1ZKRA

Crystal structure of the major cat allergen fel d 1 (1+2)
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
146
structure length
146
Chain Sequence
MEICPAVKRDVDLFLTGTPDEYVEQVAQYKALPVVLENARILKNCVDAKMTEEDKENALSLLDKIYTSPLCVKMAETCPIFYDVFFAVANGNELLLDLSLTKVNATEPERTAMKKIQDCYVENGLISRVLDGLVMTTISSSKDCMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Allergen
molecule keywords Major allergen I polypeptide, fused chain 1, chain 2
publication title Crystal structure of the major cat allergen Fel d 1 (1+2)
rcsb
source organism Felis catus
total genus 61
structure length 146
sequence length 146
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09252 Feld-I_B Allergen Fel d I-B chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.50 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Histone Acetyltransferase; Chain A 1zkrA00
1PUOA 2EJNA 1ZKRA
chains in the Genus database with same CATH superfamily
3MULA 5A83A 2DATA 4LZRA 4QC1A 4TS8A 4YYGA 5DFBA 2FSAA 5I29A 3VKGA 4UIWA 5EPBA 3HMHA 4NQNA 4A9HA 5DW2A 4HXMA 4MENA 4PS5A 5E9MA 4AKIA 2L5EA 4NXJA 5EPSA 4AKHA 5EVAA 5FH8A 4O7FA 4HXRA 4N4FA 5ENBA 4QSVA 4NUDA 3UVWA 4MR3A 4KV4A 4O72A 4Z6IA 5J0DA 5HELA 5CQ4A 5LUUA 5EICA 4MEQA 4X2IA 5FG5A 5FE6A 5FE9A 5HQ6A 4YYMA 2DWWA 5HQ5A 5D24A 5F1HA 3UVXA 3DAIA 4O7BA 5DFDA 4NS5A 5E74A 5HRXA 5F2PA 5IGLA 5D26A 5FE0A 5KU3A 5CUAA 3HMFA 5EM3A 2NXBA 3D1BA 2RNXA 4LYWA 4QZSA 5CQ6A 5D3PA 4KV1A 5DKDA 5D3RA 4QY4A 5HCLA 5CRMA 5DLZA 4QBMA 4LYIA 5FE1A 1PUOA 3S91A 4NRBA 4PY6A 5KHMA 2RNWA 4TT6A 3U5KA 5EP7A 4HXSA 5ENIA 4ALHA 5F36A 5A5RA 4Q0OA 5E9YA 4YBSA 1JSPB 4TT4A 4QSRA 4TU6A 5EV9A 4J1PA 5A5SA 5TCMA 5A5QA 5HEMA 5HRVA 3MXFA 4IR5A 4J0SA 4OUFA 5AD2A 4J3IA 4C67A 4UIYA 2G4AA 5EK9A 4HBYA 2R0YA 5IG6A 2YQDA 5LJ1A 2I8NA 5EA1A 5CQ8A 5CRZA 5EGUA 3MUKA 5ACYA 5ETDA 4YAXA 5CUDA 5CUEA 5IGNA 5EPRA 4HBVA 5ENFA 4YATA 4TTEA 5DFCA 5FFWA 3IU6A 2KTBB 5DLXA 5D3TA 4BW1A 5BT5A 5I80A 3P1CA 4CUTA 3LJWA 3LQHA 4NR6A 4UYFB 4QYLA 5IIDA 4UYHA 5HQ7A 5D3LA 4CFLA 5JI8A 2DVVA 3HMEA 4E96A 3JVKA 5G4SA 2I7KA 4N4GA 1WUMA 5FFVA 5KTUA 5JWMA 4LYSA 5I86A 5HFRA 5I7XA 4MR5A 4QR3A 5A5OA 4Z1QA 3MB3A 4A9NA 5IBNA 5COIA 3MB4A 4LZ2A 5CTLA 3RCWA 3NXBA 4CFKA 5CY9A 4A9JA 3JVMA 5LKXA 2DVSA 5TB6A 2YYNA 5HENA 3SVHA 4QEUA 5LVRA 1X0JA 4LZSA 4UYGA 2OUOA 4O7EA 4LR6A 4HBXA 5D3JA 4HXKA 4UITA 4NR8A 5HRWA 5CPEA 2D9EA 5C89A 4YYJA 4O78A 3UVDA 5E7DA 3TLPA 5AD3A 5KTXA 4GPJA 4FLPA 2OSSA 5II1A 4Z93A 3U5OA 4AKNA 4O76A 2YW5A 5F61A 4IOQA 4BW3A 4A9IA 4QSUA 5F63A 5EWCA 1ZS5A 4YH3A 5H85A 5E0RA 4AKGA 4QUUA 4QNSA 4A9LA 4A9FA 4N4IA 5CP5A 4F3IA 5DW1A 5LKTA 4YBMA 5EISA 3U5LA 2R10A 2H60A 5FE8A 4A9KA 3P1FA 3Q2FA 4J0RA 2F6NA 5D3SA 5DYXA 3VKHA 5G4RA 4HXOA 2YEMA 4PKLA 4IR3A 4A9MA 5HM0A 5C4QA 4LC2A 2D82A 4CUQA 4CLBA 2YELA 2WP1A 5I40A 5LKZA 1EQFA 4NR5A 4QUTA 1WUGA 3JVLA 4O70A 5FDZA 5DKCA 4YYKA 4IR6A 3UV2A 5E73A 5L97A 5D3NA 4BJXA 3I3JA 4IORA 4QYDA 3O36A 4YY4A 5CQTA 4QEVA 3QZVA 5A7CA 4IR4A 4A9OA 4CURA 3G0JA 4RVRA 5K29A 5EWWA 5FE7A 2RNYA 4LDFA 2N9GA 5L98A 5C87A 4C66A 3UV5A 2L85A 4QSTA 4TU4A 5ENJA 4UYDA 5CUBA 5DBMA 5E9VA 5LJ2A 4QSPA 4O74A 5FE2A 2DKWA 5CQAA 5FH7A 5I83A 1JM4B 4CUPA 4NRAA 5EWHA 4QSWA 5E3GA 3U5JA 4O7AA 5H1UA 2LSPB 3UW9A 4NUCA 3P1EA 5I7YA 5LVQA 5L96A 4O77A 4ZW1A 2YEKA 4WHUA 2R0SA 5BT4A 2E7NA 4CUUA 4LRGA 4HXPA 5E3DA 5EI4A 4UYFA 4HBWA 4TZ2A 5I88A 3LQIA 5DYAA 2OO1A 4TT2A 2WP2A 4OGIA 4N4HA 4O71A 5DY7A 5EWVA 5BT3A 4A9EA 3P5OA 5D0CA 5FFYA 2YDWA 4UIVA 4WIVA 4O75A 5EQ1A 4NYWA 5ENCA 4HXLA 5CQ7A 3D1DA 5C8GA 5FB1A 4MEPA 2GRCA 4OGJA 5ETBA 5E9KA 3SVGA 4TQNA 4QEWA 5CUGA 2F6JA 5F5ZA 3ZYUA 5LJ0A 3O34A 3D7CA 3Q2EA 5FB0A 3QZTA 4PTBA 3O37A 5E9IA 3P1DA 4N3WA 5AMFA 4NYXA 3GG3A 3ERRA 4QSQA 5ENHA 3G0LA 3LXJA 5C85A 2E7OA 5CGPA 2L84A 4UIXA 5AMEA 4DONA 5F60A 4PCIA 3O35A 4AI6A 4IOOA 2RI7A 4Z1SA 4QR5A 4QR4A 5CU8A 4NUEA 4ALGA 5CZGA 5A85A 3AQAA 2R0VA 3DWYA 4BHWA 3K2JA 1ZKRA 4ZQLA 3O33A 5E9LA 4YH4A 5HLSA 4NR7A 5FG4A 4BW4A 5F1LA 5II2A 5H1VA 4CUSA 4KCXA 4PCEA 5ENGA 5L8TA 3LQJA 3U5MA 5C7NA 3MQMA 4QSXA 4WHWA 5FE4A 4YABA 4YBTA 4YYNA 4Y03A 5FE5A 3U5PA 5DKHA 5A81A 5D3HA 4XYAA 3AADA 5KO4A 3S92A 2RFJA 5DX4A 5F62A 5CS8A 5L99A 5DYCA 1N72A 4NQMA 5A82A 5A5NA 5FE3A 4XY9A 2DVRA 2EJNA 2RO1A 5F25A 4YY6A 5EWDA 4YYHA 5D7XA 5FH6A 5FG6A 4UIUA 5I1QA 4UYEA 4XUAA 5DYUA 4YK0A 4O7CA 4CL9A 4NR4A 2DVQA 3JVJA 5A5PA 4YYIA 2MJVB 5D25A 4NR9A 5IGKA 4UIZA 5CUCA 5CQ5A 3FKMX 4XY8A 4MEOA 4XUBA 4TYLA 4QSSA 4TZ8A 3U5NA 4YYDA 3IU5A 4QC3A 3UV4A 3UVYA 5F3AA 5HFQA 5LKUA 4Q0NA 4ZC9A 4Z6HA 5IGMA 3QZSA 1E6IA 4YC9A 4MR4A 2RS9B 4QB3A 3SVFA 5CFWA 2E3KA 5ENEA 5H1TA 4NYVA 4HXNA 5FBXA 4YADA 4MR6A 5HJCA 5L8UA 5EU1A 1F68A 5I89A 5CQ3A 5KTWA 4BW2A 3ONIA 4NRCA
chains in the Genus database with same CATH topology
4AI6A 1PUOA 2EJNA 1ZKRA 3D1BA 4AKIA 3VKHA 3D1DA 3VKGA 3ERRA 4AKHA 4AKGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PUO A;  2EJN A;  1ZKR A; 
#chains in the Genus database with same CATH topology
 3MUL A;  5A83 A;  2DAT A;  4LZR A;  4QC1 A;  4TS8 A;  4YYG A;  5DFB A;  2FSA A;  5I29 A;  3VKG A;  4UIW A;  5EPB A;  3HMH A;  4NQN A;  4A9H A;  5DW2 A;  4HXM A;  4MEN A;  4PS5 A;  5E9M A;  4AKI A;  2L5E A;  4NXJ A;  5EPS A;  4AKH A;  5EVA A;  5FH8 A;  4O7F A;  4HXR A;  4N4F A;  5ENB A;  4QSV A;  4NUD A;  3UVW A;  4MR3 A;  4KV4 A;  4O72 A;  4Z6I A;  5J0D A;  5HEL A;  5CQ4 A;  5LUU A;  5EIC A;  4MEQ A;  4X2I A;  5FG5 A;  5FE6 A;  5FE9 A;  5HQ6 A;  4YYM A;  2DWW A;  5HQ5 A;  5D24 A;  5F1H A;  3UVX A;  3DAI A;  4O7B A;  5DFD A;  4NS5 A;  5E74 A;  5HRX A;  5F2P A;  5IGL A;  5D26 A;  5FE0 A;  5KU3 A;  5CUA A;  3HMF A;  5EM3 A;  2NXB A;  3D1B A;  2RNX A;  4LYW A;  4QZS A;  5CQ6 A;  5D3P A;  4KV1 A;  5DKD A;  5D3R A;  4QY4 A;  5HCL A;  5CRM A;  5DLZ A;  4QBM A;  4LYI A;  5FE1 A;  1PUO A;  3S91 A;  4NRB A;  4PY6 A;  5KHM A;  2RNW A;  4TT6 A;  3U5K A;  5EP7 A;  4HXS A;  5ENI A;  4ALH A;  5F36 A;  5A5R A;  4Q0O A;  5E9Y A;  4YBS A;  1JSP B;  4TT4 A;  4QSR A;  4TU6 A;  5EV9 A;  4J1P A;  5A5S A;  5TCM A;  5A5Q A;  5HEM A;  5HRV A;  3MXF A;  4IR5 A;  4J0S A;  4OUF A;  5AD2 A;  4J3I A;  4C67 A;  4UIY A;  2G4A A;  5EK9 A;  4HBY A;  2R0Y A;  5IG6 A;  2YQD A;  5LJ1 A;  2I8N A;  5EA1 A;  5CQ8 A;  5CRZ A;  5EGU A;  3MUK A;  5ACY A;  5ETD A;  4YAX A;  5CUD A;  5CUE A;  5IGN A;  5EPR A;  4HBV A;  5ENF A;  4YAT A;  4TTE A;  5DFC A;  5FFW A;  3IU6 A;  2KTB B;  5DLX A;  5D3T A;  4BW1 A;  5BT5 A;  5I80 A;  3P1C A;  4CUT A;  3LJW A;  3LQH A;  4NR6 A;  4UYF B;  4QYL A;  5IID A;  4UYH A;  5HQ7 A;  5D3L A;  4CFL A;  5JI8 A;  2DVV A;  3HME A;  4E96 A;  3JVK A;  5G4S A;  2I7K A;  4N4G A;  1WUM A;  5FFV A;  5KTU A;  5JWM A;  4LYS A;  5I86 A;  5HFR A;  5I7X A;  4MR5 A;  4QR3 A;  5A5O A;  4Z1Q A;  3MB3 A;  4A9N A;  5IBN A;  5COI A;  3MB4 A;  4LZ2 A;  5CTL A;  3RCW A;  3NXB A;  4CFK A;  5CY9 A;  4A9J A;  3JVM A;  5LKX A;  2DVS A;  5TB6 A;  2YYN A;  5HEN A;  3SVH A;  4QEU A;  5LVR A;  1X0J A;  4LZS A;  4UYG A;  2OUO A;  4O7E A;  4LR6 A;  4HBX A;  5D3J A;  4HXK A;  4UIT A;  4NR8 A;  5HRW A;  5CPE A;  2D9E A;  5C89 A;  4YYJ A;  4O78 A;  3UVD A;  5E7D A;  3TLP A;  5AD3 A;  5KTX A;  4GPJ A;  4FLP A;  2OSS A;  5II1 A;  4Z93 A;  3U5O A;  4AKN A;  4O76 A;  2YW5 A;  5F61 A;  4IOQ A;  4BW3 A;  4A9I A;  4QSU A;  5F63 A;  5EWC A;  1ZS5 A;  4YH3 A;  5H85 A;  5E0R A;  4AKG A;  4QUU A;  4QNS A;  4A9L A;  4A9F A;  4N4I A;  5CP5 A;  4F3I A;  5DW1 A;  5LKT A;  4YBM A;  5EIS A;  3U5L A;  2R10 A;  2H60 A;  5FE8 A;  4A9K A;  3P1F A;  3Q2F A;  4J0R A;  2F6N A;  5D3S A;  5DYX A;  3VKH A;  5G4R A;  4HXO A;  2YEM A;  4PKL A;  4IR3 A;  4A9M A;  5HM0 A;  5C4Q A;  4LC2 A;  2D82 A;  4CUQ A;  4CLB A;  2YEL A;  2WP1 A;  5I40 A;  5LKZ A;  1EQF A;  4NR5 A;  4QUT A;  1WUG A;  3JVL A;  4O70 A;  5FDZ A;  5DKC A;  4YYK A;  4IR6 A;  3UV2 A;  5E73 A;  5L97 A;  5D3N A;  4BJX A;  3I3J A;  4IOR A;  4QYD A;  3O36 A;  4YY4 A;  5CQT A;  4QEV A;  3QZV A;  5A7C A;  4IR4 A;  4A9O A;  4CUR A;  3G0J A;  4RVR A;  5K29 A;  5EWW A;  5FE7 A;  2RNY A;  4LDF A;  2N9G A;  5L98 A;  5C87 A;  4C66 A;  3UV5 A;  2L85 A;  4QST A;  4TU4 A;  5ENJ A;  4UYD A;  5CUB A;  5DBM A;  5E9V A;  5LJ2 A;  4QSP A;  4O74 A;  5FE2 A;  2DKW A;  5CQA A;  5FH7 A;  5I83 A;  1JM4 B;  4CUP A;  4NRA A;  5EWH A;  4QSW A;  5E3G A;  3U5J A;  4O7A A;  5H1U A;  2LSP B;  3UW9 A;  4NUC A;  3P1E A;  5I7Y A;  5LVQ A;  5L96 A;  4O77 A;  4ZW1 A;  2YEK A;  4WHU A;  2R0S A;  5BT4 A;  2E7N A;  4CUU A;  4LRG A;  4HXP A;  5E3D A;  5EI4 A;  4UYF A;  4HBW A;  4TZ2 A;  5I88 A;  3LQI A;  5DYA A;  2OO1 A;  4TT2 A;  2WP2 A;  4OGI A;  4N4H A;  4O71 A;  5DY7 A;  5EWV A;  5BT3 A;  4A9E A;  3P5O A;  5D0C A;  5FFY A;  2YDW A;  4UIV A;  4WIV A;  4O75 A;  5EQ1 A;  4NYW A;  5ENC A;  4HXL A;  5CQ7 A;  3D1D A;  5C8G A;  5FB1 A;  4MEP A;  2GRC A;  4OGJ A;  5ETB A;  5E9K A;  3SVG A;  4TQN A;  4QEW A;  5CUG A;  2F6J A;  5F5Z A;  3ZYU A;  5LJ0 A;  3O34 A;  3D7C A;  3Q2E A;  5FB0 A;  3QZT A;  4PTB A;  3O37 A;  5E9I A;  3P1D A;  4N3W A;  5AMF A;  4NYX A;  3GG3 A;  3ERR A;  4QSQ A;  5ENH A;  3G0L A;  3LXJ A;  5C85 A;  2E7O A;  5CGP A;  2L84 A;  4UIX A;  5AME A;  4DON A;  5F60 A;  4PCI A;  3O35 A;  4AI6 A;  4IOO A;  2RI7 A;  4Z1S A;  4QR5 A;  4QR4 A;  5CU8 A;  4NUE A;  4ALG A;  5CZG A;  5A85 A;  3AQA A;  2R0V A;  3DWY A;  4BHW A;  3K2J A;  1ZKR A;  4ZQL A;  3O33 A;  5E9L A;  4YH4 A;  5HLS A;  4NR7 A;  5FG4 A;  4BW4 A;  5F1L A;  5II2 A;  5H1V A;  4CUS A;  4KCX A;  4PCE A;  5ENG A;  5L8T A;  3LQJ A;  3U5M A;  5C7N A;  3MQM A;  4QSX A;  4WHW A;  5FE4 A;  4YAB A;  4YBT A;  4YYN A;  4Y03 A;  5FE5 A;  3U5P A;  5DKH A;  5A81 A;  5D3H A;  4XYA A;  3AAD A;  5KO4 A;  3S92 A;  2RFJ A;  5DX4 A;  5F62 A;  5CS8 A;  5L99 A;  5DYC A;  1N72 A;  4NQM A;  5A82 A;  5A5N A;  5FE3 A;  4XY9 A;  2DVR A;  2EJN A;  2RO1 A;  5F25 A;  4YY6 A;  5EWD A;  4YYH A;  5D7X A;  5FH6 A;  5FG6 A;  4UIU A;  5I1Q A;  4UYE A;  4XUA A;  5DYU A;  4YK0 A;  4O7C A;  4CL9 A;  4NR4 A;  2DVQ A;  3JVJ A;  5A5P A;  4YYI A;  2MJV B;  5D25 A;  4NR9 A;  5IGK A;  4UIZ A;  5CUC A;  5CQ5 A;  3FKM X;  4XY8 A;  4MEO A;  4XUB A;  4TYL A;  4QSS A;  4TZ8 A;  3U5N A;  4YYD A;  3IU5 A;  4QC3 A;  3UV4 A;  3UVY A;  5F3A A;  5HFQ A;  5LKU A;  4Q0N A;  4ZC9 A;  4Z6H A;  5IGM A;  3QZS A;  1E6I A;  4YC9 A;  4MR4 A;  2RS9 B;  4QB3 A;  3SVF A;  5CFW A;  2E3K A;  5ENE A;  5H1T A;  4NYV A;  4HXN A;  5FBX A;  4YAD A;  4MR6 A;  5HJC A;  5L8U A;  5EU1 A;  1F68 A;  5I89 A;  5CQ3 A;  5KTW A;  4BW2 A;  3ONI A;  4NRC A; 
#chains in the Genus database with same CATH homology
 4AI6 A;  1PUO A;  2EJN A;  1ZKR A;  3D1B A;  4AKI A;  3VKH A;  3D1D A;  3VKG A;  3ERR A;  4AKH A;  4AKG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...