 A;  4LZ2 A;  5DKC A;  3UV5 A;  5CPE A;  2DVR A;  5CUG A;  4YH4 A;  3RCW A;  5FB0 A;  3MB3 A;  4CUT A;  5HLS A;  4HBV A;  4NRB A;  3GG3 A;  4LYS A;  4O7F A;  5A83 A;  5C87 A;  5FDZ A;  3MXF A;  4X2I A;  5DKH A;  4N3W A;  4NR5 A;  4TTE A;  4UIZ A;  4ALG A;  5II1 A;  4YAX A;  4O7C A;  5CUB A;  4N4G A;  5AD2 A;  5DFB A;  4QEW A;  3HMH A;  5ACY A;  3LJW A;  4Z6H A;  5E9I A;  5EWW A;  5D3H A;  4QEU A;  3JVJ A;  4A9J A;  4YK0 A;  4Q0N A;  4NQN A;  5HEN A;  4OUF A;  2DWW A;  2L85 A;  2N9G A;  3JVL A;  5CRM A;  5DW2 A;  5LKU A;  5ETD A;  4QYD A;  3JVM A;  4NUC A;  5FH6 A;  4IOO A;  5LVR A;  5L97 A;  3QZV A;  4A9I A;  3SVF A;  4QYL A;  4OGI A;  3MUL A;  3FKM X;  1WUG A;  4HXO A;  5FE4 A;  4NRC A;  4O70 A;  4UIX A;  5E3G A;  3P1E A;  4BHW A;  4C66 A;  2R0Y A;  5EV9 A;  3TLP A;  4Z6I A;  2MJV B;  5D3R A;  3AAD A;  5DFC A;  4QSX A;  4TU4 A;  1N72 A;  5HM0 A;  5F1H A;  3Q2E A;  2L84 A;  4J0R A;  5CUD A;  4TT2 A;  3UV4 A;  2YQD A;  5IGN A;  5L8T A;  5E73 A;  5ENJ A;  4CUP A;  4Z93 A;  5J0D A;  4IR5 A;  4QST A;  4NUE A;  4RVR A;  1WUM A;  5D0C A;  2E3K A;  3LQJ A;  5FE9 A;  3IU6 A;  4HXM A;  5KO4 A;  5EU1 A;  3QZS A;  5H85 A;  5LKT A;  4J1P A;  5ENB A;  1JM4 B;  2F6J A;  2WP1 A;  3O35 A;  5A85 A;  4ZQL A;  5CQ8 A;  4A9M A;  5I7Y A;  5A5N A;  3O34 A;  4A9K A;  5ENH A;  5E0R A;  5A5Q A;  5F1L A;  4UIU A;  4PCI A;  3Q2F A;  5II2 A;  1X0J A;  3MQM A;  4UIY A;  3U5L A;  5DKD A;  5EP7 A;  5EWH A;  5CTL A;  5EWV A;  4DON A;  2RS9 B;  5A7C A;  5FE0 A;  4QSW A;  5HQ7 A;  5I7X A;  5DYA A;  5I40 A;  4TT4 A;  2YYN A;  4XUB A;  5TCM A;  4N4I A;  2H60 A;  4QBM A;  4E96 A;  4FLP A;  4O76 A;  4WHU A;  4CUQ A;  4A9F A;  5FE5 A;  4TQN A;  5F3A A;  3U5M A;  3U5P A;  3DWY A;  5FB1 A;  4MEQ A;  4HBX A;  4NQM A;  4MEO A;  5AMF A;  5CY9 A;  4QSS A;  4UYF A;  5E9V A;  2YDW A;  2D9E A;  5I29 A;  3QZT A;  3UVY A;  5F60 A;  5C8G A;  4O7E A;  2YEK A;  4XYA A;  4YAB A;  5H1U A;  4YC9 A;  5AME A;  5I1Q A;  4CUS A;  3S91 A;  3P5O A;  5CS8 A;  5D3S A;  4YYG A;  4WHW A;  5HQ5 A;  4HXP A;  4XY8 A;  4HXN A;  1F68 A;  4NR9 A;  5DLZ A;  5C4Q A;  3AQA A;  5FH8 A;  5H1T A;  5LJ2 A;  4O74 A;  5FG5 A;  4TYL A;  5CU8 A;  4YAD A;  3LXJ A;  5CQ4 A;  4HBY A;  4PTB A;  4NUD A;  1ZS5 A;  4AKN A;  5EVA A;  3UVX A;  5EGU A;  2G4A A;  4O7A A;  4QSR A;  3O33 A;  4A9E A;  5C85 A;  4CL9 A;  4MR3 A;  5EA1 A;  4NS5 A;  5ENI A;  4GPJ A;  4QSU A;  5HEM A;  4YYN A;  4NYW A;  5CZG A;  5G4S A;  5EQ1 A;  2NXB A;  5HRV A;  5D7X A;  4HXL A;  2I8N A;  5FE1 A;  4NYV A;  2YEL A;  4UYF B;  4BJX A;  4CUU A;  5JI8 A;  2RNY A;  4QSQ A;  5F36 A;  5LVQ A;  5FH7 A;  4C67 A;  3U5K A;  5KU3 A;  5HFQ A;  4YBS A;  2RNX A;  2YEM A;  5IGK A;  3NXB A;  5AD3 A;  3IU5 A;  4KCX A;  3HMF A;  4NXJ A;  5TB6 A;  4NYX A;  2R0S A;  5E7D A;  5F5Z A;  3O36 A;  5CUE A;  5ETB A;  5C89 A;  2I7K A;  4O75 A;  4A9L A;  2FSA A;  5EPS A;  4YYD A;  4NR7 A;  5CQ5 A;  4QB3 A;  5F61 A;  3MUK A;  5FE3 A;  4TS8 A;  5EPB A;  4QR3 A;  4Z1Q A;  4A9N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...