4MR5A

Crystal structure of the second bromodomain of human brd2 in complex with a quinazolinone ligand (rvx-oh)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
110
structure length
110
Chain Sequence
LSEQLKHCNGILKELLSKKHAAYAWPFYKPVDASALGLHDYHDIIKHPMDLSTVKRKMENRDYRDAQEFAADVRLMFSNCYKYNPPDHDVVAMARKLQDVFEFRYAKMPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bromodomain-containing protein 2
publication title RVX-208, an inhibitor of BET transcriptional regulators with selectivity for the second bromodomain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/transcription inhibitor
total genus 42
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2013-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4mr5A00
5CTLA 4YYKA 3O34A 3JVJA 5FDZA 4Y03A 5I88A 5ETBA 5FE4A 5A5NA 4YATA 5CQ4A 5CRZA 5FE5A 4NS5A 1X0JA 3RCWA 4YAXA 4Q0NA 5CPEA 4Z6IA 5FH7A 4PCEA 5F2PA 5I29A 5A81A 3Q2EA 4CUQA 5DYAA 5HEMA 4YBSA 4CFKA 4J0SA 2YEKA 5IGLA 4O70A 3IU5A 5F61A 5D3NA 4BW4A 4XUAA 4QNSA 4QSTA 5C89A 4WHWA 5BT3A 5FB1A 5A85A 4O71A 5DYXA 5L8TA 5FE2A 5E7DA 2WP1A 4LYIA 5EGUA 1ZS5A 5ENIA 5D7XA 3UV5A 3SVHA 1E6IA 4NYXA 5A5QA 5EI4A 5A7CA 4C67A 3UVDA 4J1PA 2L5EA 4LC2A 3LJWA 3QZTA 2D82A 5EWHA 5F3AA 2RNXA 3LQHA 5CS8A 5DY7A 4ZQLA 5IBNA 5EICA 4A9IA 2OUOA 5C7NA 4HXRA 5KU3A 4QUTA 5KO4A 5DBMA 5HLSA 3Q2FA 4AKNA 5CRMA 2GRCA 2DVRA 3U5NA 2DATA 3GG3A 4MEQA 2R0VA 4A9NA 5JI8A 5DKHA 4UIWA 3HMEA 4A9MA 4QC1A 5D26A 3UVYA 4HXSA 2DKWA 4FLPA 3MULA 5AMFA 2D9EA 4ALHA 5L8UA 2YDWA 5ENJA 3UV2A 4IOQA 3JVMA 4QSQA 5II2A 4YC9A 3MXFA 3NXBA 3HMHA 5DYUA 5C85A 5I1QA 4QSWA 4NUDA 4A9LA 4BW3A 5IIDA 3MUKA 5FH6A 3JVKA 5ENEA 3LQIA 5CQAA 5ACYA 4NR9A 4IR4A 5F60A 5F1LA 2E7OA 2MJVB 5ENCA 5HQ6A 2NXBA 4QYDA 4NRBA 4QEUA 5FFYA 2KTBB 3P5OA 5ETDA 2FSAA 4PY6A 4N4GA 4HBYA 5HENA 4RVRA 5F25A 4NR8A 3AQAA 5DFCA 4ZC9A 5FE0A 3P1EA 4MENA 5LJ2A 4YY6A 4TU6A 5DX4A 3UVWA 5D3JA 1F68A 5FFVA 4MEPA 5CQ6A 5EWVA 5D3TA 4UYFA 5E9YA 5IG6A 5J0DA 4WIVA 4YH3A 5DW1A 2L85A 4O7BA 5H85A 3O35A 5A5SA 5HRXA 1N72A 4LZSA 4QEVA 5BT4A 4YK0A 4YYJA 4CURA 4O7EA 3SVFA 2DVSA 5CQ7A 2YQDA 3TLPA 4NR4A 4A9KA 5I80A 5TCMA 4IOOA 4O72A 4CUSA 5H1VA 5E9LA 5DYCA 4HXPA 4MR4A 5DW2A 4YBMA 4YYHA 5EQ1A 5D3PA 3UV4A 4IR5A 5F63A 5A82A 2LSPB 4KV4A 4LYSA 5K29A 3IU6A 5D25A 4NRCA 4F3IA 3UVXA 5CUDA 5FG5A 4TT2A 4OGIA 5FE1A 2RNYA 4N4HA 4QYLA 4QEWA 4YADA 5KHMA 5CY9A 5E9KA 1EQFA 5L96A 4TT4A 4UIYA 4LRGA 4UIVA 4UYFB 5EM3A 3P1CA 4HXNA 5HM0A 5IGKA 4LDFA 5FB0A 5AD2A 5CZGA 3JVLA 5FE3A 2RI7A 4QSUA 2F6JA 5COIA 5F1HA 4X2IA 2I8NA 4MR6A 5L97A 4KCXA 5LJ1A 3UW9A 4YYMA 4QUUA 4XUBA 4WHUA 4BHWA 5E3GA 4Z93A 5EWDA 3DAIA 5EVAA 4TYLA 5LVQA 4MEOA 4PTBA 4QR5A 5H1TA 4TTEA 2WP2A 4LZ2A 5FBXA 4PCIA 5TB6A 5HQ5A 5E9IA 3ZYUA 4HBXA 3D7CA 5E3DA 4TZ8A 5EWWA 3S92A 5LKXA 3I3JA 4PS5A 2R0SA 4QSXA 4HXMA 2OO1A 4E96A 1JSPB 4CLBA 4CL9A 4N3WA 5D3LA 4QSPA 5I89A 4A9EA 5F62A 5JWMA 5ENBA 5E9MA 4O7FA 5CFWA 5D3SA 4NRAA 5AMEA 2R0YA 2YW5A 5FE7A 3QZSA 4LR6A 4UYHA 5F5ZA 5CUAA 5FFWA 2E3KA 4GPJA 4O74A 5CUCA 2R10A 4QR3A 2RNWA 4NUEA 4QC3A 4YYNA 4UITA 4XY8A 3U5MA 5LKTA 4YY4A 5LKUA 4ZW1A 4O75A 5BT5A 4NR6A 4N4IA 4NYWA 5E9VA 1WUMA 4UIXA 3S91A 5DFDA 5CQ8A 2DVQA 5E0RA 4UYDA 5D3RA 1JM4B 5HJCA 5KTWA 3P1FA 3P1DA 3G0LA 4NR7A 5L98A 3U5LA 4QB3A 5EISA 5LKZA 5I40A 4HBWA 5FG6A 3O36A 4IR3A 4HXLA 4TQNA 4O77A 4HXKA 5D24A 5LJ0A 4HBVA 5HFQA 2OSSA 5II1A 4QBMA 4QSSA 3DWYA 5FE8A 4NR5A 4A9FA 5EPSA 5KTXA 5A83A 4J3IA 2DVVA 4LZRA 5G4SA 3O37A 4YYIA 2YELA 5CGPA 3LXJA 5EV9A 4Z1QA 4UYEA 4Q0OA 5CUGA 4IORA 5CQTA 3MB4A 4QY4A 4CUUA 4CUTA 4A9HA 4Z1SA 3U5JA 5CQ5A 5HRVA 5G4RA 5LUUA 2RS9B 5DKCA 3K2JA 5E74A 5EP7A 4BW1A 5F36A 4YABA 4YYDA 5HELA 5CU8A 4XYAA 5I86A 5A5RA 5C4QA 5EA1A 5L99A 4OUFA 5EK9A 4BW2A 5A5OA 5DKDA 4TZ2A 4C66A 5CQ3A 4QR4A 3G0JA 4MR5A 4UIUA 4Z6HA 5CUBA 2G4AA 4UIZA 4NUCA 5EPRA 4O78A 4O7CA 5CUEA 4TS8A 2RFJA 3HMFA 4O76A 5HQ7A 5FH8A 5C8GA 2L84A 2YEMA 4PKLA 5FG4A 5CP5A 5HFRA 4IR6A 4QSRA 4YBTA 5AD3A 5C87A 4NQMA 1WUGA 5IGNA 3ONIA 4A9JA 3MQMA 5I7YA 2DWWA 4TU4A 5HRWA 4J0RA 4QZSA 4NYVA 4KV1A 5KTUA 3U5OA 2YYNA 4UYGA 5ENFA 4TT6A 3LQJA 4MR3A 5D3HA 2RO1A 4HXOA 4LYWA 3FKMX 5E73A 5ENHA 4XY9A 2E7NA 4NXJA 4O7AA 5I7XA 5HCLA 5EWCA 5FE6A 3MB3A 3U5KA 5D0CA 4YH4A 3SVGA 4DONA 5ENGA 5DLXA 2I7KA 5A5PA 5H1UA 5DLZA 2H60A 5LVRA 4YYGA 3U5PA 5IGMA 3O33A 4NQNA 2F6NA 5EPBA 5I83A 3QZVA 4CUPA 5DFBA 4A9OA 4CFLA 4ALGA 4BJXA 3AADA 4N4FA 5FE9A 2N9GA 5EU1A 4QSVA 4OGJA
chains in the Genus database with same CATH superfamily
5CTLA 4YYKA 3O34A 3JVJA 5FDZA 4Y03A 5I88A 5ETBA 5FE4A 5A5NA 4YATA 5CQ4A 5CRZA 5FE5A 2EJNA 4NS5A 1X0JA 3RCWA 4YAXA 4Q0NA 3VKHA 5CPEA 4Z6IA 5FH7A 4PCEA 5F2PA 5I29A 5A81A 3Q2EA 4CUQA 5DYAA 5HEMA 4YBSA 4CFKA 4J0SA 2YEKA 5IGLA 4O70A 3IU5A 5F61A 5D3NA 4BW4A 4XUAA 4QNSA 4QSTA 5C89A 4WHWA 5BT3A 5FB1A 5A85A 4O71A 5DYXA 5L8TA 5FE2A 5E7DA 2WP1A 4LYIA 5EGUA 1ZS5A 5ENIA 5D7XA 3UV5A 3SVHA 1E6IA 4NYXA 5A5QA 5EI4A 5A7CA 4C67A 3UVDA 4J1PA 2L5EA 4LC2A 3LJWA 3QZTA 2D82A 5EWHA 5F3AA 2RNXA 3LQHA 5CS8A 5DY7A 4ZQLA 5IBNA 5EICA 4A9IA 2OUOA 5C7NA 4HXRA 5KU3A 4QUTA 3VKGA 5KO4A 5DBMA 5HLSA 3Q2FA 4AKNA 5CRMA 2GRCA 2DVRA 3U5NA 2DATA 3GG3A 4MEQA 2R0VA 4A9NA 5JI8A 5DKHA 4UIWA 3HMEA 4A9MA 4QC1A 5D26A 3UVYA 4HXSA 2DKWA 4FLPA 3MULA 5AMFA 2D9EA 4ALHA 5L8UA 2YDWA 5ENJA 3UV2A 4IOQA 3JVMA 4QSQA 5II2A 4YC9A 3MXFA 3NXBA 3HMHA 5DYUA 5C85A 5I1QA 4QSWA 4NUDA 4A9LA 4BW3A 5IIDA 3MUKA 5FH6A 3JVKA 5ENEA 3LQIA 5CQAA 5ACYA 4NR9A 4IR4A 5F60A 5F1LA 2E7OA 2MJVB 5ENCA 5HQ6A 2NXBA 4QYDA 4NRBA 4QEUA 5FFYA 2KTBB 3P5OA 5ETDA 2FSAA 4PY6A 4N4GA 4HBYA 5HENA 4RVRA 5F25A 4NR8A 3AQAA 1ZKRA 5DFCA 4ZC9A 5FE0A 3P1EA 4MENA 5LJ2A 4YY6A 4TU6A 5DX4A 3UVWA 5D3JA 1F68A 5FFVA 4MEPA 5CQ6A 5EWVA 5D3TA 4UYFA 5E9YA 5IG6A 5J0DA 4WIVA 4YH3A 5DW1A 2L85A 4O7BA 5H85A 3O35A 5A5SA 5HRXA 1N72A 4LZSA 4QEVA 4AKGA 5BT4A 4YK0A 4YYJA 4CURA 4O7EA 3SVFA 2DVSA 5CQ7A 2YQDA 3TLPA 4NR4A 4A9KA 5I80A 5TCMA 4IOOA 4O72A 4CUSA 5H1VA 5E9LA 5DYCA 4HXPA 4MR4A 5DW2A 4YBMA 4YYHA 5EQ1A 5D3PA 3UV4A 4IR5A 5F63A 5A82A 2LSPB 4KV4A 4LYSA 5K29A 3IU6A 3D1BA 4NRCA 5D25A 4F3IA 3UVXA 5CUDA 5FG5A 4TT2A 4OGIA 5FE1A 2RNYA 4N4HA 4QYLA 4QEWA 4YADA 5KHMA 5CY9A 5E9KA 1EQFA 5L96A 4TT4A 4UIYA 4LRGA 4UIVA 4UYFB 5EM3A 3P1CA 4HXNA 5HM0A 5IGKA 4LDFA 5FB0A 5AD2A 5CZGA 3JVLA 5FE3A 2RI7A 4QSUA 2F6JA 5COIA 5F1HA 4X2IA 2I8NA 4MR6A 5L97A 4KCXA 5LJ1A 3UW9A 4YYMA 4QUUA 4XUBA 4WHUA 4BHWA 5E3GA 4Z93A 5EWDA 3DAIA 5EVAA 4TYLA 5LVQA 4MEOA 4PTBA 4QR5A 5H1TA 4TTEA 2WP2A 4LZ2A 5FBXA 4PCIA 5TB6A 5HQ5A 5E9IA 3ZYUA 4HBXA 3D7CA 5E3DA 4TZ8A 3D1DA 3ERRA 5EWWA 3S92A 5LKXA 3I3JA 4PS5A 2R0SA 4QSXA 4HXMA 2OO1A 4E96A 1JSPB 4CLBA 4CL9A 4N3WA 5D3LA 4QSPA 5I89A 4A9EA 5F62A 5JWMA 5ENBA 5E9MA 4O7FA 5CFWA 5D3SA 4NRAA 5AMEA 2R0YA 2YW5A 5FE7A 3QZSA 4LR6A 4UYHA 5F5ZA 5CUAA 5FFWA 2E3KA 4GPJA 4O74A 5CUCA 2R10A 4QR3A 2RNWA 4NUEA 4QC3A 4YYNA 4UITA 4XY8A 3U5MA 5LKTA 4YY4A 5LKUA 4ZW1A 4O75A 5BT5A 4NR6A 4N4IA 4NYWA 5E9VA 1WUMA 4UIXA 3S91A 5DFDA 5CQ8A 2DVQA 5E0RA 4UYDA 5D3RA 1JM4B 5HJCA 5KTWA 3P1FA 3P1DA 3G0LA 4NR7A 5L98A 3U5LA 4QB3A 5EISA 5LKZA 5I40A 4HBWA 5FG6A 3O36A 4IR3A 4HXLA 4TQNA 4O77A 4HXKA 4AKHA 5D24A 5LJ0A 4HBVA 5HFQA 2OSSA 5II1A 4QBMA 4QSSA 3DWYA 5FE8A 4NR5A 4A9FA 5EPSA 5KTXA 5A83A 4J3IA 2DVVA 4LZRA 5G4SA 3O37A 4YYIA 2YELA 5CGPA 3LXJA 5EV9A 4Z1QA 4UYEA 4Q0OA 5CUGA 4IORA 5CQTA 3MB4A 4QY4A 4CUUA 4CUTA 4A9HA 4Z1SA 3U5JA 5CQ5A 5HRVA 5G4RA 5LUUA 2RS9B 5DKCA 3K2JA 5E74A 5EP7A 4BW1A 5F36A 4YABA 4YYDA 5HELA 5CU8A 4XYAA 5I86A 5A5RA 5C4QA 5EA1A 5L99A 4OUFA 5EK9A 4BW2A 5A5OA 5DKDA 4TZ2A 4C66A 5CQ3A 4QR4A 3G0JA 4MR5A 4UIUA 4Z6HA 5CUBA 2G4AA 4UIZA 1PUOA 4NUCA 5EPRA 4O78A 4O7CA 5CUEA 4AI6A 4TS8A 2RFJA 3HMFA 4O76A 5HQ7A 5FH8A 5C8GA 2L84A 2YEMA 4PKLA 5FG4A 5CP5A 5HFRA 4IR6A 4QSRA 4YBTA 5AD3A 5C87A 4NQMA 1WUGA 5IGNA 3ONIA 4A9JA 3MQMA 5I7YA 2DWWA 4TU4A 5HRWA 4J0RA 4QZSA 4NYVA 4KV1A 5KTUA 3U5OA 2YYNA 4UYGA 5ENFA 4TT6A 3LQJA 4MR3A 5D3HA 2RO1A 4HXOA 4LYWA 3FKMX 5E73A 5ENHA 4XY9A 2E7NA 4NXJA 4O7AA 5I7XA 5HCLA 5EWCA 5FE6A 3MB3A 3U5KA 5D0CA 4AKIA 4YH4A 3SVGA 4DONA 5ENGA 5DLXA 2I7KA 5A5PA 5H1UA 5DLZA 2H60A 5LVRA 4YYGA 3U5PA 5IGMA 3O33A 4NQNA 2F6NA 5EPBA 5I83A 3QZVA 4CUPA 5DFBA 4A9OA 4CFLA 4ALGA 4BJXA 3AADA 4N4FA 5FE9A 2N9GA 5EU1A 4QSVA 4OGJA
chains in the Genus database with same CATH topology
5CTLA 4YYKA 3O34A 3JVJA 5FDZA 4Y03A 5I88A 5ETBA 5FE4A 5A5NA 4YATA 5CQ4A 5CRZA 5FE5A 4NS5A 1X0JA 3RCWA 4YAXA 4Q0NA 5CPEA 4Z6IA 5FH7A 4PCEA 5F2PA 5I29A 5A81A 3Q2EA 4CUQA 5DYAA 5HEMA 4YBSA 4CFKA 4J0SA 2YEKA 5IGLA 4O70A 3IU5A 5F61A 5D3NA 4BW4A 4XUAA 4QNSA 4QSTA 5C89A 4WHWA 5BT3A 5FB1A 5A85A 4O71A 5DYXA 5L8TA 5FE2A 5E7DA 2WP1A 4LYIA 5EGUA 1ZS5A 5ENIA 5D7XA 3UV5A 3SVHA 1E6IA 4NYXA 5A5QA 5EI4A 5A7CA 4C67A 3UVDA 4J1PA 2L5EA 4LC2A 3LJWA 3QZTA 2D82A 5EWHA 5F3AA 2RNXA 3LQHA 5CS8A 5DY7A 4ZQLA 5IBNA 5EICA 4A9IA 2OUOA 5C7NA 4HXRA 5KU3A 4QUTA 5KO4A 5DBMA 5HLSA 3Q2FA 4AKNA 5CRMA 2GRCA 2DVRA 3U5NA 2DATA 3GG3A 4MEQA 2R0VA 4A9NA 5JI8A 5DKHA 4UIWA 3HMEA 4A9MA 4QC1A 5D26A 3UVYA 4HXSA 2DKWA 4FLPA 3MULA 5AMFA 2D9EA 4ALHA 5L8UA 2YDWA 5ENJA 3UV2A 4IOQA 3JVMA 4QSQA 5II2A 4YC9A 3MXFA 3NXBA 3HMHA 5DYUA 5C85A 5I1QA 4QSWA 4NUDA 4A9LA 4BW3A 5IIDA 3MUKA 5FH6A 3JVKA 5ENEA 3LQIA 5CQAA 5ACYA 4NR9A 4IR4A 5F60A 5F1LA 2E7OA 2MJVB 5ENCA 5HQ6A 2NXBA 4QYDA 4NRBA 4QEUA 5FFYA 2KTBB 3P5OA 5ETDA 2FSAA 4PY6A 4N4GA 4HBYA 5HENA 4RVRA 5F25A 4NR8A 3AQAA 5DFCA 4ZC9A 5FE0A 3P1EA 4MENA 5LJ2A 4YY6A 4TU6A 5DX4A 3UVWA 5D3JA 1F68A 5FFVA 4MEPA 5CQ6A 5EWVA 5D3TA 4UYFA 5E9YA 5IG6A 5J0DA 4WIVA 4YH3A 5DW1A 2L85A 4O7BA 5H85A 3O35A 5A5SA 5HRXA 1N72A 4LZSA 4QEVA 5BT4A 4YK0A 4YYJA 4CURA 4O7EA 3SVFA 2DVSA 5CQ7A 2YQDA 3TLPA 4NR4A 4A9KA 5I80A 5TCMA 4IOOA 4O72A 4CUSA 5H1VA 5E9LA 5DYCA 4HXPA 4MR4A 5DW2A 4YBMA 4YYHA 5EQ1A 5D3PA 3UV4A 4IR5A 5F63A 5A82A 2LSPB 4KV4A 4LYSA 5K29A 3IU6A 5D25A 4NRCA 4F3IA 3UVXA 5CUDA 5FG5A 4TT2A 4OGIA 5FE1A 2RNYA 4N4HA 4QYLA 4QEWA 4YADA 5KHMA 5CY9A 5E9KA 1EQFA 5L96A 4TT4A 4UIYA 4LRGA 4UIVA 4UYFB 5EM3A 3P1CA 4HXNA 5HM0A 5IGKA 4LDFA 5FB0A 5AD2A 5CZGA 3JVLA 5FE3A 2RI7A 4QSUA 2F6JA 5COIA 5F1HA 4X2IA 2I8NA 4MR6A 5L97A 4KCXA 5LJ1A 3UW9A 4YYMA 4QUUA 4XUBA 4WHUA 4BHWA 5E3GA 4Z93A 5EWDA 3DAIA 5EVAA 4TYLA 5LVQA 4MEOA 4PTBA 4QR5A 5H1TA 4TTEA 2WP2A 4LZ2A 5FBXA 4PCIA 5TB6A 5HQ5A 5E9IA 3ZYUA 4HBXA 3D7CA 5E3DA 4TZ8A 5EWWA 3S92A 5LKXA 3I3JA 4PS5A 2R0SA 4QSXA 4HXMA 2OO1A 4E96A 1JSPB 4CLBA 4CL9A 4N3WA 5D3LA 4QSPA 5I89A 4A9EA 5F62A 5JWMA 5ENBA 5E9MA 4O7FA 5CFWA 5D3SA 4NRAA 5AMEA 2R0YA 2YW5A 5FE7A 3QZSA 4LR6A 4UYHA 5F5ZA 5CUAA 5FFWA 2E3KA 4GPJA 4O74A 5CUCA 2R10A 4QR3A 2RNWA 4NUEA 4QC3A 4YYNA 4UITA 4XY8A 3U5MA 5LKTA 4YY4A 5LKUA 4ZW1A 4O75A 5BT5A 4NR6A 4N4IA 4NYWA 5E9VA 1WUMA 4UIXA 3S91A 5DFDA 5CQ8A 2DVQA 5E0RA 4UYDA 5D3RA 1JM4B 5HJCA 5KTWA 3P1FA 3P1DA 3G0LA 4NR7A 5L98A 3U5LA 4QB3A 5EISA 5LKZA 5I40A 4HBWA 5FG6A 3O36A 4IR3A 4HXLA 4TQNA 4O77A 4HXKA 5D24A 5LJ0A 4HBVA 5HFQA 2OSSA 5II1A 4QBMA 4QSSA 3DWYA 5FE8A 4NR5A 4A9FA 5EPSA 5KTXA 5A83A 4J3IA 2DVVA 4LZRA 5G4SA 3O37A 4YYIA 2YELA 5CGPA 3LXJA 5EV9A 4Z1QA 4UYEA 4Q0OA 5CUGA 4IORA 5CQTA 3MB4A 4QY4A 4CUUA 4CUTA 4A9HA 4Z1SA 3U5JA 5CQ5A 5HRVA 5G4RA 5LUUA 2RS9B 5DKCA 3K2JA 5E74A 5EP7A 4BW1A 5F36A 4YABA 4YYDA 5HELA 5CU8A 4XYAA 5I86A 5A5RA 5C4QA 5EA1A 5L99A 4OUFA 5EK9A 4BW2A 5A5OA 5DKDA 4TZ2A 4C66A 5CQ3A 4QR4A 3G0JA 4MR5A 4UIUA 4Z6HA 5CUBA 2G4AA 4UIZA 4NUCA 5EPRA 4O78A 4O7CA 5CUEA 4TS8A 2RFJA 3HMFA 4O76A 5HQ7A 5FH8A 5C8GA 2L84A 2YEMA 4PKLA 5FG4A 5CP5A 5HFRA 4IR6A 4QSRA 4YBTA 5AD3A 5C87A 4NQMA 1WUGA 5IGNA 3ONIA 4A9JA 3MQMA 5I7YA 2DWWA 4TU4A 5HRWA 4J0RA 4QZSA 4NYVA 4KV1A 5KTUA 3U5OA 2YYNA 4UYGA 5ENFA 4TT6A 3LQJA 4MR3A 5D3HA 2RO1A 4HXOA 4LYWA 3FKMX 5E73A 5ENHA 4XY9A 2E7NA 4NXJA 4O7AA 5I7XA 5HCLA 5EWCA 5FE6A 3MB3A 3U5KA 5D0CA 4YH4A 3SVGA 4DONA 5ENGA 5DLXA 2I7KA 5A5PA 5H1UA 5DLZA 2H60A 5LVRA 4YYGA 3U5PA 5IGMA 3O33A 4NQNA 2F6NA 5EPBA 5I83A 3QZVA 4CUPA 5DFBA 4A9OA 4CFLA 4ALGA 4BJXA 3AADA 4N4FA 5FE9A 2N9GA 5EU1A 4QSVA 4OGJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CTL A;  4YYK A;  3O34 A;  3JVJ A;  5FDZ A;  4Y03 A;  5I88 A;  5ETB A;  5FE4 A;  5A5N A;  4YAT A;  5CQ4 A;  5CRZ A;  5FE5 A;  4NS5 A;  1X0J A;  3RCW A;  4YAX A;  4Q0N A;  5CPE A;  4Z6I A;  5FH7 A;  4PCE A;  5F2P A;  5I29 A;  5A81 A;  3Q2E A;  4CUQ A;  5DYA A;  5HEM A;  4YBS A;  4CFK A;  4J0S A;  2YEK A;  5IGL A;  4O70 A;  3IU5 A;  5F61 A;  5D3N A;  4BW4 A;  4XUA A;  4QNS A;  4QST A;  5C89 A;  4WHW A;  5BT3 A;  5FB1 A;  5A85 A;  4O71 A;  5DYX A;  5L8T A;  5FE2 A;  5E7D A;  2WP1 A;  4LYI A;  5EGU A;  1ZS5 A;  5ENI A;  5D7X A;  3UV5 A;  3SVH A;  1E6I A;  4NYX A;  5A5Q A;  5EI4 A;  5A7C A;  4C67 A;  3UVD A;  4J1P A;  2L5E A;  4LC2 A;  3LJW A;  3QZT A;  2D82 A;  5EWH A;  5F3A A;  2RNX A;  3LQH A;  5CS8 A;  5DY7 A;  4ZQL A;  5IBN A;  5EIC A;  4A9I A;  2OUO A;  5C7N A;  4HXR A;  5KU3 A;  4QUT A;  5KO4 A;  5DBM A;  5HLS A;  3Q2F A;  4AKN A;  5CRM A;  2GRC A;  2DVR A;  3U5N A;  2DAT A;  3GG3 A;  4MEQ A;  2R0V A;  4A9N A;  5JI8 A;  5DKH A;  4UIW A;  3HME A;  4A9M A;  4QC1 A;  5D26 A;  3UVY A;  4HXS A;  2DKW A;  4FLP A;  3MUL A;  5AMF A;  2D9E A;  4ALH A;  5L8U A;  2YDW A;  5ENJ A;  3UV2 A;  4IOQ A;  3JVM A;  4QSQ A;  5II2 A;  4YC9 A;  3MXF A;  3NXB A;  3HMH A;  5DYU A;  5C85 A;  5I1Q A;  4QSW A;  4NUD A;  4A9L A;  4BW3 A;  5IID A;  3MUK A;  5FH6 A;  3JVK A;  5ENE A;  3LQI A;  5CQA A;  5ACY A;  4NR9 A;  4IR4 A;  5F60 A;  5F1L A;  2E7O A;  2MJV B;  5ENC A;  5HQ6 A;  2NXB A;  4QYD A;  4NRB A;  4QEU A;  5FFY A;  2KTB B;  3P5O A;  5ETD A;  2FSA A;  4PY6 A;  4N4G A;  4HBY A;  5HEN A;  4RVR A;  5F25 A;  4NR8 A;  3AQA A;  5DFC A;  4ZC9 A;  5FE0 A;  3P1E A;  4MEN A;  5LJ2 A;  4YY6 A;  4TU6 A;  5DX4 A;  3UVW A;  5D3J A;  1F68 A;  5FFV A;  4MEP A;  5CQ6 A;  5EWV A;  5D3T A;  4UYF A;  5E9Y A;  5IG6 A;  5J0D A;  4WIV A;  4YH3 A;  5DW1 A;  2L85 A;  4O7B A;  5H85 A;  3O35 A;  5A5S A;  5HRX A;  1N72 A;  4LZS A;  4QEV A;  5BT4 A;  4YK0 A;  4YYJ A;  4CUR A;  4O7E A;  3SVF A;  2DVS A;  5CQ7 A;  2YQD A;  3TLP A;  4NR4 A;  4A9K A;  5I80 A;  5TCM A;  4IOO A;  4O72 A;  4CUS A;  5H1V A;  5E9L A;  5DYC A;  4HXP A;  4MR4 A;  5DW2 A;  4YBM A;  4YYH A;  5EQ1 A;  5D3P A;  3UV4 A;  4IR5 A;  5F63 A;  5A82 A;  2LSP B;  4KV4 A;  4LYS A;  5K29 A;  3IU6 A;  5D25 A;  4NRC A;  4F3I A;  3UVX A;  5CUD A;  5FG5 A;  4TT2 A;  4OGI A;  5FE1 A;  2RNY A;  4N4H A;  4QYL A;  4QEW A;  4YAD A;  5KHM A;  5CY9 A;  5E9K A;  1EQF A;  5L96 A;  4TT4 A;  4UIY A;  4LRG A;  4UIV A;  4UYF B;  5EM3 A;  3P1C A;  4HXN A;  5HM0 A;  5IGK A;  4LDF A;  5FB0 A;  5AD2 A;  5CZG A;  3JVL A;  5FE3 A;  2RI7 A;  4QSU A;  2F6J A;  5COI A;  5F1H A;  4X2I A;  2I8N A;  4MR6 A;  5L97 A;  4KCX A;  5LJ1 A;  3UW9 A;  4YYM A;  4QUU A;  4XUB A;  4WHU A;  4BHW A;  5E3G A;  4Z93 A;  5EWD A;  3DAI A;  5EVA A;  4TYL A;  5LVQ A;  4MEO A;  4PTB A;  4QR5 A;  5H1T A;  4TTE A;  2WP2 A;  4LZ2 A;  5FBX A;  4PCI A;  5TB6 A;  5HQ5 A;  5E9I A;  3ZYU A;  4HBX A;  3D7C A;  5E3D A;  4TZ8 A;  5EWW A;  3S92 A;  5LKX A;  3I3J A;  4PS5 A;  2R0S A;  4QSX A;  4HXM A;  2OO1 A;  4E96 A;  1JSP B;  4CLB A;  4CL9 A;  4N3W A;  5D3L A;  4QSP A;  5I89 A;  4A9E A;  5F62 A;  5JWM A;  5ENB A;  5E9M A;  4O7F A;  5CFW A;  5D3S A;  4NRA A;  5AME A;  2R0Y A;  2YW5 A;  5FE7 A;  3QZS A;  4LR6 A;  4UYH A;  5F5Z A;  5CUA A;  5FFW A;  2E3K A;  4GPJ A;  4O74 A;  5CUC A;  2R10 A;  4QR3 A;  2RNW A;  4NUE A;  4QC3 A;  4YYN A;  4UIT A;  4XY8 A;  3U5M A;  5LKT A;  4YY4 A;  5LKU A;  4ZW1 A;  4O75 A;  5BT5 A;  4NR6 A;  4N4I A;  4NYW A;  5E9V A;  1WUM A;  4UIX A;  3S91 A;  5DFD A;  5CQ8 A;  2DVQ A;  5E0R A;  4UYD A;  5D3R A;  1JM4 B;  5HJC A;  5KTW A;  3P1F A;  3P1D A;  3G0L A;  4NR7 A;  5L98 A;  3U5L A;  4QB3 A;  5EIS A;  5LKZ A;  5I40 A;  4HBW A;  5FG6 A;  3O36 A;  4IR3 A;  4HXL A;  4TQN A;  4O77 A;  4HXK A;  5D24 A;  5LJ0 A;  4HBV A;  5HFQ A;  2OSS A;  5II1 A;  4QBM A;  4QSS A;  3DWY A;  5FE8 A;  4NR5 A;  4A9F A;  5EPS A;  5KTX A;  5A83 A;  4J3I A;  2DVV A;  4LZR A;  5G4S A;  3O37 A;  4YYI A;  2YEL A;  5CGP A;  3LXJ A;  5EV9 A;  4Z1Q A;  4UYE A;  4Q0O A;  5CUG A;  4IOR A;  5CQT A;  3MB4 A;  4QY4 A;  4CUU A;  4CUT A;  4A9H A;  4Z1S A;  3U5J A;  5CQ5 A;  5HRV A;  5G4R A;  5LUU A;  2RS9 B;  5DKC A;  3K2J A;  5E74 A;  5EP7 A;  4BW1 A;  5F36 A;  4YAB A;  4YYD A;  5HEL A;  5CU8 A;  4XYA A;  5I86 A;  5A5R A;  5C4Q A;  5EA1 A;  5L99 A;  4OUF A;  5EK9 A;  4BW2 A;  5A5O A;  5DKD A;  4TZ2 A;  4C66 A;  5CQ3 A;  4QR4 A;  3G0J A;  4MR5 A;  4UIU A;  4Z6H A;  5CUB A;  2G4A A;  4UIZ A;  4NUC A;  5EPR A;  4O78 A;  4O7C A;  5CUE A;  4TS8 A;  2RFJ A;  3HMF A;  4O76 A;  5HQ7 A;  5FH8 A;  5C8G A;  2L84 A;  2YEM A;  4PKL A;  5FG4 A;  5CP5 A;  5HFR A;  4IR6 A;  4QSR A;  4YBT A;  5AD3 A;  5C87 A;  4NQM A;  1WUG A;  5IGN A;  3ONI A;  4A9J A;  3MQM A;  5I7Y A;  2DWW A;  4TU4 A;  5HRW A;  4J0R A;  4QZS A;  4NYV A;  4KV1 A;  5KTU A;  3U5O A;  2YYN A;  4UYG A;  5ENF A;  4TT6 A;  3LQJ A;  4MR3 A;  5D3H A;  2RO1 A;  4HXO A;  4LYW A;  3FKM X;  5E73 A;  5ENH A;  4XY9 A;  2E7N A;  4NXJ A;  4O7A A;  5I7X A;  5HCL A;  5EWC A;  5FE6 A;  3MB3 A;  3U5K A;  5D0C A;  4YH4 A;  3SVG A;  4DON A;  5ENG A;  5DLX A;  2I7K A;  5A5P A;  5H1U A;  5DLZ A;  2H60 A;  5LVR A;  4YYG A;  3U5P A;  5IGM A;  3O33 A;  4NQN A;  2F6N A;  5EPB A;  5I83 A;  3QZV A;  4CUP A;  5DFB A;  4A9O A;  4CFL A;  4ALG A;  4BJX A;  3AAD A;  4N4F A;  5FE9 A;  2N9G A;  5EU1 A;  4QSV A;  4OGJ A; 
#chains in the Genus database with same CATH topology
 5CTL A;  4YYK A;  3O34 A;  3JVJ A;  5FDZ A;  4Y03 A;  5I88 A;  5ETB A;  5FE4 A;  5A5N A;  4YAT A;  5CQ4 A;  5CRZ A;  5FE5 A;  2EJN A;  4NS5 A;  1X0J A;  3RCW A;  4YAX A;  4Q0N A;  3VKH A;  5CPE A;  4Z6I A;  5FH7 A;  4PCE A;  5F2P A;  5I29 A;  5A81 A;  3Q2E A;  4CUQ A;  5DYA A;  5HEM A;  4YBS A;  4CFK A;  4J0S A;  2YEK A;  5IGL A;  4O70 A;  3IU5 A;  5F61 A;  5D3N A;  4BW4 A;  4XUA A;  4QNS A;  4QST A;  5C89 A;  4WHW A;  5BT3 A;  5FB1 A;  5A85 A;  4O71 A;  5DYX A;  5L8T A;  5FE2 A;  5E7D A;  2WP1 A;  4LYI A;  5EGU A;  1ZS5 A;  5ENI A;  5D7X A;  3UV5 A;  3SVH A;  1E6I A;  4NYX A;  5A5Q A;  5EI4 A;  5A7C A;  4C67 A;  3UVD A;  4J1P A;  2L5E A;  4LC2 A;  3LJW A;  3QZT A;  2D82 A;  5EWH A;  5F3A A;  2RNX A;  3LQH A;  5CS8 A;  5DY7 A;  4ZQL A;  5IBN A;  5EIC A;  4A9I A;  2OUO A;  5C7N A;  4HXR A;  5KU3 A;  4QUT A;  3VKG A;  5KO4 A;  5DBM A;  5HLS A;  3Q2F A;  4AKN A;  5CRM A;  2GRC A;  2DVR A;  3U5N A;  2DAT A;  3GG3 A;  4MEQ A;  2R0V A;  4A9N A;  5JI8 A;  5DKH A;  4UIW A;  3HME A;  4A9M A;  4QC1 A;  5D26 A;  3UVY A;  4HXS A;  2DKW A;  4FLP A;  3MUL A;  5AMF A;  2D9E A;  4ALH A;  5L8U A;  2YDW A;  5ENJ A;  3UV2 A;  4IOQ A;  3JVM A;  4QSQ A;  5II2 A;  4YC9 A;  3MXF A;  3NXB A;  3HMH A;  5DYU A;  5C85 A;  5I1Q A;  4QSW A;  4NUD A;  4A9L A;  4BW3 A;  5IID A;  3MUK A;  5FH6 A;  3JVK A;  5ENE A;  3LQI A;  5CQA A;  5ACY A;  4NR9 A;  4IR4 A;  5F60 A;  5F1L A;  2E7O A;  2MJV B;  5ENC A;  5HQ6 A;  2NXB A;  4QYD A;  4NRB A;  4QEU A;  5FFY A;  2KTB B;  3P5O A;  5ETD A;  2FSA A;  4PY6 A;  4N4G A;  4HBY A;  5HEN A;  4RVR A;  5F25 A;  4NR8 A;  3AQA A;  1ZKR A;  5DFC A;  4ZC9 A;  5FE0 A;  3P1E A;  4MEN A;  5LJ2 A;  4YY6 A;  4TU6 A;  5DX4 A;  3UVW A;  5D3J A;  1F68 A;  5FFV A;  4MEP A;  5CQ6 A;  5EWV A;  5D3T A;  4UYF A;  5E9Y A;  5IG6 A;  5J0D A;  4WIV A;  4YH3 A;  5DW1 A;  2L85 A;  4O7B A;  5H85 A;  3O35 A;  5A5S A;  5HRX A;  1N72 A;  4LZS A;  4QEV A;  4AKG A;  5BT4 A;  4YK0 A;  4YYJ A;  4CUR A;  4O7E A;  3SVF A;  2DVS A;  5CQ7 A;  2YQD A;  3TLP A;  4NR4 A;  4A9K A;  5I80 A;  5TCM A;  4IOO A;  4O72 A;  4CUS A;  5H1V A;  5E9L A;  5DYC A;  4HXP A;  4MR4 A;  5DW2 A;  4YBM A;  4YYH A;  5EQ1 A;  5D3P A;  3UV4 A;  4IR5 A;  5F63 A;  5A82 A;  2LSP B;  4KV4 A;  4LYS A;  5K29 A;  3IU6 A;  3D1B A;  4NRC A;  5D25 A;  4F3I A;  3UVX A;  5CUD A;  5FG5 A;  4TT2 A;  4OGI A;  5FE1 A;  2RNY A;  4N4H A;  4QYL A;  4QEW A;  4YAD A;  5KHM A;  5CY9 A;  5E9K A;  1EQF A;  5L96 A;  4TT4 A;  4UIY A;  4LRG A;  4UIV A;  4UYF B;  5EM3 A;  3P1C A;  4HXN A;  5HM0 A;  5IGK A;  4LDF A;  5FB0 A;  5AD2 A;  5CZG A;  3JVL A;  5FE3 A;  2RI7 A;  4QSU A;  2F6J A;  5COI A;  5F1H A;  4X2I A;  2I8N A;  4MR6 A;  5L97 A;  4KCX A;  5LJ1 A;  3UW9 A;  4YYM A;  4QUU A;  4XUB A;  4WHU A;  4BHW A;  5E3G A;  4Z93 A;  5EWD A;  3DAI A;  5EVA A;  4TYL A;  5LVQ A;  4MEO A;  4PTB A;  4QR5 A;  5H1T A;  4TTE A;  2WP2 A;  4LZ2 A;  5FBX A;  4PCI A;  5TB6 A;  5HQ5 A;  5E9I A;  3ZYU A;  4HBX A;  3D7C A;  5E3D A;  4TZ8 A;  3D1D A;  3ERR A;  5EWW A;  3S92 A;  5LKX A;  3I3J A;  4PS5 A;  2R0S A;  4QSX A;  4HXM A;  2OO1 A;  4E96 A;  1JSP B;  4CLB A;  4CL9 A;  4N3W A;  5D3L A;  4QSP A;  5I89 A;  4A9E A;  5F62 A;  5JWM A;  5ENB A;  5E9M A;  4O7F A;  5CFW A;  5D3S A;  4NRA A;  5AME A;  2R0Y A;  2YW5 A;  5FE7 A;  3QZS A;  4LR6 A;  4UYH A;  5F5Z A;  5CUA A;  5FFW A;  2E3K A;  4GPJ A;  4O74 A;  5CUC A;  2R10 A;  4QR3 A;  2RNW A;  4NUE A;  4QC3 A;  4YYN A;  4UIT A;  4XY8 A;  3U5M A;  5LKT A;  4YY4 A;  5LKU A;  4ZW1 A;  4O75 A;  5BT5 A;  4NR6 A;  4N4I A;  4NYW A;  5E9V A;  1WUM A;  4UIX A;  3S91 A;  5DFD A;  5CQ8 A;  2DVQ A;  5E0R A;  4UYD A;  5D3R A;  1JM4 B;  5HJC A;  5KTW A;  3P1F A;  3P1D A;  3G0L A;  4NR7 A;  5L98 A;  3U5L A;  4QB3 A;  5EIS A;  5LKZ A;  5I40 A;  4HBW A;  5FG6 A;  3O36 A;  4IR3 A;  4HXL A;  4TQN A;  4O77 A;  4HXK A;  4AKH A;  5D24 A;  5LJ0 A;  4HBV A;  5HFQ A;  2OSS A;  5II1 A;  4QBM A;  4QSS A;  3DWY A;  5FE8 A;  4NR5 A;  4A9F A;  5EPS A;  5KTX A;  5A83 A;  4J3I A;  2DVV A;  4LZR A;  5G4S A;  3O37 A;  4YYI A;  2YEL A;  5CGP A;  3LXJ A;  5EV9 A;  4Z1Q A;  4UYE A;  4Q0O A;  5CUG A;  4IOR A;  5CQT A;  3MB4 A;  4QY4 A;  4CUU A;  4CUT A;  4A9H A;  4Z1S A;  3U5J A;  5CQ5 A;  5HRV A;  5G4R A;  5LUU A;  2RS9 B;  5DKC A;  3K2J A;  5E74 A;  5EP7 A;  4BW1 A;  5F36 A;  4YAB A;  4YYD A;  5HEL A;  5CU8 A;  4XYA A;  5I86 A;  5A5R A;  5C4Q A;  5EA1 A;  5L99 A;  4OUF A;  5EK9 A;  4BW2 A;  5A5O A;  5DKD A;  4TZ2 A;  4C66 A;  5CQ3 A;  4QR4 A;  3G0J A;  4MR5 A;  4UIU A;  4Z6H A;  5CUB A;  2G4A A;  4UIZ A;  1PUO A;  4NUC A;  5EPR A;  4O78 A;  4O7C A;  5CUE A;  4AI6 A;  4TS8 A;  2RFJ A;  3HMF A;  4O76 A;  5HQ7 A;  5FH8 A;  5C8G A;  2L84 A;  2YEM A;  4PKL A;  5FG4 A;  5CP5 A;  5HFR A;  4IR6 A;  4QSR A;  4YBT A;  5AD3 A;  5C87 A;  4NQM A;  1WUG A;  5IGN A;  3ONI A;  4A9J A;  3MQM A;  5I7Y A;  2DWW A;  4TU4 A;  5HRW A;  4J0R A;  4QZS A;  4NYV A;  4KV1 A;  5KTU A;  3U5O A;  2YYN A;  4UYG A;  5ENF A;  4TT6 A;  3LQJ A;  4MR3 A;  5D3H A;  2RO1 A;  4HXO A;  4LYW A;  3FKM X;  5E73 A;  5ENH A;  4XY9 A;  2E7N A;  4NXJ A;  4O7A A;  5I7X A;  5HCL A;  5EWC A;  5FE6 A;  3MB3 A;  3U5K A;  5D0C A;  4AKI A;  4YH4 A;  3SVG A;  4DON A;  5ENG A;  5DLX A;  2I7K A;  5A5P A;  5H1U A;  5DLZ A;  2H60 A;  5LVR A;  4YYG A;  3U5P A;  5IGM A;  3O33 A;  4NQN A;  2F6N A;  5EPB A;  5I83 A;  3QZV A;  4CUP A;  5DFB A;  4A9O A;  4CFL A;  4ALG A;  4BJX A;  3AAD A;  4N4F A;  5FE9 A;  2N9G A;  5EU1 A;  4QSV A;  4OGJ A; 
#chains in the Genus database with same CATH homology
 5CTL A;  4YYK A;  3O34 A;  3JVJ A;  5FDZ A;  4Y03 A;  5I88 A;  5ETB A;  5FE4 A;  5A5N A;  4YAT A;  5CQ4 A;  5CRZ A;  5FE5 A;  4NS5 A;  1X0J A;  3RCW A;  4YAX A;  4Q0N A;  5CPE A;  4Z6I A;  5FH7 A;  4PCE A;  5F2P A;  5I29 A;  5A81 A;  3Q2E A;  4CUQ A;  5DYA A;  5HEM A;  4YBS A;  4CFK A;  4J0S A;  2YEK A;  5IGL A;  4O70 A;  3IU5 A;  5F61 A;  5D3N A;  4BW4 A;  4XUA A;  4QNS A;  4QST A;  5C89 A;  4WHW A;  5BT3 A;  5FB1 A;  5A85 A;  4O71 A;  5DYX A;  5L8T A;  5FE2 A;  5E7D A;  2WP1 A;  4LYI A;  5EGU A;  1ZS5 A;  5ENI A;  5D7X A;  3UV5 A;  3SVH A;  1E6I A;  4NYX A;  5A5Q A;  5EI4 A;  5A7C A;  4C67 A;  3UVD A;  4J1P A;  2L5E A;  4LC2 A;  3LJW A;  3QZT A;  2D82 A;  5EWH A;  5F3A A;  2RNX A;  3LQH A;  5CS8 A;  5DY7 A;  4ZQL A;  5IBN A;  5EIC A;  4A9I A;  2OUO A;  5C7N A;  4HXR A;  5KU3 A;  4QUT A;  5KO4 A;  5DBM A;  5HLS A;  3Q2F A;  4AKN A;  5CRM A;  2GRC A;  2DVR A;  3U5N A;  2DAT A;  3GG3 A;  4MEQ A;  2R0V A;  4A9N A;  5JI8 A;  5DKH A;  4UIW A;  3HME A;  4A9M A;  4QC1 A;  5D26 A;  3UVY A;  4HXS A;  2DKW A;  4FLP A;  3MUL A;  5AMF A;  2D9E A;  4ALH A;  5L8U A;  2YDW A;  5ENJ A;  3UV2 A;  4IOQ A;  3JVM A;  4QSQ A;  5II2 A;  4YC9 A;  3MXF A;  3NXB A;  3HMH A;  5DYU A;  5C85 A;  5I1Q A;  4QSW A;  4NUD A;  4A9L A;  4BW3 A;  5IID A;  3MUK A;  5FH6 A;  3JVK A;  5ENE A;  3LQI A;  5CQA A;  5ACY A;  4NR9 A;  4IR4 A;  5F60 A;  5F1L A;  2E7O A;  2MJV B;  5ENC A;  5HQ6 A;  2NXB A;  4QYD A;  4NRB A;  4QEU A;  5FFY A;  2KTB B;  3P5O A;  5ETD A;  2FSA A;  4PY6 A;  4N4G A;  4HBY A;  5HEN A;  4RVR A;  5F25 A;  4NR8 A;  3AQA A;  5DFC A;  4ZC9 A;  5FE0 A;  3P1E A;  4MEN A;  5LJ2 A;  4YY6 A;  4TU6 A;  5DX4 A;  3UVW A;  5D3J A;  1F68 A;  5FFV A;  4MEP A;  5CQ6 A;  5EWV A;  5D3T A;  4UYF A;  5E9Y A;  5IG6 A;  5J0D A;  4WIV A;  4YH3 A;  5DW1 A;  2L85 A;  4O7B A;  5H85 A;  3O35 A;  5A5S A;  5HRX A;  1N72 A;  4LZS A;  4QEV A;  5BT4 A;  4YK0 A;  4YYJ A;  4CUR A;  4O7E A;  3SVF A;  2DVS A;  5CQ7 A;  2YQD A;  3TLP A;  4NR4 A;  4A9K A;  5I80 A;  5TCM A;  4IOO A;  4O72 A;  4CUS A;  5H1V A;  5E9L A;  5DYC A;  4HXP A;  4MR4 A;  5DW2 A;  4YBM A;  4YYH A;  5EQ1 A;  5D3P A;  3UV4 A;  4IR5 A;  5F63 A;  5A82 A;  2LSP B;  4KV4 A;  4LYS A;  5K29 A;  3IU6 A;  5D25 A;  4NRC A;  4F3I A;  3UVX A;  5CUD A;  5FG5 A;  4TT2 A;  4OGI A;  5FE1 A;  2RNY A;  4N4H A;  4QYL A;  4QEW A;  4YAD A;  5KHM A;  5CY9 A;  5E9K A;  1EQF A;  5L96 A;  4TT4 A;  4UIY A;  4LRG A;  4UIV A;  4UYF B;  5EM3 A;  3P1C A;  4HXN A;  5HM0 A;  5IGK A;  4LDF A;  5FB0 A;  5AD2 A;  5CZG A;  3JVL A;  5FE3 A;  2RI7 A;  4QSU A;  2F6J A;  5COI A;  5F1H A;  4X2I A;  2I8N A;  4MR6 A;  5L97 A;  4KCX A;  5LJ1 A;  3UW9 A;  4YYM A;  4QUU A;  4XUB A;  4WHU A;  4BHW A;  5E3G A;  4Z93 A;  5EWD A;  3DAI A;  5EVA A;  4TYL A;  5LVQ A;  4MEO A;  4PTB A;  4QR5 A;  5H1T A;  4TTE A;  2WP2 A;  4LZ2 A;  5FBX A;  4PCI A;  5TB6 A;  5HQ5 A;  5E9I A;  3ZYU A;  4HBX A;  3D7C A;  5E3D A;  4TZ8 A;  5EWW A;  3S92 A;  5LKX A;  3I3J A;  4PS5 A;  2R0S A;  4QSX A;  4HXM A;  2OO1 A;  4E96 A;  1JSP B;  4CLB A;  4CL9 A;  4N3W A;  5D3L A;  4QSP A;  5I89 A;  4A9E A;  5F62 A;  5JWM A;  5ENB A;  5E9M A;  4O7F A;  5CFW A;  5D3S A;  4NRA A;  5AME A;  2R0Y A;  2YW5 A;  5FE7 A;  3QZS A;  4LR6 A;  4UYH A;  5F5Z A;  5CUA A;  5FFW A;  2E3K A;  4GPJ A;  4O74 A;  5CUC A;  2R10 A;  4QR3 A;  2RNW A;  4NUE A;  4QC3 A;  4YYN A;  4UIT A;  4XY8 A;  3U5M A;  5LKT A;  4YY4 A;  5LKU A;  4ZW1 A;  4O75 A;  5BT5 A;  4NR6 A;  4N4I A;  4NYW A;  5E9V A;  1WUM A;  4UIX A;  3S91 A;  5DFD A;  5CQ8 A;  2DVQ A;  5E0R A;  4UYD A;  5D3R A;  1JM4 B;  5HJC A;  5KTW A;  3P1F A;  3P1D A;  3G0L A;  4NR7 A;  5L98 A;  3U5L A;  4QB3 A;  5EIS A;  5LKZ A;  5I40 A;  4HBW A;  5FG6 A;  3O36 A;  4IR3 A;  4HXL A;  4TQN A;  4O77 A;  4HXK A;  5D24 A;  5LJ0 A;  4HBV A;  5HFQ A;  2OSS A;  5II1 A;  4QBM A;  4QSS A;  3DWY A;  5FE8 A;  4NR5 A;  4A9F A;  5EPS A;  5KTX A;  5A83 A;  4J3I A;  2DVV A;  4LZR A;  5G4S A;  3O37 A;  4YYI A;  2YEL A;  5CGP A;  3LXJ A;  5EV9 A;  4Z1Q A;  4UYE A;  4Q0O A;  5CUG A;  4IOR A;  5CQT A;  3MB4 A;  4QY4 A;  4CUU A;  4CUT A;  4A9H A;  4Z1S A;  3U5J A;  5CQ5 A;  5HRV A;  5G4R A;  5LUU A;  2RS9 B;  5DKC A;  3K2J A;  5E74 A;  5EP7 A;  4BW1 A;  5F36 A;  4YAB A;  4YYD A;  5HEL A;  5CU8 A;  4XYA A;  5I86 A;  5A5R A;  5C4Q A;  5EA1 A;  5L99 A;  4OUF A;  5EK9 A;  4BW2 A;  5A5O A;  5DKD A;  4TZ2 A;  4C66 A;  5CQ3 A;  4QR4 A;  3G0J A;  4MR5 A;  4UIU A;  4Z6H A;  5CUB A;  2G4A A;  4UIZ A;  4NUC A;  5EPR A;  4O78 A;  4O7C A;  5CUE A;  4TS8 A;  2RFJ A;  3HMF A;  4O76 A;  5HQ7 A;  5FH8 A;  5C8G A;  2L84 A;  2YEM A;  4PKL A;  5FG4 A;  5CP5 A;  5HFR A;  4IR6 A;  4QSR A;  4YBT A;  5AD3 A;  5C87 A;  4NQM A;  1WUG A;  5IGN A;  3ONI A;  4A9J A;  3MQM A;  5I7Y A;  2DWW A;  4TU4 A;  5HRW A;  4J0R A;  4QZS A;  4NYV A;  4KV1 A;  5KTU A;  3U5O A;  2YYN A;  4UYG A;  5ENF A;  4TT6 A;  3LQJ A;  4MR3 A;  5D3H A;  2RO1 A;  4HXO A;  4LYW A;  3FKM X;  5E73 A;  5ENH A;  4XY9 A;  2E7N A;  4NXJ A;  4O7A A;  5I7X A;  5HCL A;  5EWC A;  5FE6 A;  3MB3 A;  3U5K A;  5D0C A;  4YH4 A;  3SVG A;  4DON A;  5ENG A;  5DLX A;  2I7K A;  5A5P A;  5H1U A;  5DLZ A;  2H60 A;  5LVR A;  4YYG A;  3U5P A;  5IGM A;  3O33 A;  4NQN A;  2F6N A;  5EPB A;  5I83 A;  3QZV A;  4CUP A;  5DFB A;  4A9O A;  4CFL A;  4ALG A;  4BJX A;  3AAD A;  4N4F A;  5FE9 A;  2N9G A;  5EU1 A;  4QSV A;  4OGJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...