4QYDA

Crystal structure of the human brpf1 bromodomain in complex with a histone h4k12ac peptide
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
114
structure length
114
Chain Sequence
QLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKMGID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peregrin
publication title Structural insights into recognition of acetylated histone ligands by the BRPF1 bromodomain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 41
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2014-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4qydA00
5H1VA 4Y03A 4UYFB 5E9IA 5HLSA 4O7AA 4CURA 4QB3A 4QEVA 4O7CA 4IOQA 5FE3A 5I88A 5K29A 5E73A 5HRWA 5FE6A 4C67A 5ENBA 5DKCA 4A9NA 4A9LA 4Z1QA 5F1LA 5FG5A 5AMFA 2E7NA 5DKHA 5I83A 5J0DA 5DBMA 4O75A 4XYAA 4A9HA 5TCMA 5F60A 4YBTA 1EQFA 4KV1A 3LQHA 5FH7A 5ENEA 4YY6A 3QZVA 5FE7A 5ENGA 1F68A 4MEPA 5CUGA 3UV5A 5L99A 5EGUA 5CUEA 4UIZA 4A9EA 5I40A 5DKDA 4TTEA 4O74A 5CUBA 4YBSA 5HCLA 5EVAA 2DVSA 4PS5A 5C85A 5LVRA 5ETBA 4HBXA 5FFWA 4QSQA 5FBXA 5EM3A 4IR3A 4QSUA 4ZQLA 4UIWA 5A83A 4HBYA 4QEUA 5CQ8A 5IGNA 4KV4A 2R0VA 5IGKA 1JM4B 4J0SA 4TT2A 5I29A 5CRZA 4O7BA 5D3HA 4UIVA 4NR8A 5CQ6A 3D7CA 4O72A 5EV9A 3JVLA 5H1UA 5FE4A 5ETDA 3UVXA 4HXPA 4KCXA 5HENA 2L5EA 4TQNA 1JSPB 3NXBA 5H85A 2L84A 4NR9A 4UYEA 4QC3A 4N4GA 2N9GA 4YAXA 2KTBB 5D0CA 2I8NA 5CS8A 2DATA 3Q2EA 3RCWA 5AMEA 4CUSA 5C89A 1WUGA 3SVFA 3O35A 5A81A 5DYCA 4TU4A 4CUUA 5CUAA 4MR3A 2RNXA 4NYVA 2YYNA 4NYXA 4XUBA 4J1PA 3MQMA 4ZC9A 5LJ1A 3P1CA 4A9OA 4MR4A 4O70A 4NYWA 5D25A 5CUDA 5IG6A 3O36A 4AKNA 2H60A 4LR6A 4QEWA 5D3PA 4HBVA 4QNSA 5KTUA 4BW2A 2DKWA 5E9MA 4A9FA 2RI7A 3UV4A 5HRVA 4XY9A 4NRBA 4TZ8A 5F3AA 4OUFA 4TZ2A 3LQIA 5F1HA 5CPEA 3MUKA 4J3IA 3IU6A 4NUCA 4MEOA 5CP5A 5I7XA 5A82A 5C4QA 5G4RA 4CUPA 3S92A 3QZTA 5ACYA 5TB6A 4CFLA 4WIVA 5DY7A 4A9KA 5FDZA 5E74A 3MULA 4O7EA 5ENHA 4YYIA 4N4HA 4HXOA 5HEMA 5JI8A 3UW9A 4LRGA 2YW5A 5EPSA 5F62A 5DFCA 4BW4A 4PTBA 4HXNA 5CQ3A 3SVGA 5ENJA 5ENFA 5EICA 4TYLA 4Z93A 5L98A 5LVQA 5HFQA 4ZW1A 4NUDA 2D82A 5I89A 4O71A 5KTXA 4J0RA 4O78A 4IR4A 5IBNA 4TT6A 5CFWA 5D3NA 2DVQA 4BW1A 5HJCA 2NXBA 5EP7A 4DONA 4HXRA 4FLPA 5CTLA 4MENA 5E9KA 2F6NA 4NQMA 4TT4A 5EQ1A 4O76A 4WHWA 4QR3A 5F36A 5BT4A 2E7OA 5EWVA 5D3SA 4X2IA 3JVMA 4QYLA 5D3RA 4LZRA 4YYGA 3ZYUA 3S91A 5EPRA 4A9JA 5D3JA 5JWMA 3UV2A 5EWHA 3LXJA 5EWDA 4LZ2A 3U5LA 5FE8A 3LQJA 2LSPB 1ZS5A 5DLXA 5IGMA 5F5ZA 4YYJA 2L85A 4O77A 4QZSA 3UVYA 3AQAA 4YYHA 5FH8A 5E7DA 3FKMX 4MR5A 4IR5A 4NR6A 5ENIA 5A5NA 4QSRA 5A85A 2YQDA 4HXKA 5C7NA 4Z6IA 3U5KA 4LYSA 2YELA 4UIXA 3MB4A 5CQAA 5CU8A 3AADA 5I7YA 2YDWA 5BT5A 4UYGA 4CUTA 5I80A 5EWWA 5DFDA 3P1DA 4Q0NA 5E0RA 2G4AA 2RS9B 5LJ2A 2E3KA 5DW2A 1WUMA 5EISA 5EI4A 5L8UA 2D9EA 5BT3A 5DFBA 4HXLA 4BW3A 4YATA 5CY9A 2I7KA 5KO4A 4C66A 4NRCA 4YH3A 2RNYA 5DW1A 3O37A 3UVWA 4CLBA 3U5PA 4IORA 5FE1A 1N72A 5HELA 4UYFA 4Q0OA 5C8GA 3TLPA 3MB3A 2OUOA 4YH4A 4YK0A 5FB0A 5KU3A 3U5JA 5FG4A 2R0SA 2OSSA 4QSXA 5CUCA 2MJVB 4CL9A 4QSWA 3K2JA 4QSVA 3HMHA 5IGLA 4UITA 4LZSA 3SVHA 5CGPA 3O34A 3U5OA 4HBWA 4QR4A 5A5RA 5FG6A 5FE5A 5HRXA 5D3TA 3G0JA 4F3IA 4QSTA 5A7CA 2WP2A 4HXSA 2RFJA 2RO1A 4PKLA 4E96A 4NQNA 4GPJA 5HQ7A 4BHWA 3U5MA 5A5QA 3JVJA 5I1QA 4PCIA 4NR5A 4LDFA 4WHUA 5D3LA 5F25A 4NRAA 2R10A 3P1FA 2DVRA 5D7XA 5DYUA 4N3WA 5F63A 5CQ7A 5CZGA 5AD2A 2YEMA 4ALGA 4UIUA 4A9IA 3P1EA 5DYXA 1X0JA 4N4IA 4NXJA 2R0YA 4QSSA 5D26A 5DLZA 5FFYA 2F6JA 5FE2A 5HQ6A 3DWYA 5FE0A 4LC2A 5HM0A 4N4FA 4QUTA 4QSPA 4NUEA 5F61A 5L96A 2YEKA 4NS5A 5II2A 3QZSA 5EA1A 4YABA 4MR6A 5FH6A 5KHMA 4YYMA 2DWWA 5G4SA 3LJWA 5CQ4A 4CFKA 3DAIA 5HQ5A 2GRCA 5A5PA 4NR7A 5DYAA 4YYDA 5EPBA 5II1A 4QR5A 5LUUA 4A9MA 4PY6A 4O7FA 4IOOA 4QYDA 4Z6HA 4Z1SA 3Q2FA 4BJXA 5E3DA 5AD3A 5C87A 4PCEA 4YADA 5L97A 5FFVA 5E9VA 5EU1A 5I86A 4MEQA 3P5OA 3HMEA 5ENCA 4YBMA 3IU5A 2OO1A 4QBMA 4UYHA 5E3GA 5H1TA 4XY8A 5L8TA 1E6IA 5EK9A 5LKTA 5A5OA 5LKZA 2WP1A 4LYWA 4TU6A 4UYDA 4QY4A 4YY4A 4CUQA 3GG3A 3UVDA 5COIA 4UIYA 5IIDA 3O33A 5E9YA 4QUUA 3G0LA 4HXMA 5D24A 5A5SA 2DVVA 5F2PA 4YYNA 4XUAA 5DX4A 5E9LA 3I3JA 2FSAA 4YC9A 5CRMA 5LJ0A 5CQ5A 4QC1A 4ALHA 4RVRA 5LKUA 3HMFA 3U5NA 2RNWA 4LYIA 4YYKA 5EWCA 5KTWA 5LKXA 4NR4A 5FB1A 3JVKA 5CQTA 4TS8A 3ONIA 5FE9A 3MXFA 4OGJA 4OGIA 4IR6A 5HFRA
chains in the Genus database with same CATH superfamily
5H1VA 4Y03A 4UYFB 5E9IA 5HLSA 4O7AA 4CURA 4QB3A 4QEVA 4O7CA 4IOQA 5FE3A 5I88A 5K29A 5E73A 5HRWA 5FE6A 4C67A 5ENBA 5DKCA 4A9NA 4A9LA 4Z1QA 5F1LA 5FG5A 5AMFA 2E7NA 5DKHA 5I83A 5J0DA 5DBMA 4O75A 4XYAA 4A9HA 5TCMA 5F60A 4YBTA 1EQFA 4KV1A 3LQHA 5FH7A 5ENEA 4YY6A 4AKHA 3QZVA 5FE7A 5ENGA 1F68A 4MEPA 5CUGA 3UV5A 5L99A 5EGUA 5CUEA 4UIZA 4A9EA 5I40A 5DKDA 4TTEA 4O74A 5CUBA 4YBSA 5HCLA 5EVAA 2DVSA 4PS5A 5C85A 5LVRA 5ETBA 4HBXA 5FFWA 4QSQA 5FBXA 5EM3A 4IR3A 4QSUA 4ZQLA 4UIWA 5A83A 4HBYA 4QEUA 5CQ8A 5IGNA 4KV4A 2R0VA 5IGKA 1JM4B 4J0SA 4TT2A 5I29A 5CRZA 4O7BA 5D3HA 4UIVA 4NR8A 5CQ6A 3D7CA 4O72A 5EV9A 3JVLA 5H1UA 5FE4A 5ETDA 3UVXA 4HXPA 4KCXA 5HENA 2L5EA 4TQNA 1JSPB 3NXBA 5H85A 2L84A 4NR9A 4UYEA 4QC3A 4N4GA 2N9GA 4YAXA 2KTBB 5D0CA 2I8NA 5CS8A 2DATA 3Q2EA 4AKIA 3RCWA 5AMEA 4CUSA 5C89A 1WUGA 3SVFA 3O35A 5A81A 5DYCA 4TU4A 4CUUA 5CUAA 4MR3A 2RNXA 4NYVA 2YYNA 4NYXA 4XUBA 4J1PA 3MQMA 4ZC9A 5LJ1A 3P1CA 4A9OA 4MR4A 4O70A 4NYWA 5D25A 5CUDA 5IG6A 3O36A 4AKNA 2H60A 4LR6A 4QEWA 5D3PA 4HBVA 4QNSA 5KTUA 4BW2A 2DKWA 5E9MA 4A9FA 2RI7A 3UV4A 5HRVA 4XY9A 4NRBA 4TZ8A 5F3AA 4OUFA 4TZ2A 3LQIA 5F1HA 5CPEA 3MUKA 4J3IA 3IU6A 4NUCA 4MEOA 5CP5A 5I7XA 5A82A 5C4QA 5G4RA 4CUPA 3S92A 3QZTA 5ACYA 5TB6A 4CFLA 4WIVA 5DY7A 4A9KA 5FDZA 5E74A 3MULA 4O7EA 5ENHA 4YYIA 4N4HA 4HXOA 5HEMA 5JI8A 3UW9A 4AI6A 4LRGA 2YW5A 5EPSA 5F62A 5DFCA 4BW4A 4PTBA 4HXNA 5CQ3A 3SVGA 5ENJA 5ENFA 5EICA 4TYLA 4Z93A 5L98A 5LVQA 5HFQA 4ZW1A 4NUDA 2D82A 5I89A 4O71A 5KTXA 4J0RA 4O78A 4IR4A 5IBNA 4TT6A 5CFWA 5D3NA 2DVQA 4BW1A 5HJCA 2NXBA 5EP7A 3D1DA 4DONA 4HXRA 4FLPA 5CTLA 4MENA 5E9KA 2F6NA 4NQMA 4TT4A 5EQ1A 4O76A 4WHWA 4QR3A 5F36A 5BT4A 2E7OA 5EWVA 5D3SA 4X2IA 3JVMA 4QYLA 5D3RA 4LZRA 4YYGA 3ZYUA 3S91A 5EPRA 4A9JA 5D3JA 5JWMA 3UV2A 5EWHA 3LXJA 5EWDA 4LZ2A 3U5LA 5FE8A 3LQJA 2LSPB 1ZS5A 5DLXA 5IGMA 5F5ZA 4YYJA 2L85A 4O77A 4QZSA 3UVYA 3AQAA 4YYHA 5FH8A 5E7DA 3FKMX 4MR5A 4IR5A 4NR6A 5ENIA 5A5NA 4QSRA 5A85A 2YQDA 4HXKA 5C7NA 4Z6IA 3U5KA 3VKGA 1PUOA 4LYSA 2YELA 4UIXA 3MB4A 5CQAA 5CU8A 3AADA 5I7YA 2YDWA 5BT5A 4UYGA 4CUTA 5I80A 5EWWA 5DFDA 3P1DA 4Q0NA 5E0RA 2G4AA 2RS9B 5LJ2A 2E3KA 5DW2A 1WUMA 5EISA 3VKHA 5EI4A 5L8UA 2D9EA 5BT3A 5DFBA 4HXLA 4BW3A 4YATA 5CY9A 2I7KA 5KO4A 4C66A 4NRCA 4YH3A 2RNYA 5DW1A 3O37A 3UVWA 4CLBA 3U5PA 4IORA 5FE1A 1N72A 5HELA 4UYFA 4Q0OA 5C8GA 3TLPA 3MB3A 2OUOA 4YH4A 4YK0A 1ZKRA 5FB0A 5KU3A 3U5JA 5FG4A 2R0SA 2OSSA 4QSXA 5CUCA 2MJVB 4CL9A 4QSWA 3K2JA 4QSVA 3HMHA 5IGLA 4UITA 4LZSA 3SVHA 5CGPA 3O34A 3U5OA 4HBWA 4QR4A 5A5RA 5FG6A 5FE5A 5HRXA 3D1BA 5D3TA 3G0JA 4F3IA 4QSTA 5A7CA 2WP2A 4HXSA 2RFJA 2RO1A 4PKLA 4E96A 4NQNA 4GPJA 5HQ7A 4BHWA 3U5MA 5A5QA 3JVJA 5I1QA 4PCIA 4NR5A 4LDFA 4WHUA 5D3LA 5F25A 4NRAA 2R10A 3P1FA 2DVRA 5D7XA 5DYUA 4N3WA 5F63A 5CQ7A 5CZGA 5AD2A 2YEMA 4ALGA 3ERRA 4UIUA 4A9IA 3P1EA 5DYXA 1X0JA 4N4IA 4NXJA 2R0YA 4QSSA 5D26A 5DLZA 5FFYA 2F6JA 5FE2A 5HQ6A 3DWYA 5FE0A 4LC2A 5HM0A 4N4FA 4QUTA 4QSPA 4NUEA 5F61A 5L96A 2YEKA 2EJNA 4NS5A 5II2A 3QZSA 5EA1A 4YABA 4MR6A 5FH6A 5KHMA 4YYMA 2DWWA 5G4SA 3LJWA 5CQ4A 4CFKA 3DAIA 5HQ5A 2GRCA 5A5PA 4NR7A 5DYAA 4YYDA 5EPBA 5II1A 4QR5A 5LUUA 4A9MA 4PY6A 4O7FA 4IOOA 4QYDA 4Z6HA 4Z1SA 3Q2FA 4BJXA 5E3DA 5AD3A 5C87A 4PCEA 4YADA 5L97A 5FFVA 5E9VA 5EU1A 5I86A 4MEQA 3P5OA 3HMEA 5ENCA 4YBMA 3IU5A 2OO1A 4QBMA 4UYHA 5E3GA 5H1TA 4XY8A 5L8TA 1E6IA 5EK9A 5LKTA 5A5OA 5LKZA 2WP1A 4LYWA 4TU6A 4UYDA 4QY4A 4YY4A 4CUQA 3GG3A 3UVDA 5COIA 4UIYA 5IIDA 3O33A 5E9YA 4QUUA 3G0LA 4HXMA 5D24A 4AKGA 5A5SA 2DVVA 5F2PA 4YYNA 4XUAA 5DX4A 5E9LA 3I3JA 2FSAA 4YC9A 5CRMA 5LJ0A 5CQ5A 4QC1A 4ALHA 4RVRA 5LKUA 3HMFA 3U5NA 2RNWA 4LYIA 4YYKA 5EWCA 5KTWA 5LKXA 4NR4A 5FB1A 3JVKA 5CQTA 4TS8A 3ONIA 5FE9A 3MXFA 4OGJA 4OGIA 4IR6A 5HFRA
chains in the Genus database with same CATH topology
5H1VA 4Y03A 4UYFB 5E9IA 5HLSA 4O7AA 4CURA 4QB3A 4QEVA 4O7CA 4IOQA 5FE3A 5I88A 5K29A 5E73A 5HRWA 5FE6A 4C67A 5ENBA 5DKCA 4A9NA 4A9LA 4Z1QA 5F1LA 5FG5A 5AMFA 2E7NA 5DKHA 5I83A 5J0DA 5DBMA 4O75A 4XYAA 4A9HA 5TCMA 5F60A 4YBTA 1EQFA 4KV1A 3LQHA 5FH7A 5ENEA 4YY6A 3QZVA 5FE7A 5ENGA 1F68A 4MEPA 5CUGA 3UV5A 5L99A 5EGUA 5CUEA 4UIZA 4A9EA 5I40A 5DKDA 4TTEA 4O74A 5CUBA 4YBSA 5HCLA 5EVAA 2DVSA 4PS5A 5C85A 5LVRA 5ETBA 4HBXA 5FFWA 4QSQA 5FBXA 5EM3A 4IR3A 4QSUA 4ZQLA 4UIWA 5A83A 4HBYA 4QEUA 5CQ8A 5IGNA 4KV4A 2R0VA 5IGKA 1JM4B 4J0SA 4TT2A 5I29A 5CRZA 4O7BA 5D3HA 4UIVA 4NR8A 5CQ6A 3D7CA 4O72A 5EV9A 3JVLA 5H1UA 5FE4A 5ETDA 3UVXA 4HXPA 4KCXA 5HENA 2L5EA 4TQNA 1JSPB 3NXBA 5H85A 2L84A 4NR9A 4UYEA 4QC3A 4N4GA 2N9GA 4YAXA 2KTBB 5D0CA 2I8NA 5CS8A 2DATA 3Q2EA 3RCWA 5AMEA 4CUSA 5C89A 1WUGA 3SVFA 3O35A 5A81A 5DYCA 4TU4A 4CUUA 5CUAA 4MR3A 2RNXA 4NYVA 2YYNA 4NYXA 4XUBA 4J1PA 3MQMA 4ZC9A 5LJ1A 3P1CA 4A9OA 4MR4A 4O70A 4NYWA 5D25A 5CUDA 5IG6A 3O36A 4AKNA 2H60A 4LR6A 4QEWA 5D3PA 4HBVA 4QNSA 5KTUA 4BW2A 2DKWA 5E9MA 4A9FA 2RI7A 3UV4A 5HRVA 4XY9A 4NRBA 4TZ8A 5F3AA 4OUFA 4TZ2A 3LQIA 5F1HA 5CPEA 3MUKA 4J3IA 3IU6A 4NUCA 4MEOA 5CP5A 5I7XA 5A82A 5C4QA 5G4RA 4CUPA 3S92A 3QZTA 5ACYA 5TB6A 4CFLA 4WIVA 5DY7A 4A9KA 5FDZA 5E74A 3MULA 4O7EA 5ENHA 4YYIA 4N4HA 4HXOA 5HEMA 5JI8A 3UW9A 4LRGA 2YW5A 5EPSA 5F62A 5DFCA 4BW4A 4PTBA 4HXNA 5CQ3A 3SVGA 5ENJA 5ENFA 5EICA 4TYLA 4Z93A 5L98A 5LVQA 5HFQA 4ZW1A 4NUDA 2D82A 5I89A 4O71A 5KTXA 4J0RA 4O78A 4IR4A 5IBNA 4TT6A 5CFWA 5D3NA 2DVQA 4BW1A 5HJCA 2NXBA 5EP7A 4DONA 4HXRA 4FLPA 5CTLA 4MENA 5E9KA 2F6NA 4NQMA 4TT4A 5EQ1A 4O76A 4WHWA 4QR3A 5F36A 5BT4A 2E7OA 5EWVA 5D3SA 4X2IA 3JVMA 4QYLA 5D3RA 4LZRA 4YYGA 3ZYUA 3S91A 5EPRA 4A9JA 5D3JA 5JWMA 3UV2A 5EWHA 3LXJA 5EWDA 4LZ2A 3U5LA 5FE8A 3LQJA 2LSPB 1ZS5A 5DLXA 5IGMA 5F5ZA 4YYJA 2L85A 4O77A 4QZSA 3UVYA 3AQAA 4YYHA 5FH8A 5E7DA 3FKMX 4MR5A 4IR5A 4NR6A 5ENIA 5A5NA 4QSRA 5A85A 2YQDA 4HXKA 5C7NA 4Z6IA 3U5KA 4LYSA 2YELA 4UIXA 3MB4A 5CQAA 5CU8A 3AADA 5I7YA 2YDWA 5BT5A 4UYGA 4CUTA 5I80A 5EWWA 5DFDA 3P1DA 4Q0NA 5E0RA 2G4AA 2RS9B 5LJ2A 2E3KA 5DW2A 1WUMA 5EISA 5EI4A 5L8UA 2D9EA 5BT3A 5DFBA 4HXLA 4BW3A 4YATA 5CY9A 2I7KA 5KO4A 4C66A 4NRCA 4YH3A 2RNYA 5DW1A 3O37A 3UVWA 4CLBA 3U5PA 4IORA 5FE1A 1N72A 5HELA 4UYFA 4Q0OA 5C8GA 3TLPA 3MB3A 2OUOA 4YH4A 4YK0A 5FB0A 5KU3A 3U5JA 5FG4A 2R0SA 2OSSA 4QSXA 5CUCA 2MJVB 4CL9A 4QSWA 3K2JA 4QSVA 3HMHA 5IGLA 4UITA 4LZSA 3SVHA 5CGPA 3O34A 3U5OA 4HBWA 4QR4A 5A5RA 5FG6A 5FE5A 5HRXA 5D3TA 3G0JA 4F3IA 4QSTA 5A7CA 2WP2A 4HXSA 2RFJA 2RO1A 4PKLA 4E96A 4NQNA 4GPJA 5HQ7A 4BHWA 3U5MA 5A5QA 3JVJA 5I1QA 4PCIA 4NR5A 4LDFA 4WHUA 5D3LA 5F25A 4NRAA 2R10A 3P1FA 2DVRA 5D7XA 5DYUA 4N3WA 5F63A 5CQ7A 5CZGA 5AD2A 2YEMA 4ALGA 4UIUA 4A9IA 3P1EA 5DYXA 1X0JA 4N4IA 4NXJA 2R0YA 4QSSA 5D26A 5DLZA 5FFYA 2F6JA 5FE2A 5HQ6A 3DWYA 5FE0A 4LC2A 5HM0A 4N4FA 4QUTA 4QSPA 4NUEA 5F61A 5L96A 2YEKA 4NS5A 5II2A 3QZSA 5EA1A 4YABA 4MR6A 5FH6A 5KHMA 4YYMA 2DWWA 5G4SA 3LJWA 5CQ4A 4CFKA 3DAIA 5HQ5A 2GRCA 5A5PA 4NR7A 5DYAA 4YYDA 5EPBA 5II1A 4QR5A 5LUUA 4A9MA 4PY6A 4O7FA 4IOOA 4QYDA 4Z6HA 4Z1SA 3Q2FA 4BJXA 5E3DA 5AD3A 5C87A 4PCEA 4YADA 5L97A 5FFVA 5E9VA 5EU1A 5I86A 4MEQA 3P5OA 3HMEA 5ENCA 4YBMA 3IU5A 2OO1A 4QBMA 4UYHA 5E3GA 5H1TA 4XY8A 5L8TA 1E6IA 5EK9A 5LKTA 5A5OA 5LKZA 2WP1A 4LYWA 4TU6A 4UYDA 4QY4A 4YY4A 4CUQA 3GG3A 3UVDA 5COIA 4UIYA 5IIDA 3O33A 5E9YA 4QUUA 3G0LA 4HXMA 5D24A 5A5SA 2DVVA 5F2PA 4YYNA 4XUAA 5DX4A 5E9LA 3I3JA 2FSAA 4YC9A 5CRMA 5LJ0A 5CQ5A 4QC1A 4ALHA 4RVRA 5LKUA 3HMFA 3U5NA 2RNWA 4LYIA 4YYKA 5EWCA 5KTWA 5LKXA 4NR4A 5FB1A 3JVKA 5CQTA 4TS8A 3ONIA 5FE9A 3MXFA 4OGJA 4OGIA 4IR6A 5HFRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5H1V A;  4Y03 A;  4UYF B;  5E9I A;  5HLS A;  4O7A A;  4CUR A;  4QB3 A;  4QEV A;  4O7C A;  4IOQ A;  5FE3 A;  5I88 A;  5K29 A;  5E73 A;  5HRW A;  5FE6 A;  4C67 A;  5ENB A;  5DKC A;  4A9N A;  4A9L A;  4Z1Q A;  5F1L A;  5FG5 A;  5AMF A;  2E7N A;  5DKH A;  5I83 A;  5J0D A;  5DBM A;  4O75 A;  4XYA A;  4A9H A;  5TCM A;  5F60 A;  4YBT A;  1EQF A;  4KV1 A;  3LQH A;  5FH7 A;  5ENE A;  4YY6 A;  3QZV A;  5FE7 A;  5ENG A;  1F68 A;  4MEP A;  5CUG A;  3UV5 A;  5L99 A;  5EGU A;  5CUE A;  4UIZ A;  4A9E A;  5I40 A;  5DKD A;  4TTE A;  4O74 A;  5CUB A;  4YBS A;  5HCL A;  5EVA A;  2DVS A;  4PS5 A;  5C85 A;  5LVR A;  5ETB A;  4HBX A;  5FFW A;  4QSQ A;  5FBX A;  5EM3 A;  4IR3 A;  4QSU A;  4ZQL A;  4UIW A;  5A83 A;  4HBY A;  4QEU A;  5CQ8 A;  5IGN A;  4KV4 A;  2R0V A;  5IGK A;  1JM4 B;  4J0S A;  4TT2 A;  5I29 A;  5CRZ A;  4O7B A;  5D3H A;  4UIV A;  4NR8 A;  5CQ6 A;  3D7C A;  4O72 A;  5EV9 A;  3JVL A;  5H1U A;  5FE4 A;  5ETD A;  3UVX A;  4HXP A;  4KCX A;  5HEN A;  2L5E A;  4TQN A;  1JSP B;  3NXB A;  5H85 A;  2L84 A;  4NR9 A;  4UYE A;  4QC3 A;  4N4G A;  2N9G A;  4YAX A;  2KTB B;  5D0C A;  2I8N A;  5CS8 A;  2DAT A;  3Q2E A;  3RCW A;  5AME A;  4CUS A;  5C89 A;  1WUG A;  3SVF A;  3O35 A;  5A81 A;  5DYC A;  4TU4 A;  4CUU A;  5CUA A;  4MR3 A;  2RNX A;  4NYV A;  2YYN A;  4NYX A;  4XUB A;  4J1P A;  3MQM A;  4ZC9 A;  5LJ1 A;  3P1C A;  4A9O A;  4MR4 A;  4O70 A;  4NYW A;  5D25 A;  5CUD A;  5IG6 A;  3O36 A;  4AKN A;  2H60 A;  4LR6 A;  4QEW A;  5D3P A;  4HBV A;  4QNS A;  5KTU A;  4BW2 A;  2DKW A;  5E9M A;  4A9F A;  2RI7 A;  3UV4 A;  5HRV A;  4XY9 A;  4NRB A;  4TZ8 A;  5F3A A;  4OUF A;  4TZ2 A;  3LQI A;  5F1H A;  5CPE A;  3MUK A;  4J3I A;  3IU6 A;  4NUC A;  4MEO A;  5CP5 A;  5I7X A;  5A82 A;  5C4Q A;  5G4R A;  4CUP A;  3S92 A;  3QZT A;  5ACY A;  5TB6 A;  4CFL A;  4WIV A;  5DY7 A;  4A9K A;  5FDZ A;  5E74 A;  3MUL A;  4O7E A;  5ENH A;  4YYI A;  4N4H A;  4HXO A;  5HEM A;  5JI8 A;  3UW9 A;  4LRG A;  2YW5 A;  5EPS A;  5F62 A;  5DFC A;  4BW4 A;  4PTB A;  4HXN A;  5CQ3 A;  3SVG A;  5ENJ A;  5ENF A;  5EIC A;  4TYL A;  4Z93 A;  5L98 A;  5LVQ A;  5HFQ A;  4ZW1 A;  4NUD A;  2D82 A;  5I89 A;  4O71 A;  5KTX A;  4J0R A;  4O78 A;  4IR4 A;  5IBN A;  4TT6 A;  5CFW A;  5D3N A;  2DVQ A;  4BW1 A;  5HJC A;  2NXB A;  5EP7 A;  4DON A;  4HXR A;  4FLP A;  5CTL A;  4MEN A;  5E9K A;  2F6N A;  4NQM A;  4TT4 A;  5EQ1 A;  4O76 A;  4WHW A;  4QR3 A;  5F36 A;  5BT4 A;  2E7O A;  5EWV A;  5D3S A;  4X2I A;  3JVM A;  4QYL A;  5D3R A;  4LZR A;  4YYG A;  3ZYU A;  3S91 A;  5EPR A;  4A9J A;  5D3J A;  5JWM A;  3UV2 A;  5EWH A;  3LXJ A;  5EWD A;  4LZ2 A;  3U5L A;  5FE8 A;  3LQJ A;  2LSP B;  1ZS5 A;  5DLX A;  5IGM A;  5F5Z A;  4YYJ A;  2L85 A;  4O77 A;  4QZS A;  3UVY A;  3AQA A;  4YYH A;  5FH8 A;  5E7D A;  3FKM X;  4MR5 A;  4IR5 A;  4NR6 A;  5ENI A;  5A5N A;  4QSR A;  5A85 A;  2YQD A;  4HXK A;  5C7N A;  4Z6I A;  3U5K A;  4LYS A;  2YEL A;  4UIX A;  3MB4 A;  5CQA A;  5CU8 A;  3AAD A;  5I7Y A;  2YDW A;  5BT5 A;  4UYG A;  4CUT A;  5I80 A;  5EWW A;  5DFD A;  3P1D A;  4Q0N A;  5E0R A;  2G4A A;  2RS9 B;  5LJ2 A;  2E3K A;  5DW2 A;  1WUM A;  5EIS A;  5EI4 A;  5L8U A;  2D9E A;  5BT3 A;  5DFB A;  4HXL A;  4BW3 A;  4YAT A;  5CY9 A;  2I7K A;  5KO4 A;  4C66 A;  4NRC A;  4YH3 A;  2RNY A;  5DW1 A;  3O37 A;  3UVW A;  4CLB A;  3U5P A;  4IOR A;  5FE1 A;  1N72 A;  5HEL A;  4UYF A;  4Q0O A;  5C8G A;  3TLP A;  3MB3 A;  2OUO A;  4YH4 A;  4YK0 A;  5FB0 A;  5KU3 A;  3U5J A;  5FG4 A;  2R0S A;  2OSS A;  4QSX A;  5CUC A;  2MJV B;  4CL9 A;  4QSW A;  3K2J A;  4QSV A;  3HMH A;  5IGL A;  4UIT A;  4LZS A;  3SVH A;  5CGP A;  3O34 A;  3U5O A;  4HBW A;  4QR4 A;  5A5R A;  5FG6 A;  5FE5 A;  5HRX A;  5D3T A;  3G0J A;  4F3I A;  4QST A;  5A7C A;  2WP2 A;  4HXS A;  2RFJ A;  2RO1 A;  4PKL A;  4E96 A;  4NQN A;  4GPJ A;  5HQ7 A;  4BHW A;  3U5M A;  5A5Q A;  3JVJ A;  5I1Q A;  4PCI A;  4NR5 A;  4LDF A;  4WHU A;  5D3L A;  5F25 A;  4NRA A;  2R10 A;  3P1F A;  2DVR A;  5D7X A;  5DYU A;  4N3W A;  5F63 A;  5CQ7 A;  5CZG A;  5AD2 A;  2YEM A;  4ALG A;  4UIU A;  4A9I A;  3P1E A;  5DYX A;  1X0J A;  4N4I A;  4NXJ A;  2R0Y A;  4QSS A;  5D26 A;  5DLZ A;  5FFY A;  2F6J A;  5FE2 A;  5HQ6 A;  3DWY A;  5FE0 A;  4LC2 A;  5HM0 A;  4N4F A;  4QUT A;  4QSP A;  4NUE A;  5F61 A;  5L96 A;  2YEK A;  4NS5 A;  5II2 A;  3QZS A;  5EA1 A;  4YAB A;  4MR6 A;  5FH6 A;  5KHM A;  4YYM A;  2DWW A;  5G4S A;  3LJW A;  5CQ4 A;  4CFK A;  3DAI A;  5HQ5 A;  2GRC A;  5A5P A;  4NR7 A;  5DYA A;  4YYD A;  5EPB A;  5II1 A;  4QR5 A;  5LUU A;  4A9M A;  4PY6 A;  4O7F A;  4IOO A;  4QYD A;  4Z6H A;  4Z1S A;  3Q2F A;  4BJX A;  5E3D A;  5AD3 A;  5C87 A;  4PCE A;  4YAD A;  5L97 A;  5FFV A;  5E9V A;  5EU1 A;  5I86 A;  4MEQ A;  3P5O A;  3HME A;  5ENC A;  4YBM A;  3IU5 A;  2OO1 A;  4QBM A;  4UYH A;  5E3G A;  5H1T A;  4XY8 A;  5L8T A;  1E6I A;  5EK9 A;  5LKT A;  5A5O A;  5LKZ A;  2WP1 A;  4LYW A;  4TU6 A;  4UYD A;  4QY4 A;  4YY4 A;  4CUQ A;  3GG3 A;  3UVD A;  5COI A;  4UIY A;  5IID A;  3O33 A;  5E9Y A;  4QUU A;  3G0L A;  4HXM A;  5D24 A;  5A5S A;  2DVV A;  5F2P A;  4YYN A;  4XUA A;  5DX4 A;  5E9L A;  3I3J A;  2FSA A;  4YC9 A;  5CRM A;  5LJ0 A;  5CQ5 A;  4QC1 A;  4ALH A;  4RVR A;  5LKU A;  3HMF A;  3U5N A;  2RNW A;  4LYI A;  4YYK A;  5EWC A;  5KTW A;  5LKX A;  4NR4 A;  5FB1 A;  3JVK A;  5CQT A;  4TS8 A;  3ONI A;  5FE9 A;  3MXF A;  4OGJ A;  4OGI A;  4IR6 A;  5HFR A; 
#chains in the Genus database with same CATH topology
 5H1V A;  4Y03 A;  4UYF B;  5E9I A;  5HLS A;  4O7A A;  4CUR A;  4QB3 A;  4QEV A;  4O7C A;  4IOQ A;  5FE3 A;  5I88 A;  5K29 A;  5E73 A;  5HRW A;  5FE6 A;  4C67 A;  5ENB A;  5DKC A;  4A9N A;  4A9L A;  4Z1Q A;  5F1L A;  5FG5 A;  5AMF A;  2E7N A;  5DKH A;  5I83 A;  5J0D A;  5DBM A;  4O75 A;  4XYA A;  4A9H A;  5TCM A;  5F60 A;  4YBT A;  1EQF A;  4KV1 A;  3LQH A;  5FH7 A;  5ENE A;  4YY6 A;  4AKH A;  3QZV A;  5FE7 A;  5ENG A;  1F68 A;  4MEP A;  5CUG A;  3UV5 A;  5L99 A;  5EGU A;  5CUE A;  4UIZ A;  4A9E A;  5I40 A;  5DKD A;  4TTE A;  4O74 A;  5CUB A;  4YBS A;  5HCL A;  5EVA A;  2DVS A;  4PS5 A;  5C85 A;  5LVR A;  5ETB A;  4HBX A;  5FFW A;  4QSQ A;  5FBX A;  5EM3 A;  4IR3 A;  4QSU A;  4ZQL A;  4UIW A;  5A83 A;  4HBY A;  4QEU A;  5CQ8 A;  5IGN A;  4KV4 A;  2R0V A;  5IGK A;  1JM4 B;  4J0S A;  4TT2 A;  5I29 A;  5CRZ A;  4O7B A;  5D3H A;  4UIV A;  4NR8 A;  5CQ6 A;  3D7C A;  4O72 A;  5EV9 A;  3JVL A;  5H1U A;  5FE4 A;  5ETD A;  3UVX A;  4HXP A;  4KCX A;  5HEN A;  2L5E A;  4TQN A;  1JSP B;  3NXB A;  5H85 A;  2L84 A;  4NR9 A;  4UYE A;  4QC3 A;  4N4G A;  2N9G A;  4YAX A;  2KTB B;  5D0C A;  2I8N A;  5CS8 A;  2DAT A;  3Q2E A;  4AKI A;  3RCW A;  5AME A;  4CUS A;  5C89 A;  1WUG A;  3SVF A;  3O35 A;  5A81 A;  5DYC A;  4TU4 A;  4CUU A;  5CUA A;  4MR3 A;  2RNX A;  4NYV A;  2YYN A;  4NYX A;  4XUB A;  4J1P A;  3MQM A;  4ZC9 A;  5LJ1 A;  3P1C A;  4A9O A;  4MR4 A;  4O70 A;  4NYW A;  5D25 A;  5CUD A;  5IG6 A;  3O36 A;  4AKN A;  2H60 A;  4LR6 A;  4QEW A;  5D3P A;  4HBV A;  4QNS A;  5KTU A;  4BW2 A;  2DKW A;  5E9M A;  4A9F A;  2RI7 A;  3UV4 A;  5HRV A;  4XY9 A;  4NRB A;  4TZ8 A;  5F3A A;  4OUF A;  4TZ2 A;  3LQI A;  5F1H A;  5CPE A;  3MUK A;  4J3I A;  3IU6 A;  4NUC A;  4MEO A;  5CP5 A;  5I7X A;  5A82 A;  5C4Q A;  5G4R A;  4CUP A;  3S92 A;  3QZT A;  5ACY A;  5TB6 A;  4CFL A;  4WIV A;  5DY7 A;  4A9K A;  5FDZ A;  5E74 A;  3MUL A;  4O7E A;  5ENH A;  4YYI A;  4N4H A;  4HXO A;  5HEM A;  5JI8 A;  3UW9 A;  4AI6 A;  4LRG A;  2YW5 A;  5EPS A;  5F62 A;  5DFC A;  4BW4 A;  4PTB A;  4HXN A;  5CQ3 A;  3SVG A;  5ENJ A;  5ENF A;  5EIC A;  4TYL A;  4Z93 A;  5L98 A;  5LVQ A;  5HFQ A;  4ZW1 A;  4NUD A;  2D82 A;  5I89 A;  4O71 A;  5KTX A;  4J0R A;  4O78 A;  4IR4 A;  5IBN A;  4TT6 A;  5CFW A;  5D3N A;  2DVQ A;  4BW1 A;  5HJC A;  2NXB A;  5EP7 A;  3D1D A;  4DON A;  4HXR A;  4FLP A;  5CTL A;  4MEN A;  5E9K A;  2F6N A;  4NQM A;  4TT4 A;  5EQ1 A;  4O76 A;  4WHW A;  4QR3 A;  5F36 A;  5BT4 A;  2E7O A;  5EWV A;  5D3S A;  4X2I A;  3JVM A;  4QYL A;  5D3R A;  4LZR A;  4YYG A;  3ZYU A;  3S91 A;  5EPR A;  4A9J A;  5D3J A;  5JWM A;  3UV2 A;  5EWH A;  3LXJ A;  5EWD A;  4LZ2 A;  3U5L A;  5FE8 A;  3LQJ A;  2LSP B;  1ZS5 A;  5DLX A;  5IGM A;  5F5Z A;  4YYJ A;  2L85 A;  4O77 A;  4QZS A;  3UVY A;  3AQA A;  4YYH A;  5FH8 A;  5E7D A;  3FKM X;  4MR5 A;  4IR5 A;  4NR6 A;  5ENI A;  5A5N A;  4QSR A;  5A85 A;  2YQD A;  4HXK A;  5C7N A;  4Z6I A;  3U5K A;  3VKG A;  1PUO A;  4LYS A;  2YEL A;  4UIX A;  3MB4 A;  5CQA A;  5CU8 A;  3AAD A;  5I7Y A;  2YDW A;  5BT5 A;  4UYG A;  4CUT A;  5I80 A;  5EWW A;  5DFD A;  3P1D A;  4Q0N A;  5E0R A;  2G4A A;  2RS9 B;  5LJ2 A;  2E3K A;  5DW2 A;  1WUM A;  5EIS A;  3VKH A;  5EI4 A;  5L8U A;  2D9E A;  5BT3 A;  5DFB A;  4HXL A;  4BW3 A;  4YAT A;  5CY9 A;  2I7K A;  5KO4 A;  4C66 A;  4NRC A;  4YH3 A;  2RNY A;  5DW1 A;  3O37 A;  3UVW A;  4CLB A;  3U5P A;  4IOR A;  5FE1 A;  1N72 A;  5HEL A;  4UYF A;  4Q0O A;  5C8G A;  3TLP A;  3MB3 A;  2OUO A;  4YH4 A;  4YK0 A;  1ZKR A;  5FB0 A;  5KU3 A;  3U5J A;  5FG4 A;  2R0S A;  2OSS A;  4QSX A;  5CUC A;  2MJV B;  4CL9 A;  4QSW A;  3K2J A;  4QSV A;  3HMH A;  5IGL A;  4UIT A;  4LZS A;  3SVH A;  5CGP A;  3O34 A;  3U5O A;  4HBW A;  4QR4 A;  5A5R A;  5FG6 A;  5FE5 A;  5HRX A;  3D1B A;  5D3T A;  3G0J A;  4F3I A;  4QST A;  5A7C A;  2WP2 A;  4HXS A;  2RFJ A;  2RO1 A;  4PKL A;  4E96 A;  4NQN A;  4GPJ A;  5HQ7 A;  4BHW A;  3U5M A;  5A5Q A;  3JVJ A;  5I1Q A;  4PCI A;  4NR5 A;  4LDF A;  4WHU A;  5D3L A;  5F25 A;  4NRA A;  2R10 A;  3P1F A;  2DVR A;  5D7X A;  5DYU A;  4N3W A;  5F63 A;  5CQ7 A;  5CZG A;  5AD2 A;  2YEM A;  4ALG A;  3ERR A;  4UIU A;  4A9I A;  3P1E A;  5DYX A;  1X0J A;  4N4I A;  4NXJ A;  2R0Y A;  4QSS A;  5D26 A;  5DLZ A;  5FFY A;  2F6J A;  5FE2 A;  5HQ6 A;  3DWY A;  5FE0 A;  4LC2 A;  5HM0 A;  4N4F A;  4QUT A;  4QSP A;  4NUE A;  5F61 A;  5L96 A;  2YEK A;  2EJN A;  4NS5 A;  5II2 A;  3QZS A;  5EA1 A;  4YAB A;  4MR6 A;  5FH6 A;  5KHM A;  4YYM A;  2DWW A;  5G4S A;  3LJW A;  5CQ4 A;  4CFK A;  3DAI A;  5HQ5 A;  2GRC A;  5A5P A;  4NR7 A;  5DYA A;  4YYD A;  5EPB A;  5II1 A;  4QR5 A;  5LUU A;  4A9M A;  4PY6 A;  4O7F A;  4IOO A;  4QYD A;  4Z6H A;  4Z1S A;  3Q2F A;  4BJX A;  5E3D A;  5AD3 A;  5C87 A;  4PCE A;  4YAD A;  5L97 A;  5FFV A;  5E9V A;  5EU1 A;  5I86 A;  4MEQ A;  3P5O A;  3HME A;  5ENC A;  4YBM A;  3IU5 A;  2OO1 A;  4QBM A;  4UYH A;  5E3G A;  5H1T A;  4XY8 A;  5L8T A;  1E6I A;  5EK9 A;  5LKT A;  5A5O A;  5LKZ A;  2WP1 A;  4LYW A;  4TU6 A;  4UYD A;  4QY4 A;  4YY4 A;  4CUQ A;  3GG3 A;  3UVD A;  5COI A;  4UIY A;  5IID A;  3O33 A;  5E9Y A;  4QUU A;  3G0L A;  4HXM A;  5D24 A;  4AKG A;  5A5S A;  2DVV A;  5F2P A;  4YYN A;  4XUA A;  5DX4 A;  5E9L A;  3I3J A;  2FSA A;  4YC9 A;  5CRM A;  5LJ0 A;  5CQ5 A;  4QC1 A;  4ALH A;  4RVR A;  5LKU A;  3HMF A;  3U5N A;  2RNW A;  4LYI A;  4YYK A;  5EWC A;  5KTW A;  5LKX A;  4NR4 A;  5FB1 A;  3JVK A;  5CQT A;  4TS8 A;  3ONI A;  5FE9 A;  3MXF A;  4OGJ A;  4OGI A;  4IR6 A;  5HFR A; 
#chains in the Genus database with same CATH homology
 5H1V A;  4Y03 A;  4UYF B;  5E9I A;  5HLS A;  4O7A A;  4CUR A;  4QB3 A;  4QEV A;  4O7C A;  4IOQ A;  5FE3 A;  5I88 A;  5K29 A;  5E73 A;  5HRW A;  5FE6 A;  4C67 A;  5ENB A;  5DKC A;  4A9N A;  4A9L A;  4Z1Q A;  5F1L A;  5FG5 A;  5AMF A;  2E7N A;  5DKH A;  5I83 A;  5J0D A;  5DBM A;  4O75 A;  4XYA A;  4A9H A;  5TCM A;  5F60 A;  4YBT A;  1EQF A;  4KV1 A;  3LQH A;  5FH7 A;  5ENE A;  4YY6 A;  3QZV A;  5FE7 A;  5ENG A;  1F68 A;  4MEP A;  5CUG A;  3UV5 A;  5L99 A;  5EGU A;  5CUE A;  4UIZ A;  4A9E A;  5I40 A;  5DKD A;  4TTE A;  4O74 A;  5CUB A;  4YBS A;  5HCL A;  5EVA A;  2DVS A;  4PS5 A;  5C85 A;  5LVR A;  5ETB A;  4HBX A;  5FFW A;  4QSQ A;  5FBX A;  5EM3 A;  4IR3 A;  4QSU A;  4ZQL A;  4UIW A;  5A83 A;  4HBY A;  4QEU A;  5CQ8 A;  5IGN A;  4KV4 A;  2R0V A;  5IGK A;  1JM4 B;  4J0S A;  4TT2 A;  5I29 A;  5CRZ A;  4O7B A;  5D3H A;  4UIV A;  4NR8 A;  5CQ6 A;  3D7C A;  4O72 A;  5EV9 A;  3JVL A;  5H1U A;  5FE4 A;  5ETD A;  3UVX A;  4HXP A;  4KCX A;  5HEN A;  2L5E A;  4TQN A;  1JSP B;  3NXB A;  5H85 A;  2L84 A;  4NR9 A;  4UYE A;  4QC3 A;  4N4G A;  2N9G A;  4YAX A;  2KTB B;  5D0C A;  2I8N A;  5CS8 A;  2DAT A;  3Q2E A;  3RCW A;  5AME A;  4CUS A;  5C89 A;  1WUG A;  3SVF A;  3O35 A;  5A81 A;  5DYC A;  4TU4 A;  4CUU A;  5CUA A;  4MR3 A;  2RNX A;  4NYV A;  2YYN A;  4NYX A;  4XUB A;  4J1P A;  3MQM A;  4ZC9 A;  5LJ1 A;  3P1C A;  4A9O A;  4MR4 A;  4O70 A;  4NYW A;  5D25 A;  5CUD A;  5IG6 A;  3O36 A;  4AKN A;  2H60 A;  4LR6 A;  4QEW A;  5D3P A;  4HBV A;  4QNS A;  5KTU A;  4BW2 A;  2DKW A;  5E9M A;  4A9F A;  2RI7 A;  3UV4 A;  5HRV A;  4XY9 A;  4NRB A;  4TZ8 A;  5F3A A;  4OUF A;  4TZ2 A;  3LQI A;  5F1H A;  5CPE A;  3MUK A;  4J3I A;  3IU6 A;  4NUC A;  4MEO A;  5CP5 A;  5I7X A;  5A82 A;  5C4Q A;  5G4R A;  4CUP A;  3S92 A;  3QZT A;  5ACY A;  5TB6 A;  4CFL A;  4WIV A;  5DY7 A;  4A9K A;  5FDZ A;  5E74 A;  3MUL A;  4O7E A;  5ENH A;  4YYI A;  4N4H A;  4HXO A;  5HEM A;  5JI8 A;  3UW9 A;  4LRG A;  2YW5 A;  5EPS A;  5F62 A;  5DFC A;  4BW4 A;  4PTB A;  4HXN A;  5CQ3 A;  3SVG A;  5ENJ A;  5ENF A;  5EIC A;  4TYL A;  4Z93 A;  5L98 A;  5LVQ A;  5HFQ A;  4ZW1 A;  4NUD A;  2D82 A;  5I89 A;  4O71 A;  5KTX A;  4J0R A;  4O78 A;  4IR4 A;  5IBN A;  4TT6 A;  5CFW A;  5D3N A;  2DVQ A;  4BW1 A;  5HJC A;  2NXB A;  5EP7 A;  4DON A;  4HXR A;  4FLP A;  5CTL A;  4MEN A;  5E9K A;  2F6N A;  4NQM A;  4TT4 A;  5EQ1 A;  4O76 A;  4WHW A;  4QR3 A;  5F36 A;  5BT4 A;  2E7O A;  5EWV A;  5D3S A;  4X2I A;  3JVM A;  4QYL A;  5D3R A;  4LZR A;  4YYG A;  3ZYU A;  3S91 A;  5EPR A;  4A9J A;  5D3J A;  5JWM A;  3UV2 A;  5EWH A;  3LXJ A;  5EWD A;  4LZ2 A;  3U5L A;  5FE8 A;  3LQJ A;  2LSP B;  1ZS5 A;  5DLX A;  5IGM A;  5F5Z A;  4YYJ A;  2L85 A;  4O77 A;  4QZS A;  3UVY A;  3AQA A;  4YYH A;  5FH8 A;  5E7D A;  3FKM X;  4MR5 A;  4IR5 A;  4NR6 A;  5ENI A;  5A5N A;  4QSR A;  5A85 A;  2YQD A;  4HXK A;  5C7N A;  4Z6I A;  3U5K A;  4LYS A;  2YEL A;  4UIX A;  3MB4 A;  5CQA A;  5CU8 A;  3AAD A;  5I7Y A;  2YDW A;  5BT5 A;  4UYG A;  4CUT A;  5I80 A;  5EWW A;  5DFD A;  3P1D A;  4Q0N A;  5E0R A;  2G4A A;  2RS9 B;  5LJ2 A;  2E3K A;  5DW2 A;  1WUM A;  5EIS A;  5EI4 A;  5L8U A;  2D9E A;  5BT3 A;  5DFB A;  4HXL A;  4BW3 A;  4YAT A;  5CY9 A;  2I7K A;  5KO4 A;  4C66 A;  4NRC A;  4YH3 A;  2RNY A;  5DW1 A;  3O37 A;  3UVW A;  4CLB A;  3U5P A;  4IOR A;  5FE1 A;  1N72 A;  5HEL A;  4UYF A;  4Q0O A;  5C8G A;  3TLP A;  3MB3 A;  2OUO A;  4YH4 A;  4YK0 A;  5FB0 A;  5KU3 A;  3U5J A;  5FG4 A;  2R0S A;  2OSS A;  4QSX A;  5CUC A;  2MJV B;  4CL9 A;  4QSW A;  3K2J A;  4QSV A;  3HMH A;  5IGL A;  4UIT A;  4LZS A;  3SVH A;  5CGP A;  3O34 A;  3U5O A;  4HBW A;  4QR4 A;  5A5R A;  5FG6 A;  5FE5 A;  5HRX A;  5D3T A;  3G0J A;  4F3I A;  4QST A;  5A7C A;  2WP2 A;  4HXS A;  2RFJ A;  2RO1 A;  4PKL A;  4E96 A;  4NQN A;  4GPJ A;  5HQ7 A;  4BHW A;  3U5M A;  5A5Q A;  3JVJ A;  5I1Q A;  4PCI A;  4NR5 A;  4LDF A;  4WHU A;  5D3L A;  5F25 A;  4NRA A;  2R10 A;  3P1F A;  2DVR A;  5D7X A;  5DYU A;  4N3W A;  5F63 A;  5CQ7 A;  5CZG A;  5AD2 A;  2YEM A;  4ALG A;  4UIU A;  4A9I A;  3P1E A;  5DYX A;  1X0J A;  4N4I A;  4NXJ A;  2R0Y A;  4QSS A;  5D26 A;  5DLZ A;  5FFY A;  2F6J A;  5FE2 A;  5HQ6 A;  3DWY A;  5FE0 A;  4LC2 A;  5HM0 A;  4N4F A;  4QUT A;  4QSP A;  4NUE A;  5F61 A;  5L96 A;  2YEK A;  4NS5 A;  5II2 A;  3QZS A;  5EA1 A;  4YAB A;  4MR6 A;  5FH6 A;  5KHM A;  4YYM A;  2DWW A;  5G4S A;  3LJW A;  5CQ4 A;  4CFK A;  3DAI A;  5HQ5 A;  2GRC A;  5A5P A;  4NR7 A;  5DYA A;  4YYD A;  5EPB A;  5II1 A;  4QR5 A;  5LUU A;  4A9M A;  4PY6 A;  4O7F A;  4IOO A;  4QYD A;  4Z6H A;  4Z1S A;  3Q2F A;  4BJX A;  5E3D A;  5AD3 A;  5C87 A;  4PCE A;  4YAD A;  5L97 A;  5FFV A;  5E9V A;  5EU1 A;  5I86 A;  4MEQ A;  3P5O A;  3HME A;  5ENC A;  4YBM A;  3IU5 A;  2OO1 A;  4QBM A;  4UYH A;  5E3G A;  5H1T A;  4XY8 A;  5L8T A;  1E6I A;  5EK9 A;  5LKT A;  5A5O A;  5LKZ A;  2WP1 A;  4LYW A;  4TU6 A;  4UYD A;  4QY4 A;  4YY4 A;  4CUQ A;  3GG3 A;  3UVD A;  5COI A;  4UIY A;  5IID A;  3O33 A;  5E9Y A;  4QUU A;  3G0L A;  4HXM A;  5D24 A;  5A5S A;  2DVV A;  5F2P A;  4YYN A;  4XUA A;  5DX4 A;  5E9L A;  3I3J A;  2FSA A;  4YC9 A;  5CRM A;  5LJ0 A;  5CQ5 A;  4QC1 A;  4ALH A;  4RVR A;  5LKU A;  3HMF A;  3U5N A;  2RNW A;  4LYI A;  4YYK A;  5EWC A;  5KTW A;  5LKX A;  4NR4 A;  5FB1 A;  3JVK A;  5CQT A;  4TS8 A;  3ONI A;  5FE9 A;  3MXF A;  4OGJ A;  4OGI A;  4IR6 A;  5HFR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...