4UYFA

N-terminal bromodomain of human brd2 with i-bet726 (gsk1324726a)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
119
structure length
119
Chain Sequence
NPGRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKIFLQKVASMPQEEQELVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BROMODOMAIN-CONTAINING PROTEIN 2
publication title The Discovery of I-Bet726 (Gsk1324726A), a Potent Tetrahydroquinoline Apoa1 Up-Regulator and Selective Bet Bromodomain Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 39
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2014-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4uyfA00
3UV2A 4OGIA 4TT6A 5IGMA 4NRAA 5CQTA 4YAXA 3LXJA 5I1QA 5FE2A 4QSWA 4LR6A 4LZRA 5ENIA 5D7XA 2RI7A 4YYNA 5FG4A 5I83A 4IR3A 4MR4A 4QUTA 4YYKA 5LKXA 5LKTA 5I80A 1WUGA 4N4GA 2RNYA 5HCLA 4Z1QA 5FE7A 5EU1A 5HM0A 4YY6A 3GG3A 4CUTA 5F1HA 4N3WA 5I40A 5CUEA 4Z1SA 4O72A 5DLZA 5EV9A 4GPJA 4MEPA 4UIYA 3U5OA 5A5PA 5I89A 5HQ6A 2D9EA 5CGPA 3MB4A 3MB3A 4N4IA 5L8UA 4QNSA 5G4RA 3Q2FA 5EI4A 5H1VA 2N9GA 4XUBA 1F68A 4YABA 4LDFA 2YEKA 4Z93A 5EWVA 3P1CA 5L97A 2OSSA 5E73A 5FG5A 5CP5A 3P1EA 5FB1A 5CUAA 3O33A 3UV5A 4A9OA 4ZQLA 5I86A 3UVXA 5C87A 5DFCA 4HBVA 5C7NA 3MULA 5E9IA 5CU8A 3Q2EA 5HRXA 2DVVA 3ZYUA 5CUCA 5E74A 4QZSA 3LQJA 5DYAA 4CUQA 5HFQA 4C67A 2YDWA 4CUUA 5EGUA 3UW9A 5DY7A 4QBMA 3D7CA 4YYGA 4IOOA 5JI8A 4NUEA 5G4SA 5HRWA 4YYMA 4ALHA 4MR6A 5ENEA 3G0LA 4DONA 1E6IA 4KV4A 4TT2A 5CS8A 5CPEA 5DYCA 4A9NA 5A7CA 2FSAA 4CL9A 5EK9A 4HXSA 4NRCA 4YBMA 5EQ1A 3AQAA 2L5EA 4QSQA 4YYJA 4XUAA 2MJVB 4ALGA 2L85A 3LQIA 5HEMA 5CY9A 4LRGA 4BJXA 4YYDA 5E9YA 3RCWA 3SVFA 4QR5A 5ENBA 3HMFA 3P1FA 2RFJA 5F3AA 2RS9B 4O7CA 3MXFA 5FFYA 4HXKA 5BT3A 4Z6IA 5C4QA 4RVRA 4LYIA 5D3JA 5CQ8A 4QYLA 5E3GA 2F6NA 4CURA 5FE8A 4AKNA 3QZTA 3P5OA 4UYEA 4QSVA 5CQ4A 4O70A 3MQMA 4KCXA 4CUSA 4CFLA 5A85A 2DATA 3MUKA 5C85A 3LJWA 5IGLA 3NXBA 4HXPA 4NR9A 4TS8A 1JM4B 4QC3A 4BW2A 5LVRA 4A9FA 4NR6A 4IOQA 5K29A 4NUDA 4YK0A 3JVLA 5E9VA 2OO1A 3DAIA 4NYWA 5LJ2A 4NXJA 5HFRA 4HXMA 5DW1A 2WP2A 5FE4A 4TT4A 4O74A 5BT4A 5AD3A 5COIA 2D82A 5EVAA 4YH4A 2I8NA 4IORA 5EWDA 5FDZA 5HENA 5LUUA 3LQHA 5CQ6A 2RNWA 4Q0OA 4MENA 5FG6A 4TYLA 5E9LA 4HXOA 4PS5A 5HRVA 5DFBA 4O78A 5EWHA 5I88A 4XYAA 4PCEA 5D3HA 3I3JA 2F6JA 3QZSA 4UYDA 5DKDA 4CFKA 1N72A 3UVDA 4WHUA 2DVSA 4A9IA 5CZGA 4HXNA 5FE6A 4NR5A 5CFWA 5I7YA 5F5ZA 2R0YA 5L99A 3K2JA 3HMEA 4QEWA 5L96A 4OUFA 5AMEA 5E7DA 5AMFA 3AADA 4IR5A 4LZ2A 4N4FA 4Z6HA 4J1PA 4WHWA 4YBSA 3UVYA 5I7XA 3U5JA 4TU6A 2RO1A 2YQDA 5FE5A 5ENHA 5ACYA 5F62A 4UITA 2YYNA 4NUCA 5E9KA 5F25A 4TQNA 3JVKA 5A81A 3FKMX 3IU6A 5J0DA 5AD2A 2DKWA 4NR4A 5KTXA 4HBXA 5F63A 5FE3A 4ZW1A 4QR3A 2LSPB 4YYHA 4QC1A 5A5RA 2R0SA 5FFVA 4NR7A 4J3IA 4HBYA 4NS5A 4QSUA 5EISA 5H1TA 5FH8A 4PY6A 4A9KA 4KV1A 5CQ3A 5E9MA 5EPRA 5IG6A 5DLXA 5DKCA 5A5OA 4YYIA 5A5SA 4YH3A 3JVMA 4QSPA 5LJ0A 5IBNA 4NQNA 4UIXA 4A9LA 5A5NA 5DFDA 2RNXA 5ETDA 4PCIA 4QR4A 5KU3A 4HBWA 5CQ7A 5DKHA 1ZS5A 4UIZA 4NYXA 5D26A 3QZVA 4PTBA 4A9EA 5HQ5A 3HMHA 4BW3A 4XY9A 4XY8A 5LJ1A 3SVHA 5CRZA 5KHMA 5HQ7A 5ENJA 5BT5A 4BHWA 4O76A 5EWWA 5A83A 5II1A 5A82A 5CQ5A 5JWMA 1WUMA 5D24A 4MEOA 3SVGA 5L8TA 4O7FA 4TTEA 5D25A 5HJCA 5CUDA 3U5LA 4QSRA 4NRBA 5A5QA 5D3PA 2YEMA 4TZ2A 4WIVA 2YW5A 5F61A 3S92A 3O35A 4HXLA 5HELA 4QY4A 4CLBA 5EP7A 4UYFA 4Q0NA 5D3RA 5FE1A 2G4AA 5FFWA 2WP1A 5EM3A 4IR6A 3G0JA 4YC9A 2L84A 5HLSA 4UYGA 4O71A 5FB0A 4A9HA 5I29A 5FE9A 4O7AA 4NQMA 4QUUA 5H1UA 4TZ8A 3U5NA 5D3LA 5ENGA 5C8GA 2DWWA 2DVQA 5FE0A 5LKZA 5EWCA 2E3KA 2R10A 2KTBB 4OGJA 5DBMA 4FLPA 4LYWA 4UIVA 5F36A 5EPSA 5CQAA 4MR5A 5KO4A 4LC2A 2E7NA 4N4HA 5II2A 4UIWA 5TB6A 5DX4A 5D3SA 5TCMA 3DWYA 4PKLA 5FH7A 4A9MA 2NXBA 4QSTA 5KTWA 5DYXA 2R0VA 3UVWA 4MR3A 4CUPA 2YELA 4YATA 5DYUA 3U5PA 2DVRA 4BW1A 5F1LA 4LZSA 4O7BA 4NR8A 5H85A 5D3TA 3O34A 5C89A 5EA1A 4YBTA 3UV4A 3TLPA 5DW2A 5F60A 4YY4A 4MEQA 4O77A 2H60A 4QEVA 4QSSA 5IGNA 5IGKA 5F2PA 3IU5A 2GRCA 4QEUA 4UYHA 5CUBA 5LKUA 5FBXA 4ZC9A 2OUOA 5E3DA 5ENFA 5LVQA 5EICA 4BW4A 1JSPB 4X2IA 4J0RA 5FH6A 5CTLA 5L98A 4J0SA 4HXRA 3P1DA 4Y03A 3U5KA 4TU4A 5E0RA 4E96A 5KTUA 3ONIA 4O7EA 5D0CA 4A9JA 4UIUA 4QB3A 5CUGA 4C66A 2I7KA 4LYSA 4O75A 5D3NA 3S91A 4NYVA 5CRMA 5ENCA 4F3IA 3U5MA 4QSXA 3O36A 4UYFB 2E7OA 5IIDA 1EQFA 4IR4A 3JVJA 3O37A 4QYDA 4YADA 5EPBA 5ETBA 1X0JA
chains in the Genus database with same CATH superfamily
3UV2A 4OGIA 4TT6A 5IGMA 4NRAA 5CQTA 4YAXA 3LXJA 5I1QA 1ZKRA 5FE2A 4QSWA 4LR6A 4LZRA 5ENIA 5D7XA 2RI7A 4YYNA 5FG4A 5I83A 4IR3A 4MR4A 4QUTA 4YYKA 5LKXA 5LKTA 5I80A 1WUGA 4N4GA 2RNYA 5HCLA 4Z1QA 5FE7A 5EU1A 5HM0A 4YY6A 3GG3A 4CUTA 5F1HA 4N3WA 5I40A 5CUEA 4Z1SA 4O72A 5DLZA 5EV9A 4GPJA 4MEPA 4UIYA 3U5OA 5A5PA 5I89A 5HQ6A 2D9EA 2EJNA 5CGPA 3MB4A 3MB3A 4N4IA 5L8UA 4QNSA 5G4RA 3Q2FA 5EI4A 5H1VA 2N9GA 4XUBA 1F68A 4YABA 4LDFA 2YEKA 4Z93A 5EWVA 3P1CA 5L97A 2OSSA 5E73A 5FG5A 5CP5A 3P1EA 5FB1A 5CUAA 3O33A 3UV5A 3D1DA 4A9OA 4ZQLA 5I86A 3UVXA 5C87A 5DFCA 4HBVA 5C7NA 3MULA 5E9IA 5CU8A 3Q2EA 5HRXA 2DVVA 3ZYUA 5CUCA 5E74A 4QZSA 3LQJA 5DYAA 4CUQA 5HFQA 4C67A 2YDWA 4CUUA 5EGUA 3UW9A 5DY7A 4QBMA 3D7CA 4YYGA 4IOOA 5JI8A 4NUEA 5G4SA 5HRWA 4YYMA 4ALHA 4MR6A 5ENEA 3G0LA 4DONA 1E6IA 4KV4A 4TT2A 5CS8A 5CPEA 5DYCA 4A9NA 5A7CA 2FSAA 4CL9A 5EK9A 4HXSA 4NRCA 4YBMA 5EQ1A 3AQAA 2L5EA 4QSQA 4YYJA 4XUAA 2MJVB 4ALGA 2L85A 3LQIA 5HEMA 5CY9A 4AI6A 4LRGA 4BJXA 4YYDA 5E9YA 3RCWA 3SVFA 4QR5A 5ENBA 3HMFA 3P1FA 2RFJA 5F3AA 2RS9B 4O7CA 3MXFA 5FFYA 4HXKA 5BT3A 3ERRA 4Z6IA 5C4QA 4RVRA 4LYIA 5D3JA 5CQ8A 4QYLA 5E3GA 2F6NA 4CURA 5FE8A 4AKNA 3QZTA 3P5OA 4UYEA 4QSVA 5CQ4A 4O70A 3MQMA 4KCXA 4CUSA 4CFLA 5A85A 1PUOA 2DATA 3MUKA 5C85A 3LJWA 5IGLA 3NXBA 4HXPA 4NR9A 4TS8A 1JM4B 4QC3A 4BW2A 5LVRA 3VKGA 4A9FA 4NR6A 4IOQA 5K29A 4NUDA 4YK0A 3JVLA 5E9VA 2OO1A 3DAIA 4NYWA 5LJ2A 4NXJA 5HFRA 4HXMA 5DW1A 2WP2A 5FE4A 4TT4A 4O74A 5BT4A 5AD3A 5COIA 2D82A 5EVAA 4YH4A 2I8NA 4IORA 5EWDA 5FDZA 5HENA 5LUUA 3LQHA 5CQ6A 2RNWA 4Q0OA 4MENA 5FG6A 4TYLA 5E9LA 4HXOA 4PS5A 5HRVA 5DFBA 4O78A 5EWHA 5I88A 4XYAA 4PCEA 5D3HA 3I3JA 2F6JA 3QZSA 4UYDA 5DKDA 4CFKA 1N72A 3UVDA 4WHUA 2DVSA 4A9IA 5CZGA 4HXNA 5FE6A 4NR5A 5CFWA 5I7YA 5F5ZA 2R0YA 5L99A 3K2JA 3HMEA 4QEWA 5L96A 4OUFA 5AMEA 5E7DA 5AMFA 3AADA 4IR5A 4LZ2A 4N4FA 4Z6HA 4J1PA 4WHWA 4YBSA 3UVYA 5I7XA 3U5JA 4TU6A 2RO1A 2YQDA 5FE5A 5ENHA 5ACYA 5F62A 4UITA 2YYNA 4NUCA 5E9KA 5F25A 4TQNA 3JVKA 5A81A 3FKMX 3IU6A 5J0DA 5AD2A 2DKWA 4NR4A 5KTXA 4HBXA 5F63A 5FE3A 4ZW1A 3VKHA 4QR3A 2LSPB 4YYHA 4QC1A 5A5RA 2R0SA 5FFVA 4NR7A 4J3IA 4HBYA 4NS5A 4QSUA 5EISA 5H1TA 5FH8A 4PY6A 4A9KA 4KV1A 5CQ3A 5E9MA 5EPRA 5IG6A 5DLXA 5DKCA 5A5OA 4YYIA 5A5SA 4YH3A 3JVMA 4QSPA 5LJ0A 5IBNA 4NQNA 4UIXA 4A9LA 5A5NA 5DFDA 2RNXA 5ETDA 4PCIA 4QR4A 5KU3A 4HBWA 5CQ7A 5DKHA 1ZS5A 4UIZA 4NYXA 5D26A 3QZVA 4PTBA 4A9EA 5HQ5A 3HMHA 4BW3A 4XY9A 4XY8A 5LJ1A 3SVHA 5CRZA 5KHMA 5HQ7A 5ENJA 5BT5A 4BHWA 4O76A 5EWWA 5A83A 5II1A 5A82A 5CQ5A 5JWMA 1WUMA 5D24A 4MEOA 3SVGA 5L8TA 4O7FA 4TTEA 5D25A 5HJCA 5CUDA 3U5LA 4QSRA 4NRBA 5A5QA 5D3PA 2YEMA 4TZ2A 4WIVA 2YW5A 5F61A 3S92A 3O35A 4HXLA 5HELA 4QY4A 4CLBA 5EP7A 4UYFA 4Q0NA 5D3RA 5FE1A 2G4AA 5FFWA 2WP1A 5EM3A 4IR6A 3G0JA 4YC9A 2L84A 5HLSA 4UYGA 4O71A 5FB0A 4A9HA 5I29A 5FE9A 4O7AA 4NQMA 4QUUA 5H1UA 4TZ8A 3U5NA 5D3LA 5ENGA 5C8GA 2DWWA 2DVQA 5FE0A 5LKZA 5EWCA 2E3KA 2R10A 2KTBB 4OGJA 5DBMA 4FLPA 4LYWA 4UIVA 5F36A 5EPSA 5CQAA 4MR5A 5KO4A 4LC2A 2E7NA 4N4HA 5II2A 4UIWA 5TB6A 5DX4A 5D3SA 5TCMA 3DWYA 4PKLA 5FH7A 4A9MA 2NXBA 4QSTA 5KTWA 5DYXA 2R0VA 3UVWA 4MR3A 4CUPA 2YELA 4YATA 5DYUA 3U5PA 2DVRA 4BW1A 5F1LA 4LZSA 4O7BA 3D1BA 4NR8A 5H85A 5D3TA 3O34A 5C89A 5EA1A 4YBTA 3UV4A 3TLPA 5DW2A 5F60A 4YY4A 4MEQA 4O77A 2H60A 4QEVA 4QSSA 5IGNA 5IGKA 5F2PA 3IU5A 2GRCA 4QEUA 4UYHA 5CUBA 5LKUA 5FBXA 4ZC9A 2OUOA 5E3DA 5ENFA 5LVQA 5EICA 4BW4A 4AKGA 1JSPB 4X2IA 4J0RA 5FH6A 5CTLA 5L98A 4J0SA 4HXRA 3P1DA 4Y03A 3U5KA 4TU4A 5E0RA 4E96A 5KTUA 3ONIA 4O7EA 5D0CA 4A9JA 4UIUA 4QB3A 5CUGA 4C66A 4AKHA 2I7KA 4LYSA 4O75A 5D3NA 3S91A 4NYVA 5CRMA 5ENCA 4F3IA 3U5MA 4QSXA 3O36A 4UYFB 2E7OA 4AKIA 5IIDA 1EQFA 4IR4A 3JVJA 3O37A 4QYDA 4YADA 5EPBA 5ETBA 1X0JA
chains in the Genus database with same CATH topology
3UV2A 4OGIA 4TT6A 5IGMA 4NRAA 5CQTA 4YAXA 3LXJA 5I1QA 5FE2A 4QSWA 4LR6A 4LZRA 5ENIA 5D7XA 2RI7A 4YYNA 5FG4A 5I83A 4IR3A 4MR4A 4QUTA 4YYKA 5LKXA 5LKTA 5I80A 1WUGA 4N4GA 2RNYA 5HCLA 4Z1QA 5FE7A 5EU1A 5HM0A 4YY6A 3GG3A 4CUTA 5F1HA 4N3WA 5I40A 5CUEA 4Z1SA 4O72A 5DLZA 5EV9A 4GPJA 4MEPA 4UIYA 3U5OA 5A5PA 5I89A 5HQ6A 2D9EA 5CGPA 3MB4A 3MB3A 4N4IA 5L8UA 4QNSA 5G4RA 3Q2FA 5EI4A 5H1VA 2N9GA 4XUBA 1F68A 4YABA 4LDFA 2YEKA 4Z93A 5EWVA 3P1CA 5L97A 2OSSA 5E73A 5FG5A 5CP5A 3P1EA 5FB1A 5CUAA 3O33A 3UV5A 4A9OA 4ZQLA 5I86A 3UVXA 5C87A 5DFCA 4HBVA 5C7NA 3MULA 5E9IA 5CU8A 3Q2EA 5HRXA 2DVVA 3ZYUA 5CUCA 5E74A 4QZSA 3LQJA 5DYAA 4CUQA 5HFQA 4C67A 2YDWA 4CUUA 5EGUA 3UW9A 5DY7A 4QBMA 3D7CA 4YYGA 4IOOA 5JI8A 4NUEA 5G4SA 5HRWA 4YYMA 4ALHA 4MR6A 5ENEA 3G0LA 4DONA 1E6IA 4KV4A 4TT2A 5CS8A 5CPEA 5DYCA 4A9NA 5A7CA 2FSAA 4CL9A 5EK9A 4HXSA 4NRCA 4YBMA 5EQ1A 3AQAA 2L5EA 4QSQA 4YYJA 4XUAA 2MJVB 4ALGA 2L85A 3LQIA 5HEMA 5CY9A 4LRGA 4BJXA 4YYDA 5E9YA 3RCWA 3SVFA 4QR5A 5ENBA 3HMFA 3P1FA 2RFJA 5F3AA 2RS9B 4O7CA 3MXFA 5FFYA 4HXKA 5BT3A 4Z6IA 5C4QA 4RVRA 4LYIA 5D3JA 5CQ8A 4QYLA 5E3GA 2F6NA 4CURA 5FE8A 4AKNA 3QZTA 3P5OA 4UYEA 4QSVA 5CQ4A 4O70A 3MQMA 4KCXA 4CUSA 4CFLA 5A85A 2DATA 3MUKA 5C85A 3LJWA 5IGLA 3NXBA 4HXPA 4NR9A 4TS8A 1JM4B 4QC3A 4BW2A 5LVRA 4A9FA 4NR6A 4IOQA 5K29A 4NUDA 4YK0A 3JVLA 5E9VA 2OO1A 3DAIA 4NYWA 5LJ2A 4NXJA 5HFRA 4HXMA 5DW1A 2WP2A 5FE4A 4TT4A 4O74A 5BT4A 5AD3A 5COIA 2D82A 5EVAA 4YH4A 2I8NA 4IORA 5EWDA 5FDZA 5HENA 5LUUA 3LQHA 5CQ6A 2RNWA 4Q0OA 4MENA 5FG6A 4TYLA 5E9LA 4HXOA 4PS5A 5HRVA 5DFBA 4O78A 5EWHA 5I88A 4XYAA 4PCEA 5D3HA 3I3JA 2F6JA 3QZSA 4UYDA 5DKDA 4CFKA 1N72A 3UVDA 4WHUA 2DVSA 4A9IA 5CZGA 4HXNA 5FE6A 4NR5A 5CFWA 5I7YA 5F5ZA 2R0YA 5L99A 3K2JA 3HMEA 4QEWA 5L96A 4OUFA 5AMEA 5E7DA 5AMFA 3AADA 4IR5A 4LZ2A 4N4FA 4Z6HA 4J1PA 4WHWA 4YBSA 3UVYA 5I7XA 3U5JA 4TU6A 2RO1A 2YQDA 5FE5A 5ENHA 5ACYA 5F62A 4UITA 2YYNA 4NUCA 5E9KA 5F25A 4TQNA 3JVKA 5A81A 3FKMX 3IU6A 5J0DA 5AD2A 2DKWA 4NR4A 5KTXA 4HBXA 5F63A 5FE3A 4ZW1A 4QR3A 2LSPB 4YYHA 4QC1A 5A5RA 2R0SA 5FFVA 4NR7A 4J3IA 4HBYA 4NS5A 4QSUA 5EISA 5H1TA 5FH8A 4PY6A 4A9KA 4KV1A 5CQ3A 5E9MA 5EPRA 5IG6A 5DLXA 5DKCA 5A5OA 4YYIA 5A5SA 4YH3A 3JVMA 4QSPA 5LJ0A 5IBNA 4NQNA 4UIXA 4A9LA 5A5NA 5DFDA 2RNXA 5ETDA 4PCIA 4QR4A 5KU3A 4HBWA 5CQ7A 5DKHA 1ZS5A 4UIZA 4NYXA 5D26A 3QZVA 4PTBA 4A9EA 5HQ5A 3HMHA 4BW3A 4XY9A 4XY8A 5LJ1A 3SVHA 5CRZA 5KHMA 5HQ7A 5ENJA 5BT5A 4BHWA 4O76A 5EWWA 5A83A 5II1A 5A82A 5CQ5A 5JWMA 1WUMA 5D24A 4MEOA 3SVGA 5L8TA 4O7FA 4TTEA 5D25A 5HJCA 5CUDA 3U5LA 4QSRA 4NRBA 5A5QA 5D3PA 2YEMA 4TZ2A 4WIVA 2YW5A 5F61A 3S92A 3O35A 4HXLA 5HELA 4QY4A 4CLBA 5EP7A 4UYFA 4Q0NA 5D3RA 5FE1A 2G4AA 5FFWA 2WP1A 5EM3A 4IR6A 3G0JA 4YC9A 2L84A 5HLSA 4UYGA 4O71A 5FB0A 4A9HA 5I29A 5FE9A 4O7AA 4NQMA 4QUUA 5H1UA 4TZ8A 3U5NA 5D3LA 5ENGA 5C8GA 2DWWA 2DVQA 5FE0A 5LKZA 5EWCA 2E3KA 2R10A 2KTBB 4OGJA 5DBMA 4FLPA 4LYWA 4UIVA 5F36A 5EPSA 5CQAA 4MR5A 5KO4A 4LC2A 2E7NA 4N4HA 5II2A 4UIWA 5TB6A 5DX4A 5D3SA 5TCMA 3DWYA 4PKLA 5FH7A 4A9MA 2NXBA 4QSTA 5KTWA 5DYXA 2R0VA 3UVWA 4MR3A 4CUPA 2YELA 4YATA 5DYUA 3U5PA 2DVRA 4BW1A 5F1LA 4LZSA 4O7BA 4NR8A 5H85A 5D3TA 3O34A 5C89A 5EA1A 4YBTA 3UV4A 3TLPA 5DW2A 5F60A 4YY4A 4MEQA 4O77A 2H60A 4QEVA 4QSSA 5IGNA 5IGKA 5F2PA 3IU5A 2GRCA 4QEUA 4UYHA 5CUBA 5LKUA 5FBXA 4ZC9A 2OUOA 5E3DA 5ENFA 5LVQA 5EICA 4BW4A 1JSPB 4X2IA 4J0RA 5FH6A 5CTLA 5L98A 4J0SA 4HXRA 3P1DA 4Y03A 3U5KA 4TU4A 5E0RA 4E96A 5KTUA 3ONIA 4O7EA 5D0CA 4A9JA 4UIUA 4QB3A 5CUGA 4C66A 2I7KA 4LYSA 4O75A 5D3NA 3S91A 4NYVA 5CRMA 5ENCA 4F3IA 3U5MA 4QSXA 3O36A 4UYFB 2E7OA 5IIDA 1EQFA 4IR4A 3JVJA 3O37A 4QYDA 4YADA 5EPBA 5ETBA 1X0JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UV2 A;  4OGI A;  4TT6 A;  5IGM A;  4NRA A;  5CQT A;  4YAX A;  3LXJ A;  5I1Q A;  5FE2 A;  4QSW A;  4LR6 A;  4LZR A;  5ENI A;  5D7X A;  2RI7 A;  4YYN A;  5FG4 A;  5I83 A;  4IR3 A;  4MR4 A;  4QUT A;  4YYK A;  5LKX A;  5LKT A;  5I80 A;  1WUG A;  4N4G A;  2RNY A;  5HCL A;  4Z1Q A;  5FE7 A;  5EU1 A;  5HM0 A;  4YY6 A;  3GG3 A;  4CUT A;  5F1H A;  4N3W A;  5I40 A;  5CUE A;  4Z1S A;  4O72 A;  5DLZ A;  5EV9 A;  4GPJ A;  4MEP A;  4UIY A;  3U5O A;  5A5P A;  5I89 A;  5HQ6 A;  2D9E A;  5CGP A;  3MB4 A;  3MB3 A;  4N4I A;  5L8U A;  4QNS A;  5G4R A;  3Q2F A;  5EI4 A;  5H1V A;  2N9G A;  4XUB A;  1F68 A;  4YAB A;  4LDF A;  2YEK A;  4Z93 A;  5EWV A;  3P1C A;  5L97 A;  2OSS A;  5E73 A;  5FG5 A;  5CP5 A;  3P1E A;  5FB1 A;  5CUA A;  3O33 A;  3UV5 A;  4A9O A;  4ZQL A;  5I86 A;  3UVX A;  5C87 A;  5DFC A;  4HBV A;  5C7N A;  3MUL A;  5E9I A;  5CU8 A;  3Q2E A;  5HRX A;  2DVV A;  3ZYU A;  5CUC A;  5E74 A;  4QZS A;  3LQJ A;  5DYA A;  4CUQ A;  5HFQ A;  4C67 A;  2YDW A;  4CUU A;  5EGU A;  3UW9 A;  5DY7 A;  4QBM A;  3D7C A;  4YYG A;  4IOO A;  5JI8 A;  4NUE A;  5G4S A;  5HRW A;  4YYM A;  4ALH A;  4MR6 A;  5ENE A;  3G0L A;  4DON A;  1E6I A;  4KV4 A;  4TT2 A;  5CS8 A;  5CPE A;  5DYC A;  4A9N A;  5A7C A;  2FSA A;  4CL9 A;  5EK9 A;  4HXS A;  4NRC A;  4YBM A;  5EQ1 A;  3AQA A;  2L5E A;  4QSQ A;  4YYJ A;  4XUA A;  2MJV B;  4ALG A;  2L85 A;  3LQI A;  5HEM A;  5CY9 A;  4LRG A;  4BJX A;  4YYD A;  5E9Y A;  3RCW A;  3SVF A;  4QR5 A;  5ENB A;  3HMF A;  3P1F A;  2RFJ A;  5F3A A;  2RS9 B;  4O7C A;  3MXF A;  5FFY A;  4HXK A;  5BT3 A;  4Z6I A;  5C4Q A;  4RVR A;  4LYI A;  5D3J A;  5CQ8 A;  4QYL A;  5E3G A;  2F6N A;  4CUR A;  5FE8 A;  4AKN A;  3QZT A;  3P5O A;  4UYE A;  4QSV A;  5CQ4 A;  4O70 A;  3MQM A;  4KCX A;  4CUS A;  4CFL A;  5A85 A;  2DAT A;  3MUK A;  5C85 A;  3LJW A;  5IGL A;  3NXB A;  4HXP A;  4NR9 A;  4TS8 A;  1JM4 B;  4QC3 A;  4BW2 A;  5LVR A;  4A9F A;  4NR6 A;  4IOQ A;  5K29 A;  4NUD A;  4YK0 A;  3JVL A;  5E9V A;  2OO1 A;  3DAI A;  4NYW A;  5LJ2 A;  4NXJ A;  5HFR A;  4HXM A;  5DW1 A;  2WP2 A;  5FE4 A;  4TT4 A;  4O74 A;  5BT4 A;  5AD3 A;  5COI A;  2D82 A;  5EVA A;  4YH4 A;  2I8N A;  4IOR A;  5EWD A;  5FDZ A;  5HEN A;  5LUU A;  3LQH A;  5CQ6 A;  2RNW A;  4Q0O A;  4MEN A;  5FG6 A;  4TYL A;  5E9L A;  4HXO A;  4PS5 A;  5HRV A;  5DFB A;  4O78 A;  5EWH A;  5I88 A;  4XYA A;  4PCE A;  5D3H A;  3I3J A;  2F6J A;  3QZS A;  4UYD A;  5DKD A;  4CFK A;  1N72 A;  3UVD A;  4WHU A;  2DVS A;  4A9I A;  5CZG A;  4HXN A;  5FE6 A;  4NR5 A;  5CFW A;  5I7Y A;  5F5Z A;  2R0Y A;  5L99 A;  3K2J A;  3HME A;  4QEW A;  5L96 A;  4OUF A;  5AME A;  5E7D A;  5AMF A;  3AAD A;  4IR5 A;  4LZ2 A;  4N4F A;  4Z6H A;  4J1P A;  4WHW A;  4YBS A;  3UVY A;  5I7X A;  3U5J A;  4TU6 A;  2RO1 A;  2YQD A;  5FE5 A;  5ENH A;  5ACY A;  5F62 A;  4UIT A;  2YYN A;  4NUC A;  5E9K A;  5F25 A;  4TQN A;  3JVK A;  5A81 A;  3FKM X;  3IU6 A;  5J0D A;  5AD2 A;  2DKW A;  4NR4 A;  5KTX A;  4HBX A;  5F63 A;  5FE3 A;  4ZW1 A;  4QR3 A;  2LSP B;  4YYH A;  4QC1 A;  5A5R A;  2R0S A;  5FFV A;  4NR7 A;  4J3I A;  4HBY A;  4NS5 A;  4QSU A;  5EIS A;  5H1T A;  5FH8 A;  4PY6 A;  4A9K A;  4KV1 A;  5CQ3 A;  5E9M A;  5EPR A;  5IG6 A;  5DLX A;  5DKC A;  5A5O A;  4YYI A;  5A5S A;  4YH3 A;  3JVM A;  4QSP A;  5LJ0 A;  5IBN A;  4NQN A;  4UIX A;  4A9L A;  5A5N A;  5DFD A;  2RNX A;  5ETD A;  4PCI A;  4QR4 A;  5KU3 A;  4HBW A;  5CQ7 A;  5DKH A;  1ZS5 A;  4UIZ A;  4NYX A;  5D26 A;  3QZV A;  4PTB A;  4A9E A;  5HQ5 A;  3HMH A;  4BW3 A;  4XY9 A;  4XY8 A;  5LJ1 A;  3SVH A;  5CRZ A;  5KHM A;  5HQ7 A;  5ENJ A;  5BT5 A;  4BHW A;  4O76 A;  5EWW A;  5A83 A;  5II1 A;  5A82 A;  5CQ5 A;  5JWM A;  1WUM A;  5D24 A;  4MEO A;  3SVG A;  5L8T A;  4O7F A;  4TTE A;  5D25 A;  5HJC A;  5CUD A;  3U5L A;  4QSR A;  4NRB A;  5A5Q A;  5D3P A;  2YEM A;  4TZ2 A;  4WIV A;  2YW5 A;  5F61 A;  3S92 A;  3O35 A;  4HXL A;  5HEL A;  4QY4 A;  4CLB A;  5EP7 A;  4UYF A;  4Q0N A;  5D3R A;  5FE1 A;  2G4A A;  5FFW A;  2WP1 A;  5EM3 A;  4IR6 A;  3G0J A;  4YC9 A;  2L84 A;  5HLS A;  4UYG A;  4O71 A;  5FB0 A;  4A9H A;  5I29 A;  5FE9 A;  4O7A A;  4NQM A;  4QUU A;  5H1U A;  4TZ8 A;  3U5N A;  5D3L A;  5ENG A;  5C8G A;  2DWW A;  2DVQ A;  5FE0 A;  5LKZ A;  5EWC A;  2E3K A;  2R10 A;  2KTB B;  4OGJ A;  5DBM A;  4FLP A;  4LYW A;  4UIV A;  5F36 A;  5EPS A;  5CQA A;  4MR5 A;  5KO4 A;  4LC2 A;  2E7N A;  4N4H A;  5II2 A;  4UIW A;  5TB6 A;  5DX4 A;  5D3S A;  5TCM A;  3DWY A;  4PKL A;  5FH7 A;  4A9M A;  2NXB A;  4QST A;  5KTW A;  5DYX A;  2R0V A;  3UVW A;  4MR3 A;  4CUP A;  2YEL A;  4YAT A;  5DYU A;  3U5P A;  2DVR A;  4BW1 A;  5F1L A;  4LZS A;  4O7B A;  4NR8 A;  5H85 A;  5D3T A;  3O34 A;  5C89 A;  5EA1 A;  4YBT A;  3UV4 A;  3TLP A;  5DW2 A;  5F60 A;  4YY4 A;  4MEQ A;  4O77 A;  2H60 A;  4QEV A;  4QSS A;  5IGN A;  5IGK A;  5F2P A;  3IU5 A;  2GRC A;  4QEU A;  4UYH A;  5CUB A;  5LKU A;  5FBX A;  4ZC9 A;  2OUO A;  5E3D A;  5ENF A;  5LVQ A;  5EIC A;  4BW4 A;  1JSP B;  4X2I A;  4J0R A;  5FH6 A;  5CTL A;  5L98 A;  4J0S A;  4HXR A;  3P1D A;  4Y03 A;  3U5K A;  4TU4 A;  5E0R A;  4E96 A;  5KTU A;  3ONI A;  4O7E A;  5D0C A;  4A9J A;  4UIU A;  4QB3 A;  5CUG A;  4C66 A;  2I7K A;  4LYS A;  4O75 A;  5D3N A;  3S91 A;  4NYV A;  5CRM A;  5ENC A;  4F3I A;  3U5M A;  4QSX A;  3O36 A;  4UYF B;  2E7O A;  5IID A;  1EQF A;  4IR4 A;  3JVJ A;  3O37 A;  4QYD A;  4YAD A;  5EPB A;  5ETB A;  1X0J A; 
#chains in the Genus database with same CATH topology
 3UV2 A;  4OGI A;  4TT6 A;  5IGM A;  4NRA A;  5CQT A;  4YAX A;  3LXJ A;  5I1Q A;  1ZKR A;  5FE2 A;  4QSW A;  4LR6 A;  4LZR A;  5ENI A;  5D7X A;  2RI7 A;  4YYN A;  5FG4 A;  5I83 A;  4IR3 A;  4MR4 A;  4QUT A;  4YYK A;  5LKX A;  5LKT A;  5I80 A;  1WUG A;  4N4G A;  2RNY A;  5HCL A;  4Z1Q A;  5FE7 A;  5EU1 A;  5HM0 A;  4YY6 A;  3GG3 A;  4CUT A;  5F1H A;  4N3W A;  5I40 A;  5CUE A;  4Z1S A;  4O72 A;  5DLZ A;  5EV9 A;  4GPJ A;  4MEP A;  4UIY A;  3U5O A;  5A5P A;  5I89 A;  5HQ6 A;  2D9E A;  2EJN A;  5CGP A;  3MB4 A;  3MB3 A;  4N4I A;  5L8U A;  4QNS A;  5G4R A;  3Q2F A;  5EI4 A;  5H1V A;  2N9G A;  4XUB A;  1F68 A;  4YAB A;  4LDF A;  2YEK A;  4Z93 A;  5EWV A;  3P1C A;  5L97 A;  2OSS A;  5E73 A;  5FG5 A;  5CP5 A;  3P1E A;  5FB1 A;  5CUA A;  3O33 A;  3UV5 A;  3D1D A;  4A9O A;  4ZQL A;  5I86 A;  3UVX A;  5C87 A;  5DFC A;  4HBV A;  5C7N A;  3MUL A;  5E9I A;  5CU8 A;  3Q2E A;  5HRX A;  2DVV A;  3ZYU A;  5CUC A;  5E74 A;  4QZS A;  3LQJ A;  5DYA A;  4CUQ A;  5HFQ A;  4C67 A;  2YDW A;  4CUU A;  5EGU A;  3UW9 A;  5DY7 A;  4QBM A;  3D7C A;  4YYG A;  4IOO A;  5JI8 A;  4NUE A;  5G4S A;  5HRW A;  4YYM A;  4ALH A;  4MR6 A;  5ENE A;  3G0L A;  4DON A;  1E6I A;  4KV4 A;  4TT2 A;  5CS8 A;  5CPE A;  5DYC A;  4A9N A;  5A7C A;  2FSA A;  4CL9 A;  5EK9 A;  4HXS A;  4NRC A;  4YBM A;  5EQ1 A;  3AQA A;  2L5E A;  4QSQ A;  4YYJ A;  4XUA A;  2MJV B;  4ALG A;  2L85 A;  3LQI A;  5HEM A;  5CY9 A;  4AI6 A;  4LRG A;  4BJX A;  4YYD A;  5E9Y A;  3RCW A;  3SVF A;  4QR5 A;  5ENB A;  3HMF A;  3P1F A;  2RFJ A;  5F3A A;  2RS9 B;  4O7C A;  3MXF A;  5FFY A;  4HXK A;  5BT3 A;  3ERR A;  4Z6I A;  5C4Q A;  4RVR A;  4LYI A;  5D3J A;  5CQ8 A;  4QYL A;  5E3G A;  2F6N A;  4CUR A;  5FE8 A;  4AKN A;  3QZT A;  3P5O A;  4UYE A;  4QSV A;  5CQ4 A;  4O70 A;  3MQM A;  4KCX A;  4CUS A;  4CFL A;  5A85 A;  1PUO A;  2DAT A;  3MUK A;  5C85 A;  3LJW A;  5IGL A;  3NXB A;  4HXP A;  4NR9 A;  4TS8 A;  1JM4 B;  4QC3 A;  4BW2 A;  5LVR A;  3VKG A;  4A9F A;  4NR6 A;  4IOQ A;  5K29 A;  4NUD A;  4YK0 A;  3JVL A;  5E9V A;  2OO1 A;  3DAI A;  4NYW A;  5LJ2 A;  4NXJ A;  5HFR A;  4HXM A;  5DW1 A;  2WP2 A;  5FE4 A;  4TT4 A;  4O74 A;  5BT4 A;  5AD3 A;  5COI A;  2D82 A;  5EVA A;  4YH4 A;  2I8N A;  4IOR A;  5EWD A;  5FDZ A;  5HEN A;  5LUU A;  3LQH A;  5CQ6 A;  2RNW A;  4Q0O A;  4MEN A;  5FG6 A;  4TYL A;  5E9L A;  4HXO A;  4PS5 A;  5HRV A;  5DFB A;  4O78 A;  5EWH A;  5I88 A;  4XYA A;  4PCE A;  5D3H A;  3I3J A;  2F6J A;  3QZS A;  4UYD A;  5DKD A;  4CFK A;  1N72 A;  3UVD A;  4WHU A;  2DVS A;  4A9I A;  5CZG A;  4HXN A;  5FE6 A;  4NR5 A;  5CFW A;  5I7Y A;  5F5Z A;  2R0Y A;  5L99 A;  3K2J A;  3HME A;  4QEW A;  5L96 A;  4OUF A;  5AME A;  5E7D A;  5AMF A;  3AAD A;  4IR5 A;  4LZ2 A;  4N4F A;  4Z6H A;  4J1P A;  4WHW A;  4YBS A;  3UVY A;  5I7X A;  3U5J A;  4TU6 A;  2RO1 A;  2YQD A;  5FE5 A;  5ENH A;  5ACY A;  5F62 A;  4UIT A;  2YYN A;  4NUC A;  5E9K A;  5F25 A;  4TQN A;  3JVK A;  5A81 A;  3FKM X;  3IU6 A;  5J0D A;  5AD2 A;  2DKW A;  4NR4 A;  5KTX A;  4HBX A;  5F63 A;  5FE3 A;  4ZW1 A;  3VKH A;  4QR3 A;  2LSP B;  4YYH A;  4QC1 A;  5A5R A;  2R0S A;  5FFV A;  4NR7 A;  4J3I A;  4HBY A;  4NS5 A;  4QSU A;  5EIS A;  5H1T A;  5FH8 A;  4PY6 A;  4A9K A;  4KV1 A;  5CQ3 A;  5E9M A;  5EPR A;  5IG6 A;  5DLX A;  5DKC A;  5A5O A;  4YYI A;  5A5S A;  4YH3 A;  3JVM A;  4QSP A;  5LJ0 A;  5IBN A;  4NQN A;  4UIX A;  4A9L A;  5A5N A;  5DFD A;  2RNX A;  5ETD A;  4PCI A;  4QR4 A;  5KU3 A;  4HBW A;  5CQ7 A;  5DKH A;  1ZS5 A;  4UIZ A;  4NYX A;  5D26 A;  3QZV A;  4PTB A;  4A9E A;  5HQ5 A;  3HMH A;  4BW3 A;  4XY9 A;  4XY8 A;  5LJ1 A;  3SVH A;  5CRZ A;  5KHM A;  5HQ7 A;  5ENJ A;  5BT5 A;  4BHW A;  4O76 A;  5EWW A;  5A83 A;  5II1 A;  5A82 A;  5CQ5 A;  5JWM A;  1WUM A;  5D24 A;  4MEO A;  3SVG A;  5L8T A;  4O7F A;  4TTE A;  5D25 A;  5HJC A;  5CUD A;  3U5L A;  4QSR A;  4NRB A;  5A5Q A;  5D3P A;  2YEM A;  4TZ2 A;  4WIV A;  2YW5 A;  5F61 A;  3S92 A;  3O35 A;  4HXL A;  5HEL A;  4QY4 A;  4CLB A;  5EP7 A;  4UYF A;  4Q0N A;  5D3R A;  5FE1 A;  2G4A A;  5FFW A;  2WP1 A;  5EM3 A;  4IR6 A;  3G0J A;  4YC9 A;  2L84 A;  5HLS A;  4UYG A;  4O71 A;  5FB0 A;  4A9H A;  5I29 A;  5FE9 A;  4O7A A;  4NQM A;  4QUU A;  5H1U A;  4TZ8 A;  3U5N A;  5D3L A;  5ENG A;  5C8G A;  2DWW A;  2DVQ A;  5FE0 A;  5LKZ A;  5EWC A;  2E3K A;  2R10 A;  2KTB B;  4OGJ A;  5DBM A;  4FLP A;  4LYW A;  4UIV A;  5F36 A;  5EPS A;  5CQA A;  4MR5 A;  5KO4 A;  4LC2 A;  2E7N A;  4N4H A;  5II2 A;  4UIW A;  5TB6 A;  5DX4 A;  5D3S A;  5TCM A;  3DWY A;  4PKL A;  5FH7 A;  4A9M A;  2NXB A;  4QST A;  5KTW A;  5DYX A;  2R0V A;  3UVW A;  4MR3 A;  4CUP A;  2YEL A;  4YAT A;  5DYU A;  3U5P A;  2DVR A;  4BW1 A;  5F1L A;  4LZS A;  4O7B A;  3D1B A;  4NR8 A;  5H85 A;  5D3T A;  3O34 A;  5C89 A;  5EA1 A;  4YBT A;  3UV4 A;  3TLP A;  5DW2 A;  5F60 A;  4YY4 A;  4MEQ A;  4O77 A;  2H60 A;  4QEV A;  4QSS A;  5IGN A;  5IGK A;  5F2P A;  3IU5 A;  2GRC A;  4QEU A;  4UYH A;  5CUB A;  5LKU A;  5FBX A;  4ZC9 A;  2OUO A;  5E3D A;  5ENF A;  5LVQ A;  5EIC A;  4BW4 A;  4AKG A;  1JSP B;  4X2I A;  4J0R A;  5FH6 A;  5CTL A;  5L98 A;  4J0S A;  4HXR A;  3P1D A;  4Y03 A;  3U5K A;  4TU4 A;  5E0R A;  4E96 A;  5KTU A;  3ONI A;  4O7E A;  5D0C A;  4A9J A;  4UIU A;  4QB3 A;  5CUG A;  4C66 A;  4AKH A;  2I7K A;  4LYS A;  4O75 A;  5D3N A;  3S91 A;  4NYV A;  5CRM A;  5ENC A;  4F3I A;  3U5M A;  4QSX A;  3O36 A;  4UYF B;  2E7O A;  4AKI A;  5IID A;  1EQF A;  4IR4 A;  3JVJ A;  3O37 A;  4QYD A;  4YAD A;  5EPB A;  5ETB A;  1X0J A; 
#chains in the Genus database with same CATH homology
 3UV2 A;  4OGI A;  4TT6 A;  5IGM A;  4NRA A;  5CQT A;  4YAX A;  3LXJ A;  5I1Q A;  5FE2 A;  4QSW A;  4LR6 A;  4LZR A;  5ENI A;  5D7X A;  2RI7 A;  4YYN A;  5FG4 A;  5I83 A;  4IR3 A;  4MR4 A;  4QUT A;  4YYK A;  5LKX A;  5LKT A;  5I80 A;  1WUG A;  4N4G A;  2RNY A;  5HCL A;  4Z1Q A;  5FE7 A;  5EU1 A;  5HM0 A;  4YY6 A;  3GG3 A;  4CUT A;  5F1H A;  4N3W A;  5I40 A;  5CUE A;  4Z1S A;  4O72 A;  5DLZ A;  5EV9 A;  4GPJ A;  4MEP A;  4UIY A;  3U5O A;  5A5P A;  5I89 A;  5HQ6 A;  2D9E A;  5CGP A;  3MB4 A;  3MB3 A;  4N4I A;  5L8U A;  4QNS A;  5G4R A;  3Q2F A;  5EI4 A;  5H1V A;  2N9G A;  4XUB A;  1F68 A;  4YAB A;  4LDF A;  2YEK A;  4Z93 A;  5EWV A;  3P1C A;  5L97 A;  2OSS A;  5E73 A;  5FG5 A;  5CP5 A;  3P1E A;  5FB1 A;  5CUA A;  3O33 A;  3UV5 A;  4A9O A;  4ZQL A;  5I86 A;  3UVX A;  5C87 A;  5DFC A;  4HBV A;  5C7N A;  3MUL A;  5E9I A;  5CU8 A;  3Q2E A;  5HRX A;  2DVV A;  3ZYU A;  5CUC A;  5E74 A;  4QZS A;  3LQJ A;  5DYA A;  4CUQ A;  5HFQ A;  4C67 A;  2YDW A;  4CUU A;  5EGU A;  3UW9 A;  5DY7 A;  4QBM A;  3D7C A;  4YYG A;  4IOO A;  5JI8 A;  4NUE A;  5G4S A;  5HRW A;  4YYM A;  4ALH A;  4MR6 A;  5ENE A;  3G0L A;  4DON A;  1E6I A;  4KV4 A;  4TT2 A;  5CS8 A;  5CPE A;  5DYC A;  4A9N A;  5A7C A;  2FSA A;  4CL9 A;  5EK9 A;  4HXS A;  4NRC A;  4YBM A;  5EQ1 A;  3AQA A;  2L5E A;  4QSQ A;  4YYJ A;  4XUA A;  2MJV B;  4ALG A;  2L85 A;  3LQI A;  5HEM A;  5CY9 A;  4LRG A;  4BJX A;  4YYD A;  5E9Y A;  3RCW A;  3SVF A;  4QR5 A;  5ENB A;  3HMF A;  3P1F A;  2RFJ A;  5F3A A;  2RS9 B;  4O7C A;  3MXF A;  5FFY A;  4HXK A;  5BT3 A;  4Z6I A;  5C4Q A;  4RVR A;  4LYI A;  5D3J A;  5CQ8 A;  4QYL A;  5E3G A;  2F6N A;  4CUR A;  5FE8 A;  4AKN A;  3QZT A;  3P5O A;  4UYE A;  4QSV A;  5CQ4 A;  4O70 A;  3MQM A;  4KCX A;  4CUS A;  4CFL A;  5A85 A;  2DAT A;  3MUK A;  5C85 A;  3LJW A;  5IGL A;  3NXB A;  4HXP A;  4NR9 A;  4TS8 A;  1JM4 B;  4QC3 A;  4BW2 A;  5LVR A;  4A9F A;  4NR6 A;  4IOQ A;  5K29 A;  4NUD A;  4YK0 A;  3JVL A;  5E9V A;  2OO1 A;  3DAI A;  4NYW A;  5LJ2 A;  4NXJ A;  5HFR A;  4HXM A;  5DW1 A;  2WP2 A;  5FE4 A;  4TT4 A;  4O74 A;  5BT4 A;  5AD3 A;  5COI A;  2D82 A;  5EVA A;  4YH4 A;  2I8N A;  4IOR A;  5EWD A;  5FDZ A;  5HEN A;  5LUU A;  3LQH A;  5CQ6 A;  2RNW A;  4Q0O A;  4MEN A;  5FG6 A;  4TYL A;  5E9L A;  4HXO A;  4PS5 A;  5HRV A;  5DFB A;  4O78 A;  5EWH A;  5I88 A;  4XYA A;  4PCE A;  5D3H A;  3I3J A;  2F6J A;  3QZS A;  4UYD A;  5DKD A;  4CFK A;  1N72 A;  3UVD A;  4WHU A;  2DVS A;  4A9I A;  5CZG A;  4HXN A;  5FE6 A;  4NR5 A;  5CFW A;  5I7Y A;  5F5Z A;  2R0Y A;  5L99 A;  3K2J A;  3HME A;  4QEW A;  5L96 A;  4OUF A;  5AME A;  5E7D A;  5AMF A;  3AAD A;  4IR5 A;  4LZ2 A;  4N4F A;  4Z6H A;  4J1P A;  4WHW A;  4YBS A;  3UVY A;  5I7X A;  3U5J A;  4TU6 A;  2RO1 A;  2YQD A;  5FE5 A;  5ENH A;  5ACY A;  5F62 A;  4UIT A;  2YYN A;  4NUC A;  5E9K A;  5F25 A;  4TQN A;  3JVK A;  5A81 A;  3FKM X;  3IU6 A;  5J0D A;  5AD2 A;  2DKW A;  4NR4 A;  5KTX A;  4HBX A;  5F63 A;  5FE3 A;  4ZW1 A;  4QR3 A;  2LSP B;  4YYH A;  4QC1 A;  5A5R A;  2R0S A;  5FFV A;  4NR7 A;  4J3I A;  4HBY A;  4NS5 A;  4QSU A;  5EIS A;  5H1T A;  5FH8 A;  4PY6 A;  4A9K A;  4KV1 A;  5CQ3 A;  5E9M A;  5EPR A;  5IG6 A;  5DLX A;  5DKC A;  5A5O A;  4YYI A;  5A5S A;  4YH3 A;  3JVM A;  4QSP A;  5LJ0 A;  5IBN A;  4NQN A;  4UIX A;  4A9L A;  5A5N A;  5DFD A;  2RNX A;  5ETD A;  4PCI A;  4QR4 A;  5KU3 A;  4HBW A;  5CQ7 A;  5DKH A;  1ZS5 A;  4UIZ A;  4NYX A;  5D26 A;  3QZV A;  4PTB A;  4A9E A;  5HQ5 A;  3HMH A;  4BW3 A;  4XY9 A;  4XY8 A;  5LJ1 A;  3SVH A;  5CRZ A;  5KHM A;  5HQ7 A;  5ENJ A;  5BT5 A;  4BHW A;  4O76 A;  5EWW A;  5A83 A;  5II1 A;  5A82 A;  5CQ5 A;  5JWM A;  1WUM A;  5D24 A;  4MEO A;  3SVG A;  5L8T A;  4O7F A;  4TTE A;  5D25 A;  5HJC A;  5CUD A;  3U5L A;  4QSR A;  4NRB A;  5A5Q A;  5D3P A;  2YEM A;  4TZ2 A;  4WIV A;  2YW5 A;  5F61 A;  3S92 A;  3O35 A;  4HXL A;  5HEL A;  4QY4 A;  4CLB A;  5EP7 A;  4UYF A;  4Q0N A;  5D3R A;  5FE1 A;  2G4A A;  5FFW A;  2WP1 A;  5EM3 A;  4IR6 A;  3G0J A;  4YC9 A;  2L84 A;  5HLS A;  4UYG A;  4O71 A;  5FB0 A;  4A9H A;  5I29 A;  5FE9 A;  4O7A A;  4NQM A;  4QUU A;  5H1U A;  4TZ8 A;  3U5N A;  5D3L A;  5ENG A;  5C8G A;  2DWW A;  2DVQ A;  5FE0 A;  5LKZ A;  5EWC A;  2E3K A;  2R10 A;  2KTB B;  4OGJ A;  5DBM A;  4FLP A;  4LYW A;  4UIV A;  5F36 A;  5EPS A;  5CQA A;  4MR5 A;  5KO4 A;  4LC2 A;  2E7N A;  4N4H A;  5II2 A;  4UIW A;  5TB6 A;  5DX4 A;  5D3S A;  5TCM A;  3DWY A;  4PKL A;  5FH7 A;  4A9M A;  2NXB A;  4QST A;  5KTW A;  5DYX A;  2R0V A;  3UVW A;  4MR3 A;  4CUP A;  2YEL A;  4YAT A;  5DYU A;  3U5P A;  2DVR A;  4BW1 A;  5F1L A;  4LZS A;  4O7B A;  4NR8 A;  5H85 A;  5D3T A;  3O34 A;  5C89 A;  5EA1 A;  4YBT A;  3UV4 A;  3TLP A;  5DW2 A;  5F60 A;  4YY4 A;  4MEQ A;  4O77 A;  2H60 A;  4QEV A;  4QSS A;  5IGN A;  5IGK A;  5F2P A;  3IU5 A;  2GRC A;  4QEU A;  4UYH A;  5CUB A;  5LKU A;  5FBX A;  4ZC9 A;  2OUO A;  5E3D A;  5ENF A;  5LVQ A;  5EIC A;  4BW4 A;  1JSP B;  4X2I A;  4J0R A;  5FH6 A;  5CTL A;  5L98 A;  4J0S A;  4HXR A;  3P1D A;  4Y03 A;  3U5K A;  4TU4 A;  5E0R A;  4E96 A;  5KTU A;  3ONI A;  4O7E A;  5D0C A;  4A9J A;  4UIU A;  4QB3 A;  5CUG A;  4C66 A;  2I7K A;  4LYS A;  4O75 A;  5D3N A;  3S91 A;  4NYV A;  5CRM A;  5ENC A;  4F3I A;  3U5M A;  4QSX A;  3O36 A;  4UYF B;  2E7O A;  5IID A;  1EQF A;  4IR4 A;  3JVJ A;  3O37 A;  4QYD A;  4YAD A;  5EPB A;  5ETB A;  1X0J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...