5E7DA

Crystal structure of the fifth bromodomain of human pb1 in complex with a hydroxyphenyl ligand
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
111
structure length
111
Chain Sequence
KYMTPMQQKLNEVYEAVKNYTDKRGRRLSAIFLRLPSRSELPDYYLTIKKPMDMEKIRSHMMANKYQDIDSMVEDFVMMFNNACTYNEPESLIYKDALVLHKVLLETRRDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Protein polybromo-1
publication title Crystal Structure of the fifth bromodomain of human PB1 in complex with a hydroxyphenyl ligand
rcsb
source organism Homo sapiens
total genus 35
structure length 111
sequence length 111
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5e7dA00
4O7AA 1WUMA 4YYHA 5DW1A 4A9HA 5FDZA 4AKNA 3MUKA 5EPSA 4MR3A 5DYCA 3O35A 4NS5A 4HXKA 5D3JA 5F62A 5L98A 4IOQA 5D3SA 4TU4A 5LJ1A 5FG4A 5J0DA 4XY8A 5DX4A 3U5LA 5A5OA 5A5NA 4IORA 4LDFA 5D7XA 5EVAA 4QY4A 5HQ7A 3UW9A 5FH8A 4LYSA 4TZ8A 2DVVA 3IU5A 5G4SA 4C67A 5E3DA 4O71A 3I3JA 2RNYA 5ENIA 5EWDA 3ZYUA 4X2IA 4TTEA 3LQIA 4N4FA 5LVQA 5I80A 4YY6A 3JVLA 5FE1A 3K2JA 5FE9A 4QC1A 4A9IA 4MEQA 2YW5A 4J0SA 5FE0A 5AMEA 5EA1A 3Q2FA 3HMHA 4IR4A 4QBMA 4GPJA 5L97A 5DFBA 5I29A 3HMFA 4TQNA 2DVRA 5K29A 4HXNA 4F3IA 3UV2A 5E0RA 5CQ8A 5CQTA 3QZSA 4QYDA 2E3KA 4PTBA 4CFLA 4TZ2A 5FG6A 4TT2A 5L8UA 4QEVA 5LKTA 5HLSA 5I7YA 4QR4A 3IU6A 2OO1A 5IG6A 4KV4A 4CL9A 4BW1A 4QZSA 4O72A 5DYAA 5DKHA 5F36A 5EPRA 5FE6A 5F63A 3SVFA 3JVKA 5IGKA 2DATA 4Q0OA 4UYFB 3MULA 5E9LA 4NR4A 4NR9A 4YADA 4Z1SA 4QSWA 4O74A 5F61A 3UV5A 4OGJA 5F1LA 5EQ1A 4YBMA 4UIVA 4CUTA 2N9GA 5L96A 3G0JA 4A9FA 4HBXA 4QSTA 5D25A 4HXMA 5CQ6A 5EI4A 5H1TA 5C89A 4XUAA 4QSRA 4A9LA 5FFVA 4QUUA 4LRGA 5D3RA 4O7CA 4BW4A 4HBWA 2YQDA 5ETDA 3P1DA 5G4RA 4DONA 5EU1A 4YYIA 4QB3A 5D3PA 5EM3A 5LUUA 4NRBA 4NRAA 4TT4A 4XY9A 4N4GA 5FBXA 2G4AA 5I89A 4O70A 5HFRA 3U5KA 3QZVA 5D24A 5EICA 5D0CA 4HBYA 2RFJA 2OSSA 5KTUA 1N72A 3GG3A 5EISA 5ACYA 4YH3A 3S91A 4QNSA 5F5ZA 2DKWA 5HEMA 5DBMA 5IGNA 3FKMX 4UIZA 5D3TA 5DFCA 3NXBA 4YYGA 5CUEA 4OUFA 5CS8A 4O76A 4FLPA 4A9JA 4YY4A 5EWWA 4LYIA 4A9EA 4O7BA 5E9IA 5CUCA 4NUEA 4MEPA 4XYAA 2YYNA 5KTXA 3SVGA 4TU6A 3QZTA 5CUBA 4NRCA 5CQ3A 4QR5A 4QEWA 3JVMA 4NR6A 2YELA 3UVXA 3O37A 5CZGA 5C87A 4N4IA 4CLBA 4NYVA 5F1HA 5I83A 4O75A 5DLXA 4YK0A 3P1EA 4UYHA 5A5RA 5FG5A 5DKDA 4Z6HA 3TLPA 4BW3A 5C8GA 4CURA 5KU3A 4YBTA 4HBVA 4ZC9A 4NUDA 5H1UA 5E9VA 5HRVA 5II1A 5I1QA 3U5JA 2R0VA 2FSAA 1JSPB 4HXRA 3UVDA 4ZQLA 5EK9A 5FE8A 4CUUA 5A5SA 5ENHA 5DLZA 5ENCA 2YDWA 4BJXA 3HMEA 4HXLA 5E74A 5I7XA 3DAIA 1WUGA 5JWMA 5ENGA 5FE5A 4ALHA 5C85A 3Q2EA 5EGUA 5CQAA 4YC9A 4CUPA 4YBSA 5FFWA 5FE4A 4NR8A 4UITA 4MR4A 4TS8A 5HFQA 5LJ0A 4C66A 5ENBA 4MENA 5DKCA 4YYNA 3UVYA 3LXJA 4NR5A 4PCIA 3D7CA 5E9MA 4UYDA 5E7DA 5A7CA 4YAXA 4NYXA 5D3LA 4QSUA 4J0RA 5BT5A 4NYWA 5HM0A 5A83A 5DYXA 3DWYA 5LVRA 5F25A 4LZ2A 3P1FA 4PKLA 5FE3A 4UIYA 5A5QA 4UIXA 5KO4A 5C7NA 5E73A 5LKXA 2L84A 3AADA 4O78A 5LKZA 5FB0A 4A9NA 5E3GA 5E9YA 5II2A 2R0YA 2YEMA 2RNXA 3LQJA 5CRMA 4UYGA 5E9KA 4IR6A 1E6IA 5A85A 5DFDA 4PS5A 5I86A 3MQMA 5IGMA 5CPEA 3S92A 3MB3A 5A82A 2WP1A 5CFWA 4A9KA 1EQFA 2DWWA 4PY6A 5CGPA 1ZS5A 5CQ4A 4YYJA 4J3IA 4Z93A 5HJCA 4QSXA 3UV4A 4O7EA 4WHWA 4O7FA 4UYFA 5ENEA 5BT4A 4Y03A 3JVJA 5A81A 5LKUA 4NQNA 5EWVA 2DVSA 5CY9A 4ALGA 4PCEA 5BT3A 4CUQA 4N3WA 4WHUA 5H1VA 4MR5A 2GRCA 5FE7A 3UVWA 4A9MA 5D3NA 4MEOA 4QSVA 4NXJA 5HQ5A 5EWCA 4HXPA 4CFKA 4KCXA 3O34A 5AD3A 4UIUA 5EV9A 3O33A 2L5EA 4BW2A 5JI8A 2RI7A 4LYWA 4QC3A 5DY7A 4KV1A 5HCLA 4TYLA 3U5NA 5HQ6A 5L8TA 4UYEA 4NQMA 2E7NA 4Z6IA 5D26A 3ONIA 5EPBA 4ZW1A 4BHWA 4TT6A 5CUDA 3O36A 4HXOA 2I8NA 3LJWA 5FB1A 2MJVB 2LSPB 4QEUA 5HRXA 4WIVA 4YYKA 4A9OA 4LC2A 4QSQA 5F60A 4MR6A 5TB6A 4NUCA 2H60A 3U5MA 4UIWA 4CUSA 5CUGA 5IGLA 1F68A 2R10A 2F6NA 2WP2A 4LZRA 4O77A 4RVRA 4OGIA 5CQ5A 5I88A 4QYLA 3SVHA 5HRWA 2E7OA 4YYDA 3AQAA 5I40A 4QR3A 2I7KA 2KTBB 5FH7A 1X0JA 5HENA 5COIA 5FH6A 5FE2A 3LQHA 4NR7A 2F6JA 5F2PA 2DVQA 2RNWA 5ENJA 4E96A 5IBNA 5L99A 4Z1QA 5ETBA 5CQ7A 2D82A 5DW2A 5HELA 4QUTA 5EWHA 5LJ2A 2D9EA 3G0LA 4QSSA 2YEKA 5CRZA 4N4HA 4HXSA 3P1CA 5AD2A 5EP7A 5A5PA 5FFYA 5CTLA 4YABA 4YYMA 2NXBA 3MB4A 5KHMA 3MXFA 3RCWA 5AMFA 2RO1A 4QSPA 2OUOA 3P5OA 5CP5A 3U5OA 4LZSA 5C4QA 5ENFA 5D3HA 5CU8A 4LR6A 4Q0NA 5F3AA 4J1PA 5H85A 2L85A 4IR3A 4IR5A 5TCMA 3U5PA 4IOOA 1JM4B 4YATA 2RS9B 5IIDA 5KTWA 2R0SA 5DYUA 5CUAA 4YH4A 4XUBA
chains in the Genus database with same CATH superfamily
4O7AA 1WUMA 4YYHA 5DW1A 4A9HA 5FDZA 4AKNA 3MUKA 5EPSA 4MR3A 5DYCA 3O35A 4NS5A 4HXKA 5D3JA 5F62A 5L98A 4IOQA 5D3SA 4TU4A 5LJ1A 4AKHA 5FG4A 5J0DA 4XY8A 5DX4A 3U5LA 5A5OA 5A5NA 4IORA 4LDFA 5D7XA 5EVAA 4QY4A 5HQ7A 3UW9A 5FH8A 4LYSA 4TZ8A 2DVVA 3IU5A 5G4SA 2EJNA 4C67A 5E3DA 4O71A 3I3JA 2RNYA 5ENIA 5EWDA 3ZYUA 4X2IA 4TTEA 3LQIA 4N4FA 5LVQA 5I80A 4YY6A 3JVLA 5FE1A 3K2JA 5FE9A 4QC1A 4A9IA 4MEQA 2YW5A 4J0SA 5FE0A 5AMEA 5EA1A 3Q2FA 3HMHA 4IR4A 4QBMA 4GPJA 5L97A 5DFBA 5I29A 3HMFA 4TQNA 2DVRA 5K29A 4HXNA 4F3IA 3UV2A 5E0RA 5CQ8A 5CQTA 3QZSA 4QYDA 2E3KA 4PTBA 4CFLA 4TZ2A 5FG6A 4TT2A 5L8UA 4QEVA 5LKTA 5HLSA 5I7YA 4QR4A 3IU6A 2OO1A 5IG6A 4KV4A 4CL9A 3D1DA 4BW1A 4QZSA 4O72A 5DYAA 5DKHA 5F36A 5EPRA 5FE6A 5F63A 3SVFA 3JVKA 5IGKA 2DATA 4Q0OA 4UYFB 3MULA 5E9LA 4NR4A 4NR9A 4YADA 4Z1SA 4QSWA 4O74A 5F61A 3UV5A 4OGJA 5F1LA 5EQ1A 4YBMA 4UIVA 4CUTA 2N9GA 5L96A 3G0JA 4A9FA 4HBXA 4QSTA 5D25A 4HXMA 5CQ6A 5EI4A 5H1TA 5C89A 4XUAA 3VKHA 4QSRA 4A9LA 5FFVA 4QUUA 4LRGA 3D1BA 5D3RA 4O7CA 4BW4A 4HBWA 2YQDA 5ETDA 3P1DA 5G4RA 4DONA 5EU1A 4YYIA 4QB3A 5D3PA 5EM3A 5LUUA 4NRBA 4NRAA 4TT4A 4XY9A 4N4GA 5FBXA 2G4AA 5I89A 4O70A 5HFRA 3U5KA 3QZVA 5D24A 5EICA 5D0CA 4HBYA 2RFJA 2OSSA 5KTUA 1N72A 3GG3A 5EISA 5ACYA 4YH3A 3S91A 4QNSA 5F5ZA 2DKWA 5HEMA 5DBMA 5IGNA 3FKMX 4UIZA 5D3TA 5DFCA 3NXBA 4YYGA 5CUEA 4OUFA 5CS8A 4O76A 4FLPA 4A9JA 4YY4A 5EWWA 4LYIA 4A9EA 4O7BA 5E9IA 5CUCA 4NUEA 4MEPA 4XYAA 2YYNA 5KTXA 3SVGA 4TU6A 3QZTA 5CUBA 1ZKRA 4NRCA 5CQ3A 4QR5A 4QEWA 3JVMA 4NR6A 2YELA 3UVXA 3O37A 5CZGA 5C87A 4N4IA 4CLBA 4NYVA 5F1HA 5I83A 4O75A 5DLXA 4YK0A 3P1EA 4UYHA 5A5RA 4AI6A 5FG5A 5DKDA 4Z6HA 3TLPA 4BW3A 5C8GA 4CURA 5KU3A 4YBTA 4HBVA 4ZC9A 4NUDA 5H1UA 5E9VA 5HRVA 5II1A 5I1QA 3U5JA 2R0VA 2FSAA 1JSPB 4HXRA 3UVDA 4ZQLA 5EK9A 5FE8A 4CUUA 5A5SA 5ENHA 5DLZA 5ENCA 2YDWA 4BJXA 3HMEA 4HXLA 5E74A 5I7XA 3DAIA 1WUGA 5JWMA 5ENGA 5FE5A 4ALHA 5C85A 3Q2EA 5EGUA 5CQAA 4YC9A 4CUPA 4YBSA 5FFWA 5FE4A 4NR8A 4UITA 4MR4A 4TS8A 5HFQA 5LJ0A 4C66A 5ENBA 4MENA 5DKCA 4YYNA 3UVYA 3LXJA 4NR5A 4PCIA 3D7CA 5E9MA 4UYDA 5E7DA 5A7CA 4YAXA 4NYXA 5D3LA 4QSUA 4J0RA 5BT5A 4NYWA 5HM0A 5A83A 5DYXA 3DWYA 5LVRA 5F25A 4LZ2A 3P1FA 4PKLA 5FE3A 4UIYA 5A5QA 4UIXA 5KO4A 5C7NA 5E73A 5LKXA 2L84A 3AADA 4O78A 4AKIA 5LKZA 5FB0A 4A9NA 5E3GA 5E9YA 5II2A 2R0YA 2YEMA 2RNXA 3LQJA 5CRMA 4UYGA 5E9KA 4IR6A 1E6IA 5A85A 5DFDA 4PS5A 5I86A 3MQMA 5IGMA 5CPEA 3S92A 3MB3A 5A82A 2WP1A 5CFWA 4A9KA 1EQFA 2DWWA 4PY6A 5CGPA 1ZS5A 5CQ4A 4YYJA 4J3IA 4Z93A 5HJCA 4QSXA 3UV4A 4O7EA 4WHWA 4O7FA 4UYFA 5ENEA 5BT4A 4Y03A 3JVJA 5A81A 5LKUA 4NQNA 5EWVA 2DVSA 5CY9A 4ALGA 4PCEA 5BT3A 4CUQA 4N3WA 4WHUA 5H1VA 4MR5A 2GRCA 5FE7A 3UVWA 4A9MA 5D3NA 4MEOA 4QSVA 4NXJA 5HQ5A 5EWCA 4HXPA 4CFKA 4KCXA 3VKGA 3O34A 5AD3A 4UIUA 5EV9A 3O33A 2L5EA 4BW2A 5JI8A 2RI7A 4LYWA 4QC3A 5DY7A 4KV1A 5HCLA 4TYLA 3U5NA 5HQ6A 5L8TA 4UYEA 4NQMA 2E7NA 4Z6IA 5D26A 3ONIA 5EPBA 4ZW1A 4BHWA 4TT6A 5CUDA 3O36A 4HXOA 2I8NA 3LJWA 5FB1A 2MJVB 2LSPB 4QEUA 5HRXA 4WIVA 4YYKA 4AKGA 4A9OA 4LC2A 4QSQA 5F60A 4MR6A 5TB6A 4NUCA 2H60A 3U5MA 3ERRA 4UIWA 4CUSA 5CUGA 5IGLA 1F68A 2R10A 2F6NA 2WP2A 4LZRA 4O77A 4RVRA 4OGIA 5CQ5A 5I88A 4QYLA 3SVHA 5HRWA 2E7OA 4YYDA 3AQAA 5I40A 4QR3A 2I7KA 2KTBB 5FH7A 1X0JA 5HENA 5COIA 5FH6A 5FE2A 3LQHA 4NR7A 2F6JA 5F2PA 2DVQA 2RNWA 5ENJA 4E96A 5IBNA 5L99A 4Z1QA 5ETBA 5CQ7A 2D82A 5DW2A 5HELA 4QUTA 5EWHA 5LJ2A 2D9EA 3G0LA 4QSSA 2YEKA 1PUOA 5CRZA 4N4HA 4HXSA 3P1CA 5AD2A 5EP7A 5A5PA 5FFYA 5CTLA 4YABA 4YYMA 2NXBA 3MB4A 5KHMA 3MXFA 3RCWA 5AMFA 2RO1A 4QSPA 2OUOA 3P5OA 5CP5A 3U5OA 4LZSA 5C4QA 5ENFA 5D3HA 5CU8A 4LR6A 4Q0NA 5F3AA 4J1PA 5H85A 2L85A 4IR3A 4IR5A 5TCMA 3U5PA 4IOOA 1JM4B 4YATA 2RS9B 5IIDA 5KTWA 2R0SA 5DYUA 5CUAA 4YH4A 4XUBA
chains in the Genus database with same CATH topology
4O7AA 1WUMA 4YYHA 5DW1A 4A9HA 5FDZA 4AKNA 3MUKA 5EPSA 4MR3A 5DYCA 3O35A 4NS5A 4HXKA 5D3JA 5F62A 5L98A 4IOQA 5D3SA 4TU4A 5LJ1A 5FG4A 5J0DA 4XY8A 5DX4A 3U5LA 5A5OA 5A5NA 4IORA 4LDFA 5D7XA 5EVAA 4QY4A 5HQ7A 3UW9A 5FH8A 4LYSA 4TZ8A 2DVVA 3IU5A 5G4SA 4C67A 5E3DA 4O71A 3I3JA 2RNYA 5ENIA 5EWDA 3ZYUA 4X2IA 4TTEA 3LQIA 4N4FA 5LVQA 5I80A 4YY6A 3JVLA 5FE1A 3K2JA 5FE9A 4QC1A 4A9IA 4MEQA 2YW5A 4J0SA 5FE0A 5AMEA 5EA1A 3Q2FA 3HMHA 4IR4A 4QBMA 4GPJA 5L97A 5DFBA 5I29A 3HMFA 4TQNA 2DVRA 5K29A 4HXNA 4F3IA 3UV2A 5E0RA 5CQ8A 5CQTA 3QZSA 4QYDA 2E3KA 4PTBA 4CFLA 4TZ2A 5FG6A 4TT2A 5L8UA 4QEVA 5LKTA 5HLSA 5I7YA 4QR4A 3IU6A 2OO1A 5IG6A 4KV4A 4CL9A 4BW1A 4QZSA 4O72A 5DYAA 5DKHA 5F36A 5EPRA 5FE6A 5F63A 3SVFA 3JVKA 5IGKA 2DATA 4Q0OA 4UYFB 3MULA 5E9LA 4NR4A 4NR9A 4YADA 4Z1SA 4QSWA 4O74A 5F61A 3UV5A 4OGJA 5F1LA 5EQ1A 4YBMA 4UIVA 4CUTA 2N9GA 5L96A 3G0JA 4A9FA 4HBXA 4QSTA 5D25A 4HXMA 5CQ6A 5EI4A 5H1TA 5C89A 4XUAA 4QSRA 4A9LA 5FFVA 4QUUA 4LRGA 5D3RA 4O7CA 4BW4A 4HBWA 2YQDA 5ETDA 3P1DA 5G4RA 4DONA 5EU1A 4YYIA 4QB3A 5D3PA 5EM3A 5LUUA 4NRBA 4NRAA 4TT4A 4XY9A 4N4GA 5FBXA 2G4AA 5I89A 4O70A 5HFRA 3U5KA 3QZVA 5D24A 5EICA 5D0CA 4HBYA 2RFJA 2OSSA 5KTUA 1N72A 3GG3A 5EISA 5ACYA 4YH3A 3S91A 4QNSA 5F5ZA 2DKWA 5HEMA 5DBMA 5IGNA 3FKMX 4UIZA 5D3TA 5DFCA 3NXBA 4YYGA 5CUEA 4OUFA 5CS8A 4O76A 4FLPA 4A9JA 4YY4A 5EWWA 4LYIA 4A9EA 4O7BA 5E9IA 5CUCA 4NUEA 4MEPA 4XYAA 2YYNA 5KTXA 3SVGA 4TU6A 3QZTA 5CUBA 4NRCA 5CQ3A 4QR5A 4QEWA 3JVMA 4NR6A 2YELA 3UVXA 3O37A 5CZGA 5C87A 4N4IA 4CLBA 4NYVA 5F1HA 5I83A 4O75A 5DLXA 4YK0A 3P1EA 4UYHA 5A5RA 5FG5A 5DKDA 4Z6HA 3TLPA 4BW3A 5C8GA 4CURA 5KU3A 4YBTA 4HBVA 4ZC9A 4NUDA 5H1UA 5E9VA 5HRVA 5II1A 5I1QA 3U5JA 2R0VA 2FSAA 1JSPB 4HXRA 3UVDA 4ZQLA 5EK9A 5FE8A 4CUUA 5A5SA 5ENHA 5DLZA 5ENCA 2YDWA 4BJXA 3HMEA 4HXLA 5E74A 5I7XA 3DAIA 1WUGA 5JWMA 5ENGA 5FE5A 4ALHA 5C85A 3Q2EA 5EGUA 5CQAA 4YC9A 4CUPA 4YBSA 5FFWA 5FE4A 4NR8A 4UITA 4MR4A 4TS8A 5HFQA 5LJ0A 4C66A 5ENBA 4MENA 5DKCA 4YYNA 3UVYA 3LXJA 4NR5A 4PCIA 3D7CA 5E9MA 4UYDA 5E7DA 5A7CA 4YAXA 4NYXA 5D3LA 4QSUA 4J0RA 5BT5A 4NYWA 5HM0A 5A83A 5DYXA 3DWYA 5LVRA 5F25A 4LZ2A 3P1FA 4PKLA 5FE3A 4UIYA 5A5QA 4UIXA 5KO4A 5C7NA 5E73A 5LKXA 2L84A 3AADA 4O78A 5LKZA 5FB0A 4A9NA 5E3GA 5E9YA 5II2A 2R0YA 2YEMA 2RNXA 3LQJA 5CRMA 4UYGA 5E9KA 4IR6A 1E6IA 5A85A 5DFDA 4PS5A 5I86A 3MQMA 5IGMA 5CPEA 3S92A 3MB3A 5A82A 2WP1A 5CFWA 4A9KA 1EQFA 2DWWA 4PY6A 5CGPA 1ZS5A 5CQ4A 4YYJA 4J3IA 4Z93A 5HJCA 4QSXA 3UV4A 4O7EA 4WHWA 4O7FA 4UYFA 5ENEA 5BT4A 4Y03A 3JVJA 5A81A 5LKUA 4NQNA 5EWVA 2DVSA 5CY9A 4ALGA 4PCEA 5BT3A 4CUQA 4N3WA 4WHUA 5H1VA 4MR5A 2GRCA 5FE7A 3UVWA 4A9MA 5D3NA 4MEOA 4QSVA 4NXJA 5HQ5A 5EWCA 4HXPA 4CFKA 4KCXA 3O34A 5AD3A 4UIUA 5EV9A 3O33A 2L5EA 4BW2A 5JI8A 2RI7A 4LYWA 4QC3A 5DY7A 4KV1A 5HCLA 4TYLA 3U5NA 5HQ6A 5L8TA 4UYEA 4NQMA 2E7NA 4Z6IA 5D26A 3ONIA 5EPBA 4ZW1A 4BHWA 4TT6A 5CUDA 3O36A 4HXOA 2I8NA 3LJWA 5FB1A 2MJVB 2LSPB 4QEUA 5HRXA 4WIVA 4YYKA 4A9OA 4LC2A 4QSQA 5F60A 4MR6A 5TB6A 4NUCA 2H60A 3U5MA 4UIWA 4CUSA 5CUGA 5IGLA 1F68A 2R10A 2F6NA 2WP2A 4LZRA 4O77A 4RVRA 4OGIA 5CQ5A 5I88A 4QYLA 3SVHA 5HRWA 2E7OA 4YYDA 3AQAA 5I40A 4QR3A 2I7KA 2KTBB 5FH7A 1X0JA 5HENA 5COIA 5FH6A 5FE2A 3LQHA 4NR7A 2F6JA 5F2PA 2DVQA 2RNWA 5ENJA 4E96A 5IBNA 5L99A 4Z1QA 5ETBA 5CQ7A 2D82A 5DW2A 5HELA 4QUTA 5EWHA 5LJ2A 2D9EA 3G0LA 4QSSA 2YEKA 5CRZA 4N4HA 4HXSA 3P1CA 5AD2A 5EP7A 5A5PA 5FFYA 5CTLA 4YABA 4YYMA 2NXBA 3MB4A 5KHMA 3MXFA 3RCWA 5AMFA 2RO1A 4QSPA 2OUOA 3P5OA 5CP5A 3U5OA 4LZSA 5C4QA 5ENFA 5D3HA 5CU8A 4LR6A 4Q0NA 5F3AA 4J1PA 5H85A 2L85A 4IR3A 4IR5A 5TCMA 3U5PA 4IOOA 1JM4B 4YATA 2RS9B 5IIDA 5KTWA 2R0SA 5DYUA 5CUAA 4YH4A 4XUBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O7A A;  1WUM A;  4YYH A;  5DW1 A;  4A9H A;  5FDZ A;  4AKN A;  3MUK A;  5EPS A;  4MR3 A;  5DYC A;  3O35 A;  4NS5 A;  4HXK A;  5D3J A;  5F62 A;  5L98 A;  4IOQ A;  5D3S A;  4TU4 A;  5LJ1 A;  5FG4 A;  5J0D A;  4XY8 A;  5DX4 A;  3U5L A;  5A5O A;  5A5N A;  4IOR A;  4LDF A;  5D7X A;  5EVA A;  4QY4 A;  5HQ7 A;  3UW9 A;  5FH8 A;  4LYS A;  4TZ8 A;  2DVV A;  3IU5 A;  5G4S A;  4C67 A;  5E3D A;  4O71 A;  3I3J A;  2RNY A;  5ENI A;  5EWD A;  3ZYU A;  4X2I A;  4TTE A;  3LQI A;  4N4F A;  5LVQ A;  5I80 A;  4YY6 A;  3JVL A;  5FE1 A;  3K2J A;  5FE9 A;  4QC1 A;  4A9I A;  4MEQ A;  2YW5 A;  4J0S A;  5FE0 A;  5AME A;  5EA1 A;  3Q2F A;  3HMH A;  4IR4 A;  4QBM A;  4GPJ A;  5L97 A;  5DFB A;  5I29 A;  3HMF A;  4TQN A;  2DVR A;  5K29 A;  4HXN A;  4F3I A;  3UV2 A;  5E0R A;  5CQ8 A;  5CQT A;  3QZS A;  4QYD A;  2E3K A;  4PTB A;  4CFL A;  4TZ2 A;  5FG6 A;  4TT2 A;  5L8U A;  4QEV A;  5LKT A;  5HLS A;  5I7Y A;  4QR4 A;  3IU6 A;  2OO1 A;  5IG6 A;  4KV4 A;  4CL9 A;  4BW1 A;  4QZS A;  4O72 A;  5DYA A;  5DKH A;  5F36 A;  5EPR A;  5FE6 A;  5F63 A;  3SVF A;  3JVK A;  5IGK A;  2DAT A;  4Q0O A;  4UYF B;  3MUL A;  5E9L A;  4NR4 A;  4NR9 A;  4YAD A;  4Z1S A;  4QSW A;  4O74 A;  5F61 A;  3UV5 A;  4OGJ A;  5F1L A;  5EQ1 A;  4YBM A;  4UIV A;  4CUT A;  2N9G A;  5L96 A;  3G0J A;  4A9F A;  4HBX A;  4QST A;  5D25 A;  4HXM A;  5CQ6 A;  5EI4 A;  5H1T A;  5C89 A;  4XUA A;  4QSR A;  4A9L A;  5FFV A;  4QUU A;  4LRG A;  5D3R A;  4O7C A;  4BW4 A;  4HBW A;  2YQD A;  5ETD A;  3P1D A;  5G4R A;  4DON A;  5EU1 A;  4YYI A;  4QB3 A;  5D3P A;  5EM3 A;  5LUU A;  4NRB A;  4NRA A;  4TT4 A;  4XY9 A;  4N4G A;  5FBX A;  2G4A A;  5I89 A;  4O70 A;  5HFR A;  3U5K A;  3QZV A;  5D24 A;  5EIC A;  5D0C A;  4HBY A;  2RFJ A;  2OSS A;  5KTU A;  1N72 A;  3GG3 A;  5EIS A;  5ACY A;  4YH3 A;  3S91 A;  4QNS A;  5F5Z A;  2DKW A;  5HEM A;  5DBM A;  5IGN A;  3FKM X;  4UIZ A;  5D3T A;  5DFC A;  3NXB A;  4YYG A;  5CUE A;  4OUF A;  5CS8 A;  4O76 A;  4FLP A;  4A9J A;  4YY4 A;  5EWW A;  4LYI A;  4A9E A;  4O7B A;  5E9I A;  5CUC A;  4NUE A;  4MEP A;  4XYA A;  2YYN A;  5KTX A;  3SVG A;  4TU6 A;  3QZT A;  5CUB A;  4NRC A;  5CQ3 A;  4QR5 A;  4QEW A;  3JVM A;  4NR6 A;  2YEL A;  3UVX A;  3O37 A;  5CZG A;  5C87 A;  4N4I A;  4CLB A;  4NYV A;  5F1H A;  5I83 A;  4O75 A;  5DLX A;  4YK0 A;  3P1E A;  4UYH A;  5A5R A;  5FG5 A;  5DKD A;  4Z6H A;  3TLP A;  4BW3 A;  5C8G A;  4CUR A;  5KU3 A;  4YBT A;  4HBV A;  4ZC9 A;  4NUD A;  5H1U A;  5E9V A;  5HRV A;  5II1 A;  5I1Q A;  3U5J A;  2R0V A;  2FSA A;  1JSP B;  4HXR A;  3UVD A;  4ZQL A;  5EK9 A;  5FE8 A;  4CUU A;  5A5S A;  5ENH A;  5DLZ A;  5ENC A;  2YDW A;  4BJX A;  3HME A;  4HXL A;  5E74 A;  5I7X A;  3DAI A;  1WUG A;  5JWM A;  5ENG A;  5FE5 A;  4ALH A;  5C85 A;  3Q2E A;  5EGU A;  5CQA A;  4YC9 A;  4CUP A;  4YBS A;  5FFW A;  5FE4 A;  4NR8 A;  4UIT A;  4MR4 A;  4TS8 A;  5HFQ A;  5LJ0 A;  4C66 A;  5ENB A;  4MEN A;  5DKC A;  4YYN A;  3UVY A;  3LXJ A;  4NR5 A;  4PCI A;  3D7C A;  5E9M A;  4UYD A;  5E7D A;  5A7C A;  4YAX A;  4NYX A;  5D3L A;  4QSU A;  4J0R A;  5BT5 A;  4NYW A;  5HM0 A;  5A83 A;  5DYX A;  3DWY A;  5LVR A;  5F25 A;  4LZ2 A;  3P1F A;  4PKL A;  5FE3 A;  4UIY A;  5A5Q A;  4UIX A;  5KO4 A;  5C7N A;  5E73 A;  5LKX A;  2L84 A;  3AAD A;  4O78 A;  5LKZ A;  5FB0 A;  4A9N A;  5E3G A;  5E9Y A;  5II2 A;  2R0Y A;  2YEM A;  2RNX A;  3LQJ A;  5CRM A;  4UYG A;  5E9K A;  4IR6 A;  1E6I A;  5A85 A;  5DFD A;  4PS5 A;  5I86 A;  3MQM A;  5IGM A;  5CPE A;  3S92 A;  3MB3 A;  5A82 A;  2WP1 A;  5CFW A;  4A9K A;  1EQF A;  2DWW A;  4PY6 A;  5CGP A;  1ZS5 A;  5CQ4 A;  4YYJ A;  4J3I A;  4Z93 A;  5HJC A;  4QSX A;  3UV4 A;  4O7E A;  4WHW A;  4O7F A;  4UYF A;  5ENE A;  5BT4 A;  4Y03 A;  3JVJ A;  5A81 A;  5LKU A;  4NQN A;  5EWV A;  2DVS A;  5CY9 A;  4ALG A;  4PCE A;  5BT3 A;  4CUQ A;  4N3W A;  4WHU A;  5H1V A;  4MR5 A;  2GRC A;  5FE7 A;  3UVW A;  4A9M A;  5D3N A;  4MEO A;  4QSV A;  4NXJ A;  5HQ5 A;  5EWC A;  4HXP A;  4CFK A;  4KCX A;  3O34 A;  5AD3 A;  4UIU A;  5EV9 A;  3O33 A;  2L5E A;  4BW2 A;  5JI8 A;  2RI7 A;  4LYW A;  4QC3 A;  5DY7 A;  4KV1 A;  5HCL A;  4TYL A;  3U5N A;  5HQ6 A;  5L8T A;  4UYE A;  4NQM A;  2E7N A;  4Z6I A;  5D26 A;  3ONI A;  5EPB A;  4ZW1 A;  4BHW A;  4TT6 A;  5CUD A;  3O36 A;  4HXO A;  2I8N A;  3LJW A;  5FB1 A;  2MJV B;  2LSP B;  4QEU A;  5HRX A;  4WIV A;  4YYK A;  4A9O A;  4LC2 A;  4QSQ A;  5F60 A;  4MR6 A;  5TB6 A;  4NUC A;  2H60 A;  3U5M A;  4UIW A;  4CUS A;  5CUG A;  5IGL A;  1F68 A;  2R10 A;  2F6N A;  2WP2 A;  4LZR A;  4O77 A;  4RVR A;  4OGI A;  5CQ5 A;  5I88 A;  4QYL A;  3SVH A;  5HRW A;  2E7O A;  4YYD A;  3AQA A;  5I40 A;  4QR3 A;  2I7K A;  2KTB B;  5FH7 A;  1X0J A;  5HEN A;  5COI A;  5FH6 A;  5FE2 A;  3LQH A;  4NR7 A;  2F6J A;  5F2P A;  2DVQ A;  2RNW A;  5ENJ A;  4E96 A;  5IBN A;  5L99 A;  4Z1Q A;  5ETB A;  5CQ7 A;  2D82 A;  5DW2 A;  5HEL A;  4QUT A;  5EWH A;  5LJ2 A;  2D9E A;  3G0L A;  4QSS A;  2YEK A;  5CRZ A;  4N4H A;  4HXS A;  3P1C A;  5AD2 A;  5EP7 A;  5A5P A;  5FFY A;  5CTL A;  4YAB A;  4YYM A;  2NXB A;  3MB4 A;  5KHM A;  3MXF A;  3RCW A;  5AMF A;  2RO1 A;  4QSP A;  2OUO A;  3P5O A;  5CP5 A;  3U5O A;  4LZS A;  5C4Q A;  5ENF A;  5D3H A;  5CU8 A;  4LR6 A;  4Q0N A;  5F3A A;  4J1P A;  5H85 A;  2L85 A;  4IR3 A;  4IR5 A;  5TCM A;  3U5P A;  4IOO A;  1JM4 B;  4YAT A;  2RS9 B;  5IID A;  5KTW A;  2R0S A;  5DYU A;  5CUA A;  4YH4 A;  4XUB A; 
#chains in the Genus database with same CATH topology
 4O7A A;  1WUM A;  4YYH A;  5DW1 A;  4A9H A;  5FDZ A;  4AKN A;  3MUK A;  5EPS A;  4MR3 A;  5DYC A;  3O35 A;  4NS5 A;  4HXK A;  5D3J A;  5F62 A;  5L98 A;  4IOQ A;  5D3S A;  4TU4 A;  5LJ1 A;  4AKH A;  5FG4 A;  5J0D A;  4XY8 A;  5DX4 A;  3U5L A;  5A5O A;  5A5N A;  4IOR A;  4LDF A;  5D7X A;  5EVA A;  4QY4 A;  5HQ7 A;  3UW9 A;  5FH8 A;  4LYS A;  4TZ8 A;  2DVV A;  3IU5 A;  5G4S A;  2EJN A;  4C67 A;  5E3D A;  4O71 A;  3I3J A;  2RNY A;  5ENI A;  5EWD A;  3ZYU A;  4X2I A;  4TTE A;  3LQI A;  4N4F A;  5LVQ A;  5I80 A;  4YY6 A;  3JVL A;  5FE1 A;  3K2J A;  5FE9 A;  4QC1 A;  4A9I A;  4MEQ A;  2YW5 A;  4J0S A;  5FE0 A;  5AME A;  5EA1 A;  3Q2F A;  3HMH A;  4IR4 A;  4QBM A;  4GPJ A;  5L97 A;  5DFB A;  5I29 A;  3HMF A;  4TQN A;  2DVR A;  5K29 A;  4HXN A;  4F3I A;  3UV2 A;  5E0R A;  5CQ8 A;  5CQT A;  3QZS A;  4QYD A;  2E3K A;  4PTB A;  4CFL A;  4TZ2 A;  5FG6 A;  4TT2 A;  5L8U A;  4QEV A;  5LKT A;  5HLS A;  5I7Y A;  4QR4 A;  3IU6 A;  2OO1 A;  5IG6 A;  4KV4 A;  4CL9 A;  3D1D A;  4BW1 A;  4QZS A;  4O72 A;  5DYA A;  5DKH A;  5F36 A;  5EPR A;  5FE6 A;  5F63 A;  3SVF A;  3JVK A;  5IGK A;  2DAT A;  4Q0O A;  4UYF B;  3MUL A;  5E9L A;  4NR4 A;  4NR9 A;  4YAD A;  4Z1S A;  4QSW A;  4O74 A;  5F61 A;  3UV5 A;  4OGJ A;  5F1L A;  5EQ1 A;  4YBM A;  4UIV A;  4CUT A;  2N9G A;  5L96 A;  3G0J A;  4A9F A;  4HBX A;  4QST A;  5D25 A;  4HXM A;  5CQ6 A;  5EI4 A;  5H1T A;  5C89 A;  4XUA A;  3VKH A;  4QSR A;  4A9L A;  5FFV A;  4QUU A;  4LRG A;  3D1B A;  5D3R A;  4O7C A;  4BW4 A;  4HBW A;  2YQD A;  5ETD A;  3P1D A;  5G4R A;  4DON A;  5EU1 A;  4YYI A;  4QB3 A;  5D3P A;  5EM3 A;  5LUU A;  4NRB A;  4NRA A;  4TT4 A;  4XY9 A;  4N4G A;  5FBX A;  2G4A A;  5I89 A;  4O70 A;  5HFR A;  3U5K A;  3QZV A;  5D24 A;  5EIC A;  5D0C A;  4HBY A;  2RFJ A;  2OSS A;  5KTU A;  1N72 A;  3GG3 A;  5EIS A;  5ACY A;  4YH3 A;  3S91 A;  4QNS A;  5F5Z A;  2DKW A;  5HEM A;  5DBM A;  5IGN A;  3FKM X;  4UIZ A;  5D3T A;  5DFC A;  3NXB A;  4YYG A;  5CUE A;  4OUF A;  5CS8 A;  4O76 A;  4FLP A;  4A9J A;  4YY4 A;  5EWW A;  4LYI A;  4A9E A;  4O7B A;  5E9I A;  5CUC A;  4NUE A;  4MEP A;  4XYA A;  2YYN A;  5KTX A;  3SVG A;  4TU6 A;  3QZT A;  5CUB A;  1ZKR A;  4NRC A;  5CQ3 A;  4QR5 A;  4QEW A;  3JVM A;  4NR6 A;  2YEL A;  3UVX A;  3O37 A;  5CZG A;  5C87 A;  4N4I A;  4CLB A;  4NYV A;  5F1H A;  5I83 A;  4O75 A;  5DLX A;  4YK0 A;  3P1E A;  4UYH A;  5A5R A;  4AI6 A;  5FG5 A;  5DKD A;  4Z6H A;  3TLP A;  4BW3 A;  5C8G A;  4CUR A;  5KU3 A;  4YBT A;  4HBV A;  4ZC9 A;  4NUD A;  5H1U A;  5E9V A;  5HRV A;  5II1 A;  5I1Q A;  3U5J A;  2R0V A;  2FSA A;  1JSP B;  4HXR A;  3UVD A;  4ZQL A;  5EK9 A;  5FE8 A;  4CUU A;  5A5S A;  5ENH A;  5DLZ A;  5ENC A;  2YDW A;  4BJX A;  3HME A;  4HXL A;  5E74 A;  5I7X A;  3DAI A;  1WUG A;  5JWM A;  5ENG A;  5FE5 A;  4ALH A;  5C85 A;  3Q2E A;  5EGU A;  5CQA A;  4YC9 A;  4CUP A;  4YBS A;  5FFW A;  5FE4 A;  4NR8 A;  4UIT A;  4MR4 A;  4TS8 A;  5HFQ A;  5LJ0 A;  4C66 A;  5ENB A;  4MEN A;  5DKC A;  4YYN A;  3UVY A;  3LXJ A;  4NR5 A;  4PCI A;  3D7C A;  5E9M A;  4UYD A;  5E7D A;  5A7C A;  4YAX A;  4NYX A;  5D3L A;  4QSU A;  4J0R A;  5BT5 A;  4NYW A;  5HM0 A;  5A83 A;  5DYX A;  3DWY A;  5LVR A;  5F25 A;  4LZ2 A;  3P1F A;  4PKL A;  5FE3 A;  4UIY A;  5A5Q A;  4UIX A;  5KO4 A;  5C7N A;  5E73 A;  5LKX A;  2L84 A;  3AAD A;  4O78 A;  4AKI A;  5LKZ A;  5FB0 A;  4A9N A;  5E3G A;  5E9Y A;  5II2 A;  2R0Y A;  2YEM A;  2RNX A;  3LQJ A;  5CRM A;  4UYG A;  5E9K A;  4IR6 A;  1E6I A;  5A85 A;  5DFD A;  4PS5 A;  5I86 A;  3MQM A;  5IGM A;  5CPE A;  3S92 A;  3MB3 A;  5A82 A;  2WP1 A;  5CFW A;  4A9K A;  1EQF A;  2DWW A;  4PY6 A;  5CGP A;  1ZS5 A;  5CQ4 A;  4YYJ A;  4J3I A;  4Z93 A;  5HJC A;  4QSX A;  3UV4 A;  4O7E A;  4WHW A;  4O7F A;  4UYF A;  5ENE A;  5BT4 A;  4Y03 A;  3JVJ A;  5A81 A;  5LKU A;  4NQN A;  5EWV A;  2DVS A;  5CY9 A;  4ALG A;  4PCE A;  5BT3 A;  4CUQ A;  4N3W A;  4WHU A;  5H1V A;  4MR5 A;  2GRC A;  5FE7 A;  3UVW A;  4A9M A;  5D3N A;  4MEO A;  4QSV A;  4NXJ A;  5HQ5 A;  5EWC A;  4HXP A;  4CFK A;  4KCX A;  3VKG A;  3O34 A;  5AD3 A;  4UIU A;  5EV9 A;  3O33 A;  2L5E A;  4BW2 A;  5JI8 A;  2RI7 A;  4LYW A;  4QC3 A;  5DY7 A;  4KV1 A;  5HCL A;  4TYL A;  3U5N A;  5HQ6 A;  5L8T A;  4UYE A;  4NQM A;  2E7N A;  4Z6I A;  5D26 A;  3ONI A;  5EPB A;  4ZW1 A;  4BHW A;  4TT6 A;  5CUD A;  3O36 A;  4HXO A;  2I8N A;  3LJW A;  5FB1 A;  2MJV B;  2LSP B;  4QEU A;  5HRX A;  4WIV A;  4YYK A;  4AKG A;  4A9O A;  4LC2 A;  4QSQ A;  5F60 A;  4MR6 A;  5TB6 A;  4NUC A;  2H60 A;  3U5M A;  3ERR A;  4UIW A;  4CUS A;  5CUG A;  5IGL A;  1F68 A;  2R10 A;  2F6N A;  2WP2 A;  4LZR A;  4O77 A;  4RVR A;  4OGI A;  5CQ5 A;  5I88 A;  4QYL A;  3SVH A;  5HRW A;  2E7O A;  4YYD A;  3AQA A;  5I40 A;  4QR3 A;  2I7K A;  2KTB B;  5FH7 A;  1X0J A;  5HEN A;  5COI A;  5FH6 A;  5FE2 A;  3LQH A;  4NR7 A;  2F6J A;  5F2P A;  2DVQ A;  2RNW A;  5ENJ A;  4E96 A;  5IBN A;  5L99 A;  4Z1Q A;  5ETB A;  5CQ7 A;  2D82 A;  5DW2 A;  5HEL A;  4QUT A;  5EWH A;  5LJ2 A;  2D9E A;  3G0L A;  4QSS A;  2YEK A;  1PUO A;  5CRZ A;  4N4H A;  4HXS A;  3P1C A;  5AD2 A;  5EP7 A;  5A5P A;  5FFY A;  5CTL A;  4YAB A;  4YYM A;  2NXB A;  3MB4 A;  5KHM A;  3MXF A;  3RCW A;  5AMF A;  2RO1 A;  4QSP A;  2OUO A;  3P5O A;  5CP5 A;  3U5O A;  4LZS A;  5C4Q A;  5ENF A;  5D3H A;  5CU8 A;  4LR6 A;  4Q0N A;  5F3A A;  4J1P A;  5H85 A;  2L85 A;  4IR3 A;  4IR5 A;  5TCM A;  3U5P A;  4IOO A;  1JM4 B;  4YAT A;  2RS9 B;  5IID A;  5KTW A;  2R0S A;  5DYU A;  5CUA A;  4YH4 A;  4XUB A; 
#chains in the Genus database with same CATH homology
 4O7A A;  1WUM A;  4YYH A;  5DW1 A;  4A9H A;  5FDZ A;  4AKN A;  3MUK A;  5EPS A;  4MR3 A;  5DYC A;  3O35 A;  4NS5 A;  4HXK A;  5D3J A;  5F62 A;  5L98 A;  4IOQ A;  5D3S A;  4TU4 A;  5LJ1 A;  5FG4 A;  5J0D A;  4XY8 A;  5DX4 A;  3U5L A;  5A5O A;  5A5N A;  4IOR A;  4LDF A;  5D7X A;  5EVA A;  4QY4 A;  5HQ7 A;  3UW9 A;  5FH8 A;  4LYS A;  4TZ8 A;  2DVV A;  3IU5 A;  5G4S A;  4C67 A;  5E3D A;  4O71 A;  3I3J A;  2RNY A;  5ENI A;  5EWD A;  3ZYU A;  4X2I A;  4TTE A;  3LQI A;  4N4F A;  5LVQ A;  5I80 A;  4YY6 A;  3JVL A;  5FE1 A;  3K2J A;  5FE9 A;  4QC1 A;  4A9I A;  4MEQ A;  2YW5 A;  4J0S A;  5FE0 A;  5AME A;  5EA1 A;  3Q2F A;  3HMH A;  4IR4 A;  4QBM A;  4GPJ A;  5L97 A;  5DFB A;  5I29 A;  3HMF A;  4TQN A;  2DVR A;  5K29 A;  4HXN A;  4F3I A;  3UV2 A;  5E0R A;  5CQ8 A;  5CQT A;  3QZS A;  4QYD A;  2E3K A;  4PTB A;  4CFL A;  4TZ2 A;  5FG6 A;  4TT2 A;  5L8U A;  4QEV A;  5LKT A;  5HLS A;  5I7Y A;  4QR4 A;  3IU6 A;  2OO1 A;  5IG6 A;  4KV4 A;  4CL9 A;  4BW1 A;  4QZS A;  4O72 A;  5DYA A;  5DKH A;  5F36 A;  5EPR A;  5FE6 A;  5F63 A;  3SVF A;  3JVK A;  5IGK A;  2DAT A;  4Q0O A;  4UYF B;  3MUL A;  5E9L A;  4NR4 A;  4NR9 A;  4YAD A;  4Z1S A;  4QSW A;  4O74 A;  5F61 A;  3UV5 A;  4OGJ A;  5F1L A;  5EQ1 A;  4YBM A;  4UIV A;  4CUT A;  2N9G A;  5L96 A;  3G0J A;  4A9F A;  4HBX A;  4QST A;  5D25 A;  4HXM A;  5CQ6 A;  5EI4 A;  5H1T A;  5C89 A;  4XUA A;  4QSR A;  4A9L A;  5FFV A;  4QUU A;  4LRG A;  5D3R A;  4O7C A;  4BW4 A;  4HBW A;  2YQD A;  5ETD A;  3P1D A;  5G4R A;  4DON A;  5EU1 A;  4YYI A;  4QB3 A;  5D3P A;  5EM3 A;  5LUU A;  4NRB A;  4NRA A;  4TT4 A;  4XY9 A;  4N4G A;  5FBX A;  2G4A A;  5I89 A;  4O70 A;  5HFR A;  3U5K A;  3QZV A;  5D24 A;  5EIC A;  5D0C A;  4HBY A;  2RFJ A;  2OSS A;  5KTU A;  1N72 A;  3GG3 A;  5EIS A;  5ACY A;  4YH3 A;  3S91 A;  4QNS A;  5F5Z A;  2DKW A;  5HEM A;  5DBM A;  5IGN A;  3FKM X;  4UIZ A;  5D3T A;  5DFC A;  3NXB A;  4YYG A;  5CUE A;  4OUF A;  5CS8 A;  4O76 A;  4FLP A;  4A9J A;  4YY4 A;  5EWW A;  4LYI A;  4A9E A;  4O7B A;  5E9I A;  5CUC A;  4NUE A;  4MEP A;  4XYA A;  2YYN A;  5KTX A;  3SVG A;  4TU6 A;  3QZT A;  5CUB A;  4NRC A;  5CQ3 A;  4QR5 A;  4QEW A;  3JVM A;  4NR6 A;  2YEL A;  3UVX A;  3O37 A;  5CZG A;  5C87 A;  4N4I A;  4CLB A;  4NYV A;  5F1H A;  5I83 A;  4O75 A;  5DLX A;  4YK0 A;  3P1E A;  4UYH A;  5A5R A;  5FG5 A;  5DKD A;  4Z6H A;  3TLP A;  4BW3 A;  5C8G A;  4CUR A;  5KU3 A;  4YBT A;  4HBV A;  4ZC9 A;  4NUD A;  5H1U A;  5E9V A;  5HRV A;  5II1 A;  5I1Q A;  3U5J A;  2R0V A;  2FSA A;  1JSP B;  4HXR A;  3UVD A;  4ZQL A;  5EK9 A;  5FE8 A;  4CUU A;  5A5S A;  5ENH A;  5DLZ A;  5ENC A;  2YDW A;  4BJX A;  3HME A;  4HXL A;  5E74 A;  5I7X A;  3DAI A;  1WUG A;  5JWM A;  5ENG A;  5FE5 A;  4ALH A;  5C85 A;  3Q2E A;  5EGU A;  5CQA A;  4YC9 A;  4CUP A;  4YBS A;  5FFW A;  5FE4 A;  4NR8 A;  4UIT A;  4MR4 A;  4TS8 A;  5HFQ A;  5LJ0 A;  4C66 A;  5ENB A;  4MEN A;  5DKC A;  4YYN A;  3UVY A;  3LXJ A;  4NR5 A;  4PCI A;  3D7C A;  5E9M A;  4UYD A;  5E7D A;  5A7C A;  4YAX A;  4NYX A;  5D3L A;  4QSU A;  4J0R A;  5BT5 A;  4NYW A;  5HM0 A;  5A83 A;  5DYX A;  3DWY A;  5LVR A;  5F25 A;  4LZ2 A;  3P1F A;  4PKL A;  5FE3 A;  4UIY A;  5A5Q A;  4UIX A;  5KO4 A;  5C7N A;  5E73 A;  5LKX A;  2L84 A;  3AAD A;  4O78 A;  5LKZ A;  5FB0 A;  4A9N A;  5E3G A;  5E9Y A;  5II2 A;  2R0Y A;  2YEM A;  2RNX A;  3LQJ A;  5CRM A;  4UYG A;  5E9K A;  4IR6 A;  1E6I A;  5A85 A;  5DFD A;  4PS5 A;  5I86 A;  3MQM A;  5IGM A;  5CPE A;  3S92 A;  3MB3 A;  5A82 A;  2WP1 A;  5CFW A;  4A9K A;  1EQF A;  2DWW A;  4PY6 A;  5CGP A;  1ZS5 A;  5CQ4 A;  4YYJ A;  4J3I A;  4Z93 A;  5HJC A;  4QSX A;  3UV4 A;  4O7E A;  4WHW A;  4O7F A;  4UYF A;  5ENE A;  5BT4 A;  4Y03 A;  3JVJ A;  5A81 A;  5LKU A;  4NQN A;  5EWV A;  2DVS A;  5CY9 A;  4ALG A;  4PCE A;  5BT3 A;  4CUQ A;  4N3W A;  4WHU A;  5H1V A;  4MR5 A;  2GRC A;  5FE7 A;  3UVW A;  4A9M A;  5D3N A;  4MEO A;  4QSV A;  4NXJ A;  5HQ5 A;  5EWC A;  4HXP A;  4CFK A;  4KCX A;  3O34 A;  5AD3 A;  4UIU A;  5EV9 A;  3O33 A;  2L5E A;  4BW2 A;  5JI8 A;  2RI7 A;  4LYW A;  4QC3 A;  5DY7 A;  4KV1 A;  5HCL A;  4TYL A;  3U5N A;  5HQ6 A;  5L8T A;  4UYE A;  4NQM A;  2E7N A;  4Z6I A;  5D26 A;  3ONI A;  5EPB A;  4ZW1 A;  4BHW A;  4TT6 A;  5CUD A;  3O36 A;  4HXO A;  2I8N A;  3LJW A;  5FB1 A;  2MJV B;  2LSP B;  4QEU A;  5HRX A;  4WIV A;  4YYK A;  4A9O A;  4LC2 A;  4QSQ A;  5F60 A;  4MR6 A;  5TB6 A;  4NUC A;  2H60 A;  3U5M A;  4UIW A;  4CUS A;  5CUG A;  5IGL A;  1F68 A;  2R10 A;  2F6N A;  2WP2 A;  4LZR A;  4O77 A;  4RVR A;  4OGI A;  5CQ5 A;  5I88 A;  4QYL A;  3SVH A;  5HRW A;  2E7O A;  4YYD A;  3AQA A;  5I40 A;  4QR3 A;  2I7K A;  2KTB B;  5FH7 A;  1X0J A;  5HEN A;  5COI A;  5FH6 A;  5FE2 A;  3LQH A;  4NR7 A;  2F6J A;  5F2P A;  2DVQ A;  2RNW A;  5ENJ A;  4E96 A;  5IBN A;  5L99 A;  4Z1Q A;  5ETB A;  5CQ7 A;  2D82 A;  5DW2 A;  5HEL A;  4QUT A;  5EWH A;  5LJ2 A;  2D9E A;  3G0L A;  4QSS A;  2YEK A;  5CRZ A;  4N4H A;  4HXS A;  3P1C A;  5AD2 A;  5EP7 A;  5A5P A;  5FFY A;  5CTL A;  4YAB A;  4YYM A;  2NXB A;  3MB4 A;  5KHM A;  3MXF A;  3RCW A;  5AMF A;  2RO1 A;  4QSP A;  2OUO A;  3P5O A;  5CP5 A;  3U5O A;  4LZS A;  5C4Q A;  5ENF A;  5D3H A;  5CU8 A;  4LR6 A;  4Q0N A;  5F3A A;  4J1P A;  5H85 A;  2L85 A;  4IR3 A;  4IR5 A;  5TCM A;  3U5P A;  4IOO A;  1JM4 B;  4YAT A;  2RS9 B;  5IID A;  5KTW A;  2R0S A;  5DYU A;  5CUA A;  4YH4 A;  4XUB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...