4QYDA

Crystal structure of the human brpf1 bromodomain in complex with a histone h4k12ac peptide
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
114
structure length
114
Chain Sequence
QLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKMGID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Peregrin
publication title Structural insights into recognition of acetylated histone ligands by the BRPF1 bromodomain.
pubmed doi rcsb
source organism Homo sapiens
total genus 41
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2014-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4qydA00
5HLSA 2RNWA 5FH6A 2L5EA 4J0SA 4UYGA 5L98A 4NR5A 2YQDA 5ENHA 4CUUA 5CP5A 5FE1A 5L99A 4PCIA 4NUDA 2GRCA 3MUKA 5CQ6A 2R0YA 3MXFA 3NXBA 4YYHA 4QSPA 4QBMA 4LZ2A 5E3GA 4RVRA 5CTLA 5CFWA 3ZYUA 5LJ2A 2L84A 5L8TA 4QSWA 5E9LA 5FDZA 5DW2A 5ETDA 4HBVA 5A5SA 5I7YA 5H1TA 5CQ4A 4QB3A 5CUGA 4UYFB 5ENEA 4C67A 5E9KA 5CQTA 3LQJA 4NS5A 3HMFA 5CGPA 4HXOA 5A82A 3SVGA 3P1DA 4ALGA 4O77A 2WP2A 4N4FA 5L96A 5FB1A 4TQNA 5FB0A 4Z6HA 5JWMA 4BW1A 5BT5A 5I88A 3Q2FA 2G4AA 5CQ3A 4TU6A 4J3IA 2E7NA 4UITA 5D3SA 5AMEA 3UVWA 2DKWA 4TZ8A 4YC9A 4CLBA 5F3AA 4IR3A 4J0RA 5FH7A 2N9GA 4TS8A 4DONA 4UIWA 4LR6A 5II1A 3U5LA 4TU4A 4MEOA 5DKDA 4YYNA 4QEUA 4QR4A 5JI8A 4HBYA 3IU6A 4NR8A 4YADA 5CU8A 4XYAA 2RO1A 4HXPA 5II2A 3U5NA 4Y03A 5CQ8A 5EPRA 5ENBA 4A9NA 4LYSA 4YBTA 3LJWA 5FE4A 4NRCA 4YK0A 5E9YA 4NQNA 2YEKA 5HFQA 5KHMA 4QEVA 5EA1A 5E9VA 5D0CA 3D7CA 4LC2A 3O35A 4O70A 5FFWA 4TYLA 4IR4A 2E7OA 5F60A 5EICA 2DATA 5EU1A 3O33A 4PY6A 4WHWA 4CUTA 5FE0A 5FH8A 5CRZA 4KV4A 3DAIA 3P1EA 4UYHA 5HRXA 5DYAA 2DVRA 3JVJA 5KTWA 2L85A 5DFCA 5EGUA 5FE2A 5KU3A 3LQIA 4QC3A 5CRMA 5DFBA 2YELA 3S92A 2R10A 5CQ5A 4PTBA 4MEPA 2NXBA 5EQ1A 5D3TA 5ENCA 5HQ7A 3AADA 4GPJA 5LKZA 5EWCA 5EPSA 5C87A 5DX4A 5G4SA 3MB3A 4FLPA 4MR3A 4QR3A 3O34A 5E3DA 5EWVA 4YYIA 5DW1A 4IOQA 2F6NA 4HXRA 5HRVA 3I3JA 3MB4A 4QSXA 5A5PA 3UW9A 5LKTA 4HBWA 2DVSA 4QY4A 4A9OA 2I8NA 5F25A 4ZQLA 4TZ2A 4Z1SA 5C89A 5HCLA 4YH4A 5A83A 4NR4A 5EPBA 2R0VA 3UVYA 4ZW1A 5DBMA 5A5QA 5H1UA 4QYLA 2WP1A 5H1VA 5A5RA 4IR6A 5TCMA 4ZC9A 5C7NA 5IGKA 4YABA 2H60A 4A9MA 4YY4A 5E9MA 5FE3A 2RI7A 5EK9A 5IG6A 2DVQA 5LJ1A 5CZGA 5D3LA 3G0JA 5E0RA 5DFDA 4YYJA 2RS9B 4HXLA 4NYWA 4A9KA 5CQ7A 4YYDA 5C8GA 3QZSA 5CY9A 4F3IA 2RNXA 5E7DA 4HXKA 4O71A 5D3HA 4UIXA 3AQAA 2D9EA 3LQHA 4HXSA 5LUUA 4O76A 4Q0OA 4C66A 4CURA 2YEMA 5D3JA 5ENFA 4TTEA 2RNYA 2R0SA 4HBXA 2OUOA 5FG5A 5E9IA 4NR6A 5E74A 4YBSA 5J0DA 4QNSA 3P1CA 4BJXA 5AMFA 5DY7A 4MEQA 4CUQA 5LVQA 4QYDA 5A5NA 3U5OA 1WUGA 4MR5A 5EWHA 4HXMA 4XUBA 5DKHA 1X0JA 4O72A 5F36A 5F5ZA 4LDFA 4QSSA 3TLPA 4LYIA 4X2IA 4A9IA 3P1FA 5EWDA 4WIVA 5CUEA 3ONIA 5CUCA 4N4IA 3QZVA 5HFRA 4AKNA 2MJVB 4N4GA 5COIA 4O75A 4O78A 2FSAA 5F62A 4LRGA 5I83A 4LYWA 4PCEA 4KCXA 5DKCA 3LXJA 5A7CA 4YYMA 4YYKA 5L97A 3UV4A 3P5OA 4UYEA 5F1HA 5IBNA 4HXNA 4CUPA 5HELA 3U5KA 5ENGA 2OO1A 5CUDA 4A9JA 4QZSA 5DYCA 3FKMX 4UIUA 5LKUA 1EQFA 5FFVA 3Q2EA 5LVRA 4QSRA 2E3KA 2DVVA 5CUBA 5I1QA 5IGLA 5CS8A 1JSPB 4NUCA 5FE8A 5D25A 1F68A 4O7CA 5A5OA 5H85A 5IGMA 3HMHA 4O7BA 5FG6A 1WUMA 4NR9A 5FE6A 5FE9A 4A9LA 4QSTA 4QC1A 5A81A 4MR6A 5CPEA 4YY6A 4TT6A 4LZSA 3G0LA 5KTXA 5HJCA 3SVFA 4NUEA 4PKLA 5E73A 4NXJA 5EM3A 3RCWA 4NRAA 5KO4A 5DYXA 3JVMA 4A9FA 4Q0NA 2YYNA 4QSUA 4E96A 5HM0A 1E6IA 4QEWA 4O7AA 4BW4A 5L8UA 3DWYA 5F63A 4QUUA 3O37A 5EI4A 5EP7A 4CFLA 4MENA 4NYXA 4OGJA 5C85A 5AD2A 4TT4A 4O74A 4UYFA 5LJ0A 4WHUA 5HEMA 5EV9A 2OSSA 5I89A 1JM4B 3SVHA 3GG3A 5ENIA 5AD3A 5D3PA 4UYDA 5FE5A 4TT2A 2DWWA 1N72A 4QSVA 4UIVA 4LZRA 5G4RA 4CUSA 5K29A 5I86A 3K2JA 5F2PA 4PS5A 5FG4A 5CUAA 5TB6A 4NQMA 3UV5A 4BW2A 4KV1A 5F61A 2KTBB 4CFKA 4O7FA 5DLXA 5EISA 5FE7A 4Z93A 4XY8A 3JVLA 5FBXA 3QZTA 2LSPB 2YW5A 3O36A 4YH3A 5ETBA 5I40A 5LKXA 5D3NA 5KTUA 2D82A 4BHWA 5D24A 3U5MA 5HQ5A 5CQAA 5BT3A 5EVAA 4XY9A 5EWWA 3UVXA 3MULA 4J1PA 4UIYA 4Z1QA 5F1LA 5DLZA 4Z6IA 4IOOA 3IU5A 4QUTA 4MR4A 4YAXA 5I7XA 3S91A 5I29A 4NRBA 5D3RA 5D26A 4OUFA 5D7XA 5ENJA 3U5PA 3HMEA 2RFJA 5BT4A 4ALHA 5FFYA 4CL9A 2YDWA 3UVDA 4IR5A 4YATA 5I80A 1ZS5A 4A9EA 5HQ6A 4NYVA 5HRWA 4N3WA 4O7EA 4QSQA 4YBMA 4N4HA 5C4QA 5DYUA 3MQMA 4QR5A 4NR7A 4UIZA 2I7KA 4YYGA 5HENA 4XUAA 4A9HA 4IORA 5ACYA 5IIDA 3U5JA 4BW3A 4OGIA 5IGNA 5A85A 3JVKA 2F6JA 3UV2A
chains in the Genus database with same CATH superfamily
5HLSA 2RNWA 5FH6A 2L5EA 4J0SA 4UYGA 5L98A 4NR5A 2YQDA 5ENHA 4CUUA 5CP5A 5FE1A 5L99A 4PCIA 4NUDA 2GRCA 3MUKA 5CQ6A 2R0YA 3MXFA 3NXBA 4YYHA 4QSPA 4QBMA 4LZ2A 5E3GA 4RVRA 5CTLA 5CFWA 3ZYUA 5LJ2A 4AI6A 2L84A 5L8TA 4QSWA 5E9LA 5FDZA 5DW2A 5ETDA 4HBVA 5A5SA 5I7YA 5H1TA 5CQ4A 4QB3A 5CUGA 4UYFB 5ENEA 4C67A 5E9KA 5CQTA 3LQJA 4NS5A 3HMFA 5CGPA 4HXOA 5A82A 3SVGA 3P1DA 4ALGA 4O77A 2WP2A 4N4FA 5L96A 5FB1A 4TQNA 5FB0A 4Z6HA 5JWMA 4BW1A 5BT5A 5I88A 3Q2FA 2G4AA 5CQ3A 4TU6A 4J3IA 2E7NA 4UITA 5D3SA 5AMEA 3UVWA 2DKWA 4TZ8A 4YC9A 4CLBA 5F3AA 4IR3A 4J0RA 5FH7A 2N9GA 4TS8A 4DONA 4UIWA 4LR6A 5II1A 3U5LA 4TU4A 4MEOA 5DKDA 4YYNA 4QEUA 4QR4A 5JI8A 4HBYA 3IU6A 4NR8A 4YADA 5CU8A 4XYAA 2RO1A 4HXPA 5II2A 3U5NA 4Y03A 5CQ8A 5EPRA 5ENBA 4A9NA 4LYSA 4YBTA 3LJWA 5FE4A 4NRCA 4YK0A 5E9YA 4NQNA 2YEKA 5HFQA 5KHMA 4QEVA 5EA1A 5E9VA 5D0CA 3D7CA 4LC2A 3O35A 4O70A 5FFWA 4TYLA 4IR4A 2E7OA 5F60A 5EICA 2DATA 2EJNA 3D1BA 3D1DA 5EU1A 3O33A 4PY6A 4WHWA 4CUTA 5FE0A 5FH8A 5CRZA 4KV4A 3DAIA 3P1EA 4UYHA 5HRXA 5DYAA 2DVRA 3JVJA 5KTWA 2L85A 5DFCA 5EGUA 5FE2A 5KU3A 3LQIA 4QC3A 5CRMA 5DFBA 2YELA 3S92A 2R10A 5CQ5A 4PTBA 4MEPA 2NXBA 5EQ1A 5D3TA 5ENCA 5HQ7A 3AADA 4GPJA 5LKZA 5EWCA 5EPSA 5C87A 5DX4A 5G4SA 3MB3A 4FLPA 4MR3A 4QR3A 3O34A 5E3DA 5EWVA 4YYIA 5DW1A 4IOQA 2F6NA 4HXRA 5HRVA 3I3JA 3MB4A 4QSXA 5A5PA 3UW9A 5LKTA 4HBWA 2DVSA 4QY4A 4A9OA 2I8NA 5F25A 4ZQLA 4TZ2A 4Z1SA 5C89A 1PUOA 5HCLA 4YH4A 5A83A 4NR4A 5EPBA 2R0VA 3UVYA 4ZW1A 5DBMA 5A5QA 5H1UA 4QYLA 2WP1A 5H1VA 5A5RA 4IR6A 5TCMA 4ZC9A 5C7NA 5IGKA 4YABA 2H60A 4A9MA 4YY4A 5E9MA 5FE3A 2RI7A 5EK9A 5IG6A 2DVQA 5LJ1A 5CZGA 5D3LA 3G0JA 5E0RA 5DFDA 4YYJA 2RS9B 4HXLA 4NYWA 4A9KA 5CQ7A 4YYDA 5C8GA 3QZSA 5CY9A 4F3IA 2RNXA 5E7DA 4HXKA 4O71A 5D3HA 4UIXA 3AQAA 2D9EA 3LQHA 4HXSA 5LUUA 4O76A 4Q0OA 4C66A 4CURA 2YEMA 5D3JA 5ENFA 4TTEA 2RNYA 2R0SA 4HBXA 2OUOA 5FG5A 5E9IA 4NR6A 5E74A 4YBSA 5J0DA 3VKGA 4QNSA 3P1CA 4BJXA 5AMFA 5DY7A 4MEQA 4CUQA 5LVQA 4QYDA 5A5NA 3U5OA 1WUGA 4MR5A 5EWHA 4HXMA 4XUBA 5DKHA 1X0JA 4O72A 5F36A 5F5ZA 4LDFA 4QSSA 3TLPA 4LYIA 4X2IA 3VKHA 4A9IA 3P1FA 4AKGA 5EWDA 4WIVA 5CUEA 3ONIA 5CUCA 4N4IA 3QZVA 5HFRA 4AKNA 2MJVB 4N4GA 5COIA 4O75A 4O78A 2FSAA 5F62A 4LRGA 5I83A 4LYWA 4PCEA 4KCXA 5DKCA 3LXJA 5A7CA 4YYMA 4YYKA 5L97A 3UV4A 3P5OA 4UYEA 5F1HA 5IBNA 4HXNA 4CUPA 5HELA 3U5KA 5ENGA 4AKIA 2OO1A 5CUDA 4A9JA 4QZSA 5DYCA 3FKMX 4UIUA 5LKUA 1EQFA 5FFVA 3Q2EA 5LVRA 4QSRA 2E3KA 2DVVA 5CUBA 5I1QA 5IGLA 5CS8A 1JSPB 4NUCA 5FE8A 5D25A 1F68A 4O7CA 5A5OA 5H85A 5IGMA 3HMHA 4O7BA 5FG6A 1WUMA 4NR9A 5FE6A 5FE9A 4A9LA 4QSTA 4QC1A 5A81A 4MR6A 5CPEA 4YY6A 4TT6A 4LZSA 3G0LA 5KTXA 5HJCA 3SVFA 4NUEA 4PKLA 5E73A 4NXJA 5EM3A 3RCWA 4NRAA 5KO4A 5DYXA 3JVMA 4A9FA 4Q0NA 2YYNA 4QSUA 4E96A 5HM0A 1E6IA 4QEWA 4O7AA 4BW4A 5L8UA 3DWYA 5F63A 4QUUA 3O37A 5EI4A 5EP7A 4CFLA 4MENA 4AKHA 4NYXA 4OGJA 5C85A 5AD2A 4TT4A 4O74A 4UYFA 1ZKRA 5LJ0A 4WHUA 5HEMA 5EV9A 2OSSA 5I89A 1JM4B 3SVHA 3GG3A 5ENIA 5AD3A 5D3PA 4UYDA 5FE5A 4TT2A 2DWWA 1N72A 4QSVA 4UIVA 4LZRA 5G4RA 4CUSA 5K29A 5I86A 3K2JA 5F2PA 4PS5A 5FG4A 5CUAA 5TB6A 4NQMA 3UV5A 4BW2A 4KV1A 5F61A 2KTBB 4CFKA 4O7FA 5DLXA 5EISA 5FE7A 4Z93A 4XY8A 3JVLA 5FBXA 3QZTA 2LSPB 2YW5A 3O36A 4YH3A 5ETBA 5I40A 5LKXA 5D3NA 5KTUA 2D82A 4BHWA 5D24A 3U5MA 5HQ5A 5CQAA 5BT3A 5EVAA 4XY9A 5EWWA 3UVXA 3MULA 4J1PA 4UIYA 4Z1QA 5F1LA 5DLZA 4Z6IA 4IOOA 3IU5A 4QUTA 4MR4A 4YAXA 5I7XA 3S91A 5I29A 4NRBA 5D3RA 5D26A 4OUFA 5D7XA 5ENJA 3U5PA 3HMEA 2RFJA 5BT4A 4ALHA 5FFYA 3ERRA 4CL9A 2YDWA 3UVDA 4IR5A 4YATA 5I80A 1ZS5A 4A9EA 5HQ6A 4NYVA 5HRWA 4N3WA 4O7EA 4QSQA 4YBMA 4N4HA 5C4QA 5DYUA 3MQMA 4QR5A 4NR7A 4UIZA 2I7KA 4YYGA 5HENA 4XUAA 4A9HA 4IORA 5ACYA 5IIDA 3U5JA 4BW3A 4OGIA 5IGNA 5A85A 3JVKA 2F6JA 3UV2A
chains in the Genus database with same CATH topology
5HLSA 2RNWA 5FH6A 2L5EA 4J0SA 4UYGA 5L98A 4NR5A 2YQDA 5ENHA 4CUUA 5CP5A 5FE1A 5L99A 4PCIA 4NUDA 2GRCA 3MUKA 5CQ6A 2R0YA 3MXFA 3NXBA 4YYHA 4QSPA 4QBMA 4LZ2A 5E3GA 4RVRA 5CTLA 5CFWA 3ZYUA 5LJ2A 2L84A 5L8TA 4QSWA 5E9LA 5FDZA 5DW2A 5ETDA 4HBVA 5A5SA 5I7YA 5H1TA 5CQ4A 4QB3A 5CUGA 4UYFB 5ENEA 4C67A 5E9KA 5CQTA 3LQJA 4NS5A 3HMFA 5CGPA 4HXOA 5A82A 3SVGA 3P1DA 4ALGA 4O77A 2WP2A 4N4FA 5L96A 5FB1A 4TQNA 5FB0A 4Z6HA 5JWMA 4BW1A 5BT5A 5I88A 3Q2FA 2G4AA 5CQ3A 4TU6A 4J3IA 2E7NA 4UITA 5D3SA 5AMEA 3UVWA 2DKWA 4TZ8A 4YC9A 4CLBA 5F3AA 4IR3A 4J0RA 5FH7A 2N9GA 4TS8A 4DONA 4UIWA 4LR6A 5II1A 3U5LA 4TU4A 4MEOA 5DKDA 4YYNA 4QEUA 4QR4A 5JI8A 4HBYA 3IU6A 4NR8A 4YADA 5CU8A 4XYAA 2RO1A 4HXPA 5II2A 3U5NA 4Y03A 5CQ8A 5EPRA 5ENBA 4A9NA 4LYSA 4YBTA 3LJWA 5FE4A 4NRCA 4YK0A 5E9YA 4NQNA 2YEKA 5HFQA 5KHMA 4QEVA 5EA1A 5E9VA 5D0CA 3D7CA 4LC2A 3O35A 4O70A 5FFWA 4TYLA 4IR4A 2E7OA 5F60A 5EICA 2DATA 5EU1A 3O33A 4PY6A 4WHWA 4CUTA 5FE0A 5FH8A 5CRZA 4KV4A 3DAIA 3P1EA 4UYHA 5HRXA 5DYAA 2DVRA 3JVJA 5KTWA 2L85A 5DFCA 5EGUA 5FE2A 5KU3A 3LQIA 4QC3A 5CRMA 5DFBA 2YELA 3S92A 2R10A 5CQ5A 4PTBA 4MEPA 2NXBA 5EQ1A 5D3TA 5ENCA 5HQ7A 3AADA 4GPJA 5LKZA 5EWCA 5EPSA 5C87A 5DX4A 5G4SA 3MB3A 4FLPA 4MR3A 4QR3A 3O34A 5E3DA 5EWVA 4YYIA 5DW1A 4IOQA 2F6NA 4HXRA 5HRVA 3I3JA 3MB4A 4QSXA 5A5PA 3UW9A 5LKTA 4HBWA 2DVSA 4QY4A 4A9OA 2I8NA 5F25A 4ZQLA 4TZ2A 4Z1SA 5C89A 5HCLA 4YH4A 5A83A 4NR4A 5EPBA 2R0VA 3UVYA 4ZW1A 5DBMA 5A5QA 5H1UA 4QYLA 2WP1A 5H1VA 5A5RA 4IR6A 5TCMA 4ZC9A 5C7NA 5IGKA 4YABA 2H60A 4A9MA 4YY4A 5E9MA 5FE3A 2RI7A 5EK9A 5IG6A 2DVQA 5LJ1A 5CZGA 5D3LA 3G0JA 5E0RA 5DFDA 4YYJA 2RS9B 4HXLA 4NYWA 4A9KA 5CQ7A 4YYDA 5C8GA 3QZSA 5CY9A 4F3IA 2RNXA 5E7DA 4HXKA 4O71A 5D3HA 4UIXA 3AQAA 2D9EA 3LQHA 4HXSA 5LUUA 4O76A 4Q0OA 4C66A 4CURA 2YEMA 5D3JA 5ENFA 4TTEA 2RNYA 2R0SA 4HBXA 2OUOA 5FG5A 5E9IA 4NR6A 5E74A 4YBSA 5J0DA 4QNSA 3P1CA 4BJXA 5AMFA 5DY7A 4MEQA 4CUQA 5LVQA 4QYDA 5A5NA 3U5OA 1WUGA 4MR5A 5EWHA 4HXMA 4XUBA 5DKHA 1X0JA 4O72A 5F36A 5F5ZA 4LDFA 4QSSA 3TLPA 4LYIA 4X2IA 4A9IA 3P1FA 5EWDA 4WIVA 5CUEA 3ONIA 5CUCA 4N4IA 3QZVA 5HFRA 4AKNA 2MJVB 4N4GA 5COIA 4O75A 4O78A 2FSAA 5F62A 4LRGA 5I83A 4LYWA 4PCEA 4KCXA 5DKCA 3LXJA 5A7CA 4YYMA 4YYKA 5L97A 3UV4A 3P5OA 4UYEA 5F1HA 5IBNA 4HXNA 4CUPA 5HELA 3U5KA 5ENGA 2OO1A 5CUDA 4A9JA 4QZSA 5DYCA 3FKMX 4UIUA 5LKUA 1EQFA 5FFVA 3Q2EA 5LVRA 4QSRA 2E3KA 2DVVA 5CUBA 5I1QA 5IGLA 5CS8A 1JSPB 4NUCA 5FE8A 5D25A 1F68A 4O7CA 5A5OA 5H85A 5IGMA 3HMHA 4O7BA 5FG6A 1WUMA 4NR9A 5FE6A 5FE9A 4A9LA 4QSTA 4QC1A 5A81A 4MR6A 5CPEA 4YY6A 4TT6A 4LZSA 3G0LA 5KTXA 5HJCA 3SVFA 4NUEA 4PKLA 5E73A 4NXJA 5EM3A 3RCWA 4NRAA 5KO4A 5DYXA 3JVMA 4A9FA 4Q0NA 2YYNA 4QSUA 4E96A 5HM0A 1E6IA 4QEWA 4O7AA 4BW4A 5L8UA 3DWYA 5F63A 4QUUA 3O37A 5EI4A 5EP7A 4CFLA 4MENA 4NYXA 4OGJA 5C85A 5AD2A 4TT4A 4O74A 4UYFA 5LJ0A 4WHUA 5HEMA 5EV9A 2OSSA 5I89A 1JM4B 3SVHA 3GG3A 5ENIA 5AD3A 5D3PA 4UYDA 5FE5A 4TT2A 2DWWA 1N72A 4QSVA 4UIVA 4LZRA 5G4RA 4CUSA 5K29A 5I86A 3K2JA 5F2PA 4PS5A 5FG4A 5CUAA 5TB6A 4NQMA 3UV5A 4BW2A 4KV1A 5F61A 2KTBB 4CFKA 4O7FA 5DLXA 5EISA 5FE7A 4Z93A 4XY8A 3JVLA 5FBXA 3QZTA 2LSPB 2YW5A 3O36A 4YH3A 5ETBA 5I40A 5LKXA 5D3NA 5KTUA 2D82A 4BHWA 5D24A 3U5MA 5HQ5A 5CQAA 5BT3A 5EVAA 4XY9A 5EWWA 3UVXA 3MULA 4J1PA 4UIYA 4Z1QA 5F1LA 5DLZA 4Z6IA 4IOOA 3IU5A 4QUTA 4MR4A 4YAXA 5I7XA 3S91A 5I29A 4NRBA 5D3RA 5D26A 4OUFA 5D7XA 5ENJA 3U5PA 3HMEA 2RFJA 5BT4A 4ALHA 5FFYA 4CL9A 2YDWA 3UVDA 4IR5A 4YATA 5I80A 1ZS5A 4A9EA 5HQ6A 4NYVA 5HRWA 4N3WA 4O7EA 4QSQA 4YBMA 4N4HA 5C4QA 5DYUA 3MQMA 4QR5A 4NR7A 4UIZA 2I7KA 4YYGA 5HENA 4XUAA 4A9HA 4IORA 5ACYA 5IIDA 3U5JA 4BW3A 4OGIA 5IGNA 5A85A 3JVKA 2F6JA 3UV2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HLS A;  2RNW A;  5FH6 A;  2L5E A;  4J0S A;  4UYG A;  5L98 A;  4NR5 A;  2YQD A;  5ENH A;  4CUU A;  5CP5 A;  5FE1 A;  5L99 A;  4PCI A;  4NUD A;  2GRC A;  3MUK A;  5CQ6 A;  2R0Y A;  3MXF A;  3NXB A;  4YYH A;  4QSP A;  4QBM A;  4LZ2 A;  5E3G A;  4RVR A;  5CTL A;  5CFW A;  3ZYU A;  5LJ2 A;  2L84 A;  5L8T A;  4QSW A;  5E9L A;  5FDZ A;  5DW2 A;  5ETD A;  4HBV A;  5A5S A;  5I7Y A;  5H1T A;  5CQ4 A;  4QB3 A;  5CUG A;  4UYF B;  5ENE A;  4C67 A;  5E9K A;  5CQT A;  3LQJ A;  4NS5 A;  3HMF A;  5CGP A;  4HXO A;  5A82 A;  3SVG A;  3P1D A;  4ALG A;  4O77 A;  2WP2 A;  4N4F A;  5L96 A;  5FB1 A;  4TQN A;  5FB0 A;  4Z6H A;  5JWM A;  4BW1 A;  5BT5 A;  5I88 A;  3Q2F A;  2G4A A;  5CQ3 A;  4TU6 A;  4J3I A;  2E7N A;  4UIT A;  5D3S A;  5AME A;  3UVW A;  2DKW A;  4TZ8 A;  4YC9 A;  4CLB A;  5F3A A;  4IR3 A;  4J0R A;  5FH7 A;  2N9G A;  4TS8 A;  4DON A;  4UIW A;  4LR6 A;  5II1 A;  3U5L A;  4TU4 A;  4MEO A;  5DKD A;  4YYN A;  4QEU A;  4QR4 A;  5JI8 A;  4HBY A;  3IU6 A;  4NR8 A;  4YAD A;  5CU8 A;  4XYA A;  2RO1 A;  4HXP A;  5II2 A;  3U5N A;  4Y03 A;  5CQ8 A;  5EPR A;  5ENB A;  4A9N A;  4LYS A;  4YBT A;  3LJW A;  5FE4 A;  4NRC A;  4YK0 A;  5E9Y A;  4NQN A;  2YEK A;  5HFQ A;  5KHM A;  4QEV A;  5EA1 A;  5E9V A;  5D0C A;  3D7C A;  4LC2 A;  3O35 A;  4O70 A;  5FFW A;  4TYL A;  4IR4 A;  2E7O A;  5F60 A;  5EIC A;  2DAT A;  5EU1 A;  3O33 A;  4PY6 A;  4WHW A;  4CUT A;  5FE0 A;  5FH8 A;  5CRZ A;  4KV4 A;  3DAI A;  3P1E A;  4UYH A;  5HRX A;  5DYA A;  2DVR A;  3JVJ A;  5KTW A;  2L85 A;  5DFC A;  5EGU A;  5FE2 A;  5KU3 A;  3LQI A;  4QC3 A;  5CRM A;  5DFB A;  2YEL A;  3S92 A;  2R10 A;  5CQ5 A;  4PTB A;  4MEP A;  2NXB A;  5EQ1 A;  5D3T A;  5ENC A;  5HQ7 A;  3AAD A;  4GPJ A;  5LKZ A;  5EWC A;  5EPS A;  5C87 A;  5DX4 A;  5G4S A;  3MB3 A;  4FLP A;  4MR3 A;  4QR3 A;  3O34 A;  5E3D A;  5EWV A;  4YYI A;  5DW1 A;  4IOQ A;  2F6N A;  4HXR A;  5HRV A;  3I3J A;  3MB4 A;  4QSX A;  5A5P A;  3UW9 A;  5LKT A;  4HBW A;  2DVS A;  4QY4 A;  4A9O A;  2I8N A;  5F25 A;  4ZQL A;  4TZ2 A;  4Z1S A;  5C89 A;  5HCL A;  4YH4 A;  5A83 A;  4NR4 A;  5EPB A;  2R0V A;  3UVY A;  4ZW1 A;  5DBM A;  5A5Q A;  5H1U A;  4QYL A;  2WP1 A;  5H1V A;  5A5R A;  4IR6 A;  5TCM A;  4ZC9 A;  5C7N A;  5IGK A;  4YAB A;  2H60 A;  4A9M A;  4YY4 A;  5E9M A;  5FE3 A;  2RI7 A;  5EK9 A;  5IG6 A;  2DVQ A;  5LJ1 A;  5CZG A;  5D3L A;  3G0J A;  5E0R A;  5DFD A;  4YYJ A;  2RS9 B;  4HXL A;  4NYW A;  4A9K A;  5CQ7 A;  4YYD A;  5C8G A;  3QZS A;  5CY9 A;  4F3I A;  2RNX A;  5E7D A;  4HXK A;  4O71 A;  5D3H A;  4UIX A;  3AQA A;  2D9E A;  3LQH A;  4HXS A;  5LUU A;  4O76 A;  4Q0O A;  4C66 A;  4CUR A;  2YEM A;  5D3J A;  5ENF A;  4TTE A;  2RNY A;  2R0S A;  4HBX A;  2OUO A;  5FG5 A;  5E9I A;  4NR6 A;  5E74 A;  4YBS A;  5J0D A;  4QNS A;  3P1C A;  4BJX A;  5AMF A;  5DY7 A;  4MEQ A;  4CUQ A;  5LVQ A;  4QYD A;  5A5N A;  3U5O A;  1WUG A;  4MR5 A;  5EWH A;  4HXM A;  4XUB A;  5DKH A;  1X0J A;  4O72 A;  5F36 A;  5F5Z A;  4LDF A;  4QSS A;  3TLP A;  4LYI A;  4X2I A;  4A9I A;  3P1F A;  5EWD A;  4WIV A;  5CUE A;  3ONI A;  5CUC A;  4N4I A;  3QZV A;  5HFR A;  4AKN A;  2MJV B;  4N4G A;  5COI A;  4O75 A;  4O78 A;  2FSA A;  5F62 A;  4LRG A;  5I83 A;  4LYW A;  4PCE A;  4KCX A;  5DKC A;  3LXJ A;  5A7C A;  4YYM A;  4YYK A;  5L97 A;  3UV4 A;  3P5O A;  4UYE A;  5F1H A;  5IBN A;  4HXN A;  4CUP A;  5HEL A;  3U5K A;  5ENG A;  2OO1 A;  5CUD A;  4A9J A;  4QZS A;  5DYC A;  3FKM X;  4UIU A;  5LKU A;  1EQF A;  5FFV A;  3Q2E A;  5LVR A;  4QSR A;  2E3K A;  2DVV A;  5CUB A;  5I1Q A;  5IGL A;  5CS8 A;  1JSP B;  4NUC A;  5FE8 A;  5D25 A;  1F68 A;  4O7C A;  5A5O A;  5H85 A;  5IGM A;  3HMH A;  4O7B A;  5FG6 A;  1WUM A;  4NR9 A;  5FE6 A;  5FE9 A;  4A9L A;  4QST A;  4QC1 A;  5A81 A;  4MR6 A;  5CPE A;  4YY6 A;  4TT6 A;  4LZS A;  3G0L A;  5KTX A;  5HJC A;  3SVF A;  4NUE A;  4PKL A;  5E73 A;  4NXJ A;  5EM3 A;  3RCW A;  4NRA A;  5KO4 A;  5DYX A;  3JVM A;  4A9F A;  4Q0N A;  2YYN A;  4QSU A;  4E96 A;  5HM0 A;  1E6I A;  4QEW A;  4O7A A;  4BW4 A;  5L8U A;  3DWY A;  5F63 A;  4QUU A;  3O37 A;  5EI4 A;  5EP7 A;  4CFL A;  4MEN A;  4NYX A;  4OGJ A;  5C85 A;  5AD2 A;  4TT4 A;  4O74 A;  4UYF A;  5LJ0 A;  4WHU A;  5HEM A;  5EV9 A;  2OSS A;  5I89 A;  1JM4 B;  3SVH A;  3GG3 A;  5ENI A;  5AD3 A;  5D3P A;  4UYD A;  5FE5 A;  4TT2 A;  2DWW A;  1N72 A;  4QSV A;  4UIV A;  4LZR A;  5G4R A;  4CUS A;  5K29 A;  5I86 A;  3K2J A;  5F2P A;  4PS5 A;  5FG4 A;  5CUA A;  5TB6 A;  4NQM A;  3UV5 A;  4BW2 A;  4KV1 A;  5F61 A;  2KTB B;  4CFK A;  4O7F A;  5DLX A;  5EIS A;  5FE7 A;  4Z93 A;  4XY8 A;  3JVL A;  5FBX A;  3QZT A;  2LSP B;  2YW5 A;  3O36 A;  4YH3 A;  5ETB A;  5I40 A;  5LKX A;  5D3N A;  5KTU A;  2D82 A;  4BHW A;  5D24 A;  3U5M A;  5HQ5 A;  5CQA A;  5BT3 A;  5EVA A;  4XY9 A;  5EWW A;  3UVX A;  3MUL A;  4J1P A;  4UIY A;  4Z1Q A;  5F1L A;  5DLZ A;  4Z6I A;  4IOO A;  3IU5 A;  4QUT A;  4MR4 A;  4YAX A;  5I7X A;  3S91 A;  5I29 A;  4NRB A;  5D3R A;  5D26 A;  4OUF A;  5D7X A;  5ENJ A;  3U5P A;  3HME A;  2RFJ A;  5BT4 A;  4ALH A;  5FFY A;  4CL9 A;  2YDW A;  3UVD A;  4IR5 A;  4YAT A;  5I80 A;  1ZS5 A;  4A9E A;  5HQ6 A;  4NYV A;  5HRW A;  4N3W A;  4O7E A;  4QSQ A;  4YBM A;  4N4H A;  5C4Q A;  5DYU A;  3MQM A;  4QR5 A;  4NR7 A;  4UIZ A;  2I7K A;  4YYG A;  5HEN A;  4XUA A;  4A9H A;  4IOR A;  5ACY A;  5IID A;  3U5J A;  4BW3 A;  4OGI A;  5IGN A;  5A85 A;  3JVK A;  2F6J A;  3UV2 A; 
#chains in the Genus database with same CATH topology
 5HLS A;  2RNW A;  5FH6 A;  2L5E A;  4J0S A;  4UYG A;  5L98 A;  4NR5 A;  2YQD A;  5ENH A;  4CUU A;  5CP5 A;  5FE1 A;  5L99 A;  4PCI A;  4NUD A;  2GRC A;  3MUK A;  5CQ6 A;  2R0Y A;  3MXF A;  3NXB A;  4YYH A;  4QSP A;  4QBM A;  4LZ2 A;  5E3G A;  4RVR A;  5CTL A;  5CFW A;  3ZYU A;  5LJ2 A;  4AI6 A;  2L84 A;  5L8T A;  4QSW A;  5E9L A;  5FDZ A;  5DW2 A;  5ETD A;  4HBV A;  5A5S A;  5I7Y A;  5H1T A;  5CQ4 A;  4QB3 A;  5CUG A;  4UYF B;  5ENE A;  4C67 A;  5E9K A;  5CQT A;  3LQJ A;  4NS5 A;  3HMF A;  5CGP A;  4HXO A;  5A82 A;  3SVG A;  3P1D A;  4ALG A;  4O77 A;  2WP2 A;  4N4F A;  5L96 A;  5FB1 A;  4TQN A;  5FB0 A;  4Z6H A;  5JWM A;  4BW1 A;  5BT5 A;  5I88 A;  3Q2F A;  2G4A A;  5CQ3 A;  4TU6 A;  4J3I A;  2E7N A;  4UIT A;  5D3S A;  5AME A;  3UVW A;  2DKW A;  4TZ8 A;  4YC9 A;  4CLB A;  5F3A A;  4IR3 A;  4J0R A;  5FH7 A;  2N9G A;  4TS8 A;  4DON A;  4UIW A;  4LR6 A;  5II1 A;  3U5L A;  4TU4 A;  4MEO A;  5DKD A;  4YYN A;  4QEU A;  4QR4 A;  5JI8 A;  4HBY A;  3IU6 A;  4NR8 A;  4YAD A;  5CU8 A;  4XYA A;  2RO1 A;  4HXP A;  5II2 A;  3U5N A;  4Y03 A;  5CQ8 A;  5EPR A;  5ENB A;  4A9N A;  4LYS A;  4YBT A;  3LJW A;  5FE4 A;  4NRC A;  4YK0 A;  5E9Y A;  4NQN A;  2YEK A;  5HFQ A;  5KHM A;  4QEV A;  5EA1 A;  5E9V A;  5D0C A;  3D7C A;  4LC2 A;  3O35 A;  4O70 A;  5FFW A;  4TYL A;  4IR4 A;  2E7O A;  5F60 A;  5EIC A;  2DAT A;  2EJN A;  3D1B A;  3D1D A;  5EU1 A;  3O33 A;  4PY6 A;  4WHW A;  4CUT A;  5FE0 A;  5FH8 A;  5CRZ A;  4KV4 A;  3DAI A;  3P1E A;  4UYH A;  5HRX A;  5DYA A;  2DVR A;  3JVJ A;  5KTW A;  2L85 A;  5DFC A;  5EGU A;  5FE2 A;  5KU3 A;  3LQI A;  4QC3 A;  5CRM A;  5DFB A;  2YEL A;  3S92 A;  2R10 A;  5CQ5 A;  4PTB A;  4MEP A;  2NXB A;  5EQ1 A;  5D3T A;  5ENC A;  5HQ7 A;  3AAD A;  4GPJ A;  5LKZ A;  5EWC A;  5EPS A;  5C87 A;  5DX4 A;  5G4S A;  3MB3 A;  4FLP A;  4MR3 A;  4QR3 A;  3O34 A;  5E3D A;  5EWV A;  4YYI A;  5DW1 A;  4IOQ A;  2F6N A;  4HXR A;  5HRV A;  3I3J A;  3MB4 A;  4QSX A;  5A5P A;  3UW9 A;  5LKT A;  4HBW A;  2DVS A;  4QY4 A;  4A9O A;  2I8N A;  5F25 A;  4ZQL A;  4TZ2 A;  4Z1S A;  5C89 A;  1PUO A;  5HCL A;  4YH4 A;  5A83 A;  4NR4 A;  5EPB A;  2R0V A;  3UVY A;  4ZW1 A;  5DBM A;  5A5Q A;  5H1U A;  4QYL A;  2WP1 A;  5H1V A;  5A5R A;  4IR6 A;  5TCM A;  4ZC9 A;  5C7N A;  5IGK A;  4YAB A;  2H60 A;  4A9M A;  4YY4 A;  5E9M A;  5FE3 A;  2RI7 A;  5EK9 A;  5IG6 A;  2DVQ A;  5LJ1 A;  5CZG A;  5D3L A;  3G0J A;  5E0R A;  5DFD A;  4YYJ A;  2RS9 B;  4HXL A;  4NYW A;  4A9K A;  5CQ7 A;  4YYD A;  5C8G A;  3QZS A;  5CY9 A;  4F3I A;  2RNX A;  5E7D A;  4HXK A;  4O71 A;  5D3H A;  4UIX A;  3AQA A;  2D9E A;  3LQH A;  4HXS A;  5LUU A;  4O76 A;  4Q0O A;  4C66 A;  4CUR A;  2YEM A;  5D3J A;  5ENF A;  4TTE A;  2RNY A;  2R0S A;  4HBX A;  2OUO A;  5FG5 A;  5E9I A;  4NR6 A;  5E74 A;  4YBS A;  5J0D A;  3VKG A;  4QNS A;  3P1C A;  4BJX A;  5AMF A;  5DY7 A;  4MEQ A;  4CUQ A;  5LVQ A;  4QYD A;  5A5N A;  3U5O A;  1WUG A;  4MR5 A;  5EWH A;  4HXM A;  4XUB A;  5DKH A;  1X0J A;  4O72 A;  5F36 A;  5F5Z A;  4LDF A;  4QSS A;  3TLP A;  4LYI A;  4X2I A;  3VKH A;  4A9I A;  3P1F A;  4AKG A;  5EWD A;  4WIV A;  5CUE A;  3ONI A;  5CUC A;  4N4I A;  3QZV A;  5HFR A;  4AKN A;  2MJV B;  4N4G A;  5COI A;  4O75 A;  4O78 A;  2FSA A;  5F62 A;  4LRG A;  5I83 A;  4LYW A;  4PCE A;  4KCX A;  5DKC A;  3LXJ A;  5A7C A;  4YYM A;  4YYK A;  5L97 A;  3UV4 A;  3P5O A;  4UYE A;  5F1H A;  5IBN A;  4HXN A;  4CUP A;  5HEL A;  3U5K A;  5ENG A;  4AKI A;  2OO1 A;  5CUD A;  4A9J A;  4QZS A;  5DYC A;  3FKM X;  4UIU A;  5LKU A;  1EQF A;  5FFV A;  3Q2E A;  5LVR A;  4QSR A;  2E3K A;  2DVV A;  5CUB A;  5I1Q A;  5IGL A;  5CS8 A;  1JSP B;  4NUC A;  5FE8 A;  5D25 A;  1F68 A;  4O7C A;  5A5O A;  5H85 A;  5IGM A;  3HMH A;  4O7B A;  5FG6 A;  1WUM A;  4NR9 A;  5FE6 A;  5FE9 A;  4A9L A;  4QST A;  4QC1 A;  5A81 A;  4MR6 A;  5CPE A;  4YY6 A;  4TT6 A;  4LZS A;  3G0L A;  5KTX A;  5HJC A;  3SVF A;  4NUE A;  4PKL A;  5E73 A;  4NXJ A;  5EM3 A;  3RCW A;  4NRA A;  5KO4 A;  5DYX A;  3JVM A;  4A9F A;  4Q0N A;  2YYN A;  4QSU A;  4E96 A;  5HM0 A;  1E6I A;  4QEW A;  4O7A A;  4BW4 A;  5L8U A;  3DWY A;  5F63 A;  4QUU A;  3O37 A;  5EI4 A;  5EP7 A;  4CFL A;  4MEN A;  4AKH A;  4NYX A;  4OGJ A;  5C85 A;  5AD2 A;  4TT4 A;  4O74 A;  4UYF A;  1ZKR A;  5LJ0 A;  4WHU A;  5HEM A;  5EV9 A;  2OSS A;  5I89 A;  1JM4 B;  3SVH A;  3GG3 A;  5ENI A;  5AD3 A;  5D3P A;  4UYD A;  5FE5 A;  4TT2 A;  2DWW A;  1N72 A;  4QSV A;  4UIV A;  4LZR A;  5G4R A;  4CUS A;  5K29 A;  5I86 A;  3K2J A;  5F2P A;  4PS5 A;  5FG4 A;  5CUA A;  5TB6 A;  4NQM A;  3UV5 A;  4BW2 A;  4KV1 A;  5F61 A;  2KTB B;  4CFK A;  4O7F A;  5DLX A;  5EIS A;  5FE7 A;  4Z93 A;  4XY8 A;  3JVL A;  5FBX A;  3QZT A;  2LSP B;  2YW5 A;  3O36 A;  4YH3 A;  5ETB A;  5I40 A;  5LKX A;  5D3N A;  5KTU A;  2D82 A;  4BHW A;  5D24 A;  3U5M A;  5HQ5 A;  5CQA A;  5BT3 A;  5EVA A;  4XY9 A;  5EWW A;  3UVX A;  3MUL A;  4J1P A;  4UIY A;  4Z1Q A;  5F1L A;  5DLZ A;  4Z6I A;  4IOO A;  3IU5 A;  4QUT A;  4MR4 A;  4YAX A;  5I7X A;  3S91 A;  5I29 A;  4NRB A;  5D3R A;  5D26 A;  4OUF A;  5D7X A;  5ENJ A;  3U5P A;  3HME A;  2RFJ A;  5BT4 A;  4ALH A;  5FFY A;  3ERR A;  4CL9 A;  2YDW A;  3UVD A;  4IR5 A;  4YAT A;  5I80 A;  1ZS5 A;  4A9E A;  5HQ6 A;  4NYV A;  5HRW A;  4N3W A;  4O7E A;  4QSQ A;  4YBM A;  4N4H A;  5C4Q A;  5DYU A;  3MQM A;  4QR5 A;  4NR7 A;  4UIZ A;  2I7K A;  4YYG A;  5HEN A;  4XUA A;  4A9H A;  4IOR A;  5ACY A;  5IID A;  3U5J A;  4BW3 A;  4OGI A;  5IGN A;  5A85 A;  3JVK A;  2F6J A;  3UV2 A; 
#chains in the Genus database with same CATH homology
 5HLS A;  2RNW A;  5FH6 A;  2L5E A;  4J0S A;  4UYG A;  5L98 A;  4NR5 A;  2YQD A;  5ENH A;  4CUU A;  5CP5 A;  5FE1 A;  5L99 A;  4PCI A;  4NUD A;  2GRC A;  3MUK A;  5CQ6 A;  2R0Y A;  3MXF A;  3NXB A;  4YYH A;  4QSP A;  4QBM A;  4LZ2 A;  5E3G A;  4RVR A;  5CTL A;  5CFW A;  3ZYU A;  5LJ2 A;  2L84 A;  5L8T A;  4QSW A;  5E9L A;  5FDZ A;  5DW2 A;  5ETD A;  4HBV A;  5A5S A;  5I7Y A;  5H1T A;  5CQ4 A;  4QB3 A;  5CUG A;  4UYF B;  5ENE A;  4C67 A;  5E9K A;  5CQT A;  3LQJ A;  4NS5 A;  3HMF A;  5CGP A;  4HXO A;  5A82 A;  3SVG A;  3P1D A;  4ALG A;  4O77 A;  2WP2 A;  4N4F A;  5L96 A;  5FB1 A;  4TQN A;  5FB0 A;  4Z6H A;  5JWM A;  4BW1 A;  5BT5 A;  5I88 A;  3Q2F A;  2G4A A;  5CQ3 A;  4TU6 A;  4J3I A;  2E7N A;  4UIT A;  5D3S A;  5AME A;  3UVW A;  2DKW A;  4TZ8 A;  4YC9 A;  4CLB A;  5F3A A;  4IR3 A;  4J0R A;  5FH7 A;  2N9G A;  4TS8 A;  4DON A;  4UIW A;  4LR6 A;  5II1 A;  3U5L A;  4TU4 A;  4MEO A;  5DKD A;  4YYN A;  4QEU A;  4QR4 A;  5JI8 A;  4HBY A;  3IU6 A;  4NR8 A;  4YAD A;  5CU8 A;  4XYA A;  2RO1 A;  4HXP A;  5II2 A;  3U5N A;  4Y03 A;  5CQ8 A;  5EPR A;  5ENB A;  4A9N A;  4LYS A;  4YBT A;  3LJW A;  5FE4 A;  4NRC A;  4YK0 A;  5E9Y A;  4NQN A;  2YEK A;  5HFQ A;  5KHM A;  4QEV A;  5EA1 A;  5E9V A;  5D0C A;  3D7C A;  4LC2 A;  3O35 A;  4O70 A;  5FFW A;  4TYL A;  4IR4 A;  2E7O A;  5F60 A;  5EIC A;  2DAT A;  5EU1 A;  3O33 A;  4PY6 A;  4WHW A;  4CUT A;  5FE0 A;  5FH8 A;  5CRZ A;  4KV4 A;  3DAI A;  3P1E A;  4UYH A;  5HRX A;  5DYA A;  2DVR A;  3JVJ A;  5KTW A;  2L85 A;  5DFC A;  5EGU A;  5FE2 A;  5KU3 A;  3LQI A;  4QC3 A;  5CRM A;  5DFB A;  2YEL A;  3S92 A;  2R10 A;  5CQ5 A;  4PTB A;  4MEP A;  2NXB A;  5EQ1 A;  5D3T A;  5ENC A;  5HQ7 A;  3AAD A;  4GPJ A;  5LKZ A;  5EWC A;  5EPS A;  5C87 A;  5DX4 A;  5G4S A;  3MB3 A;  4FLP A;  4MR3 A;  4QR3 A;  3O34 A;  5E3D A;  5EWV A;  4YYI A;  5DW1 A;  4IOQ A;  2F6N A;  4HXR A;  5HRV A;  3I3J A;  3MB4 A;  4QSX A;  5A5P A;  3UW9 A;  5LKT A;  4HBW A;  2DVS A;  4QY4 A;  4A9O A;  2I8N A;  5F25 A;  4ZQL A;  4TZ2 A;  4Z1S A;  5C89 A;  5HCL A;  4YH4 A;  5A83 A;  4NR4 A;  5EPB A;  2R0V A;  3UVY A;  4ZW1 A;  5DBM A;  5A5Q A;  5H1U A;  4QYL A;  2WP1 A;  5H1V A;  5A5R A;  4IR6 A;  5TCM A;  4ZC9 A;  5C7N A;  5IGK A;  4YAB A;  2H60 A;  4A9M A;  4YY4 A;  5E9M A;  5FE3 A;  2RI7 A;  5EK9 A;  5IG6 A;  2DVQ A;  5LJ1 A;  5CZG A;  5D3L A;  3G0J A;  5E0R A;  5DFD A;  4YYJ A;  2RS9 B;  4HXL A;  4NYW A;  4A9K A;  5CQ7 A;  4YYD A;  5C8G A;  3QZS A;  5CY9 A;  4F3I A;  2RNX A;  5E7D A;  4HXK A;  4O71 A;  5D3H A;  4UIX A;  3AQA A;  2D9E A;  3LQH A;  4HXS A;  5LUU A;  4O76 A;  4Q0O A;  4C66 A;  4CUR A;  2YEM A;  5D3J A;  5ENF A;  4TTE A;  2RNY A;  2R0S A;  4HBX A;  2OUO A;  5FG5 A;  5E9I A;  4NR6 A;  5E74 A;  4YBS A;  5J0D A;  4QNS A;  3P1C A;  4BJX A;  5AMF A;  5DY7 A;  4MEQ A;  4CUQ A;  5LVQ A;  4QYD A;  5A5N A;  3U5O A;  1WUG A;  4MR5 A;  5EWH A;  4HXM A;  4XUB A;  5DKH A;  1X0J A;  4O72 A;  5F36 A;  5F5Z A;  4LDF A;  4QSS A;  3TLP A;  4LYI A;  4X2I A;  4A9I A;  3P1F A;  5EWD A;  4WIV A;  5CUE A;  3ONI A;  5CUC A;  4N4I A;  3QZV A;  5HFR A;  4AKN A;  2MJV B;  4N4G A;  5COI A;  4O75 A;  4O78 A;  2FSA A;  5F62 A;  4LRG A;  5I83 A;  4LYW A;  4PCE A;  4KCX A;  5DKC A;  3LXJ A;  5A7C A;  4YYM A;  4YYK A;  5L97 A;  3UV4 A;  3P5O A;  4UYE A;  5F1H A;  5IBN A;  4HXN A;  4CUP A;  5HEL A;  3U5K A;  5ENG A;  2OO1 A;  5CUD A;  4A9J A;  4QZS A;  5DYC A;  3FKM X;  4UIU A;  5LKU A;  1EQF A;  5FFV A;  3Q2E A;  5LVR A;  4QSR A;  2E3K A;  2DVV A;  5CUB A;  5I1Q A;  5IGL A;  5CS8 A;  1JSP B;  4NUC A;  5FE8 A;  5D25 A;  1F68 A;  4O7C A;  5A5O A;  5H85 A;  5IGM A;  3HMH A;  4O7B A;  5FG6 A;  1WUM A;  4NR9 A;  5FE6 A;  5FE9 A;  4A9L A;  4QST A;  4QC1 A;  5A81 A;  4MR6 A;  5CPE A;  4YY6 A;  4TT6 A;  4LZS A;  3G0L A;  5KTX A;  5HJC A;  3SVF A;  4NUE A;  4PKL A;  5E73 A;  4NXJ A;  5EM3 A;  3RCW A;  4NRA A;  5KO4 A;  5DYX A;  3JVM A;  4A9F A;  4Q0N A;  2YYN A;  4QSU A;  4E96 A;  5HM0 A;  1E6I A;  4QEW A;  4O7A A;  4BW4 A;  5L8U A;  3DWY A;  5F63 A;  4QUU A;  3O37 A;  5EI4 A;  5EP7 A;  4CFL A;  4MEN A;  4NYX A;  4OGJ A;  5C85 A;  5AD2 A;  4TT4 A;  4O74 A;  4UYF A;  5LJ0 A;  4WHU A;  5HEM A;  5EV9 A;  2OSS A;  5I89 A;  1JM4 B;  3SVH A;  3GG3 A;  5ENI A;  5AD3 A;  5D3P A;  4UYD A;  5FE5 A;  4TT2 A;  2DWW A;  1N72 A;  4QSV A;  4UIV A;  4LZR A;  5G4R A;  4CUS A;  5K29 A;  5I86 A;  3K2J A;  5F2P A;  4PS5 A;  5FG4 A;  5CUA A;  5TB6 A;  4NQM A;  3UV5 A;  4BW2 A;  4KV1 A;  5F61 A;  2KTB B;  4CFK A;  4O7F A;  5DLX A;  5EIS A;  5FE7 A;  4Z93 A;  4XY8 A;  3JVL A;  5FBX A;  3QZT A;  2LSP B;  2YW5 A;  3O36 A;  4YH3 A;  5ETB A;  5I40 A;  5LKX A;  5D3N A;  5KTU A;  2D82 A;  4BHW A;  5D24 A;  3U5M A;  5HQ5 A;  5CQA A;  5BT3 A;  5EVA A;  4XY9 A;  5EWW A;  3UVX A;  3MUL A;  4J1P A;  4UIY A;  4Z1Q A;  5F1L A;  5DLZ A;  4Z6I A;  4IOO A;  3IU5 A;  4QUT A;  4MR4 A;  4YAX A;  5I7X A;  3S91 A;  5I29 A;  4NRB A;  5D3R A;  5D26 A;  4OUF A;  5D7X A;  5ENJ A;  3U5P A;  3HME A;  2RFJ A;  5BT4 A;  4ALH A;  5FFY A;  4CL9 A;  2YDW A;  3UVD A;  4IR5 A;  4YAT A;  5I80 A;  1ZS5 A;  4A9E A;  5HQ6 A;  4NYV A;  5HRW A;  4N3W A;  4O7E A;  4QSQ A;  4YBM A;  4N4H A;  5C4Q A;  5DYU A;  3MQM A;  4QR5 A;  4NR7 A;  4UIZ A;  2I7K A;  4YYG A;  5HEN A;  4XUA A;  4A9H A;  4IOR A;  5ACY A;  5IID A;  3U5J A;  4BW3 A;  4OGI A;  5IGN A;  5A85 A;  3JVK A;  2F6J A;  3UV2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...