4UYFA

N-terminal bromodomain of human brd2 with i-bet726 (gsk1324726a)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
119
structure length
119
Chain Sequence
NPGRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKIFLQKVASMPQEEQELVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords BROMODOMAIN-CONTAINING PROTEIN 2
publication title The Discovery of I-Bet726 (Gsk1324726A), a Potent Tetrahydroquinoline Apoa1 Up-Regulator and Selective Bet Bromodomain Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
total genus 39
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2014-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4uyfA00
3MB4A 3UW9A 4A9IA 5FH8A 5DY7A 1JSPB 4Z93A 3UV5A 3P1CA 5I40A 4UITA 4A9MA 4QSQA 5LUUA 3LQHA 5I89A 4NR5A 4QYLA 4LRGA 4HBVA 5FE0A 4WHUA 3QZTA 5FE2A 4YC9A 4OUFA 4QUTA 4UYEA 5I80A 2DVQA 4NQMA 3JVMA 5CQ4A 4YH4A 2FSAA 4QSRA 4TTEA 2KTBB 5AD3A 5ENGA 4NR7A 5EU1A 5C4QA 2E3KA 4QUUA 4TS8A 5D3SA 3DAIA 3UVYA 5F5ZA 4YH3A 3JVKA 4LYWA 5E9KA 5F3AA 4BW2A 4HXKA 3ZYUA 4LYIA 3DWYA 4O77A 2R10A 5CQ6A 5E9IA 4O7BA 4XY8A 4MR5A 5DKHA 4J0RA 5KTUA 5I7YA 1F68A 4O76A 5E9MA 2R0SA 5F36A 4CFLA 5LKUA 2YEMA 4Q0OA 4O7AA 5L99A 4WHWA 5F2PA 4UYDA 2G4AA 5CUAA 5EVAA 5FE1A 4BHWA 5HRXA 4TT4A 5JWMA 3HMEA 1X0JA 5EK9A 4YY6A 2L84A 5CUCA 3UVDA 4A9OA 2E7OA 5DYCA 4HBYA 4A9KA 4TT6A 5L96A 4LC2A 2F6NA 5A5NA 5KU3A 5JI8A 4QC1A 2DVRA 5F1HA 4HXRA 4UYFA 4BW3A 2WP1A 4LDFA 4UYFB 5TCMA 5I86A 3U5LA 4PCEA 4Q0NA 5DFBA 4LZ2A 4ZW1A 5DKDA 5IBNA 4QR4A 4Z1QA 5LJ1A 4N4IA 3NXBA 4QC3A 4TQNA 2YDWA 2YELA 3GG3A 4YYHA 5ETDA 5IGLA 5A5RA 5HRWA 4KV1A 4O75A 4CURA 2D82A 5EWWA 5CP5A 2DWWA 5FBXA 3QZVA 4BW4A 5A5OA 4TT2A 5LVQA 3MB3A 3RCWA 4NRBA 1WUMA 3LQJA 3P5OA 3Q2FA 5F61A 3JVJA 5D24A 4RVRA 5FDZA 5LJ2A 4QEUA 5ETBA 2DATA 4PKLA 5IGMA 5C87A 3UVWA 4QEVA 2MJVB 4YADA 4O70A 4PCIA 2DKWA 5I88A 4ALHA 3QZSA 5AMFA 2RI7A 5A7CA 4YATA 4NRAA 4CLBA 5DW2A 5IG6A 4ALGA 3JVLA 5A5QA 4YYNA 2RNYA 5CGPA 5C89A 5LVRA 5II1A 5CRMA 5HQ7A 4YYIA 5L8UA 4J1PA 4WIVA 3G0LA 4OGIA 4A9FA 4PS5A 4ZQLA 5EICA 3K2JA 5EP7A 4J3IA 3SVGA 5J0DA 4HBXA 5HEMA 5C8GA 5IGKA 3D7CA 3AQAA 5D7XA 5F63A 5CY9A 4HXSA 5CUDA 3LQIA 5CTLA 4CL9A 5ENHA 5II2A 2N9GA 2R0VA 2RS9B 4IOQA 4J0SA 4ZC9A 3U5OA 5KTWA 5AD2A 5FE6A 4X2IA 4MR6A 5L97A 1ZS5A 5H1VA 5F1LA 5I83A 3IU6A 3FKMX 5KO4A 4F3IA 5D3RA 3I3JA 4UIVA 4HXLA 4GPJA 5DYUA 4NR8A 5E9LA 5EPSA 2DVSA 4E96A 4PTBA 3HMFA 3U5KA 4IR4A 5EQ1A 4YYKA 4YYMA 4O78A 5L8TA 4MR3A 5LKZA 4HXPA 4Z1SA 4NYWA 5LJ0A 4KV4A 5G4RA 4NUDA 5ENEA 3O37A 5COIA 5HLSA 5E9YA 5FH7A 4CUSA 4YK0A 4TU6A 5FB0A 4CUQA 4NR4A 5E7DA 5FE5A 5CUEA 3O35A 4O7FA 4Z6IA 5L98A 3UV4A 3U5JA 5D3LA 4KCXA 5CUBA 5EISA 3ONIA 4MEPA 5D3TA 4NS5A 5FH6A 5AMEA 2E7NA 4N4FA 3SVHA 4XUAA 4NQNA 3U5MA 5FG5A 4A9HA 5D3PA 5CQ5A 5I1QA 5F62A 5A5PA 1EQFA 4QSPA 4LZSA 5HENA 4CUPA 5CUGA 4XYAA 4O7EA 5FE9A 2YYNA 4UIUA 5HFQA 5CQAA 5EI4A 5ENIA 2OO1A 2OSSA 4QZSA 5A82A 5E0RA 4QR3A 5E9VA 4C67A 4UIYA 5CZGA 4YAXA 4QSXA 4YBSA 2L85A 4DONA 4YYGA 5TB6A 5D3HA 3G0JA 5I7XA 5H85A 5E73A 4O71A 5ENBA 5IGNA 5EWVA 4NR9A 4YBMA 2R0YA 5EWHA 5CQ7A 4UYGA 2YQDA 5FFYA 5D3JA 4XY9A 4QNSA 5C85A 3LXJA 4FLPA 4IORA 1JM4B 5CS8A 4QB3A 5EM3A 5BT5A 3IU5A 4A9EA 4LYSA 3HMHA 5DYXA 5A85A 4IOOA 5F25A 5DFCA 4UIZA 2GRCA 4HXOA 5H1UA 5FFVA 4IR3A 3SVFA 4O72A 4A9NA 5E3DA 3AADA 5CRZA 2RNXA 4HXMA 4MENA 4N3WA 5D25A 5A5SA 5CU8A 3P1FA 5EWDA 4QSSA 4N4GA 4N4HA 4OGJA 5FE8A 4IR5A 4MR4A 5EPRA 3U5NA 5CQ8A 5EPBA 3U5PA 5HELA 4YBTA 5A83A 4BW1A 4O74A 4NYXA 5CQTA 5H1TA 5CPEA 4YY4A 3P1EA 2RFJA 5FFWA 1E6IA 4PY6A 3O34A 4XUBA 4QBMA 5KTXA 5BT4A 3MULA 4LZRA 4AKNA 5LKXA 5HM0A 5CFWA 4QSWA 4NRCA 3P1DA 5KHMA 5ENFA 5FE7A 3MQMA 4QSUA 5HQ5A 4NUEA 2OUOA 4HBWA 2NXBA 5DBMA 5DYAA 5ENJA 5ENCA 3S92A 3TLPA 5IIDA 2F6JA 5HCLA 2D9EA 4CUUA 5DLZA 5CQ3A 4BJXA 5DX4A 5HQ6A 2L5EA 5D0CA 5DFDA 5ACYA 5EV9A 2DVVA 5HRVA 4NR6A 2I8NA 4O7CA 2RNWA 4TYLA 4Z6HA 5DW1A 5HFRA 2YW5A 1N72A 2I7KA 5EA1A 3S91A 4TZ8A 4MEOA 4Y03A 5FG4A 4YYDA 4NYVA 4A9LA 2H60A 5E74A 4HXNA 5FB1A 4NXJA 3O36A 4QSTA 4QY4A 4C66A 5FE3A 4UYHA 5C7NA 5EWCA 5LKTA 5BT3A 4QSVA 4NUCA 4TU4A 3UV2A 4CUTA 5F60A 5HJCA 2LSPB 4LR6A 5I29A 2RO1A 4IR6A 4CFKA 5DKCA 5EGUA 5G4SA 4YYJA 2YEKA 4UIXA 4MEQA 4QYDA 4YABA 3O33A 5E3GA 4UIWA 5A81A 4TZ2A 3Q2EA 4QEWA 1WUGA 3UVXA 4A9JA 5D3NA 2WP2A 5D26A 3MXFA 4QR5A 5FG6A 3MUKA 3LJWA 5K29A 5FE4A 5DLXA
chains in the Genus database with same CATH superfamily
3MB4A 3UW9A 4A9IA 5FH8A 5DY7A 1JSPB 4Z93A 3UV5A 3P1CA 5I40A 4UITA 4A9MA 4QSQA 5LUUA 3LQHA 5I89A 4NR5A 4QYLA 4LRGA 4HBVA 5FE0A 4WHUA 3QZTA 5FE2A 4YC9A 4OUFA 4QUTA 4UYEA 5I80A 2DVQA 4NQMA 3JVMA 5CQ4A 4YH4A 2FSAA 4QSRA 4TTEA 2KTBB 5AD3A 5ENGA 4NR7A 5EU1A 5C4QA 2E3KA 4QUUA 4TS8A 5D3SA 3DAIA 3UVYA 5F5ZA 4YH3A 3JVKA 4LYWA 5E9KA 5F3AA 4BW2A 4HXKA 3ZYUA 4LYIA 3DWYA 4O77A 2R10A 5CQ6A 5E9IA 4O7BA 4XY8A 4MR5A 5DKHA 4J0RA 5KTUA 5I7YA 1F68A 4O76A 5E9MA 2R0SA 5F36A 4CFLA 5LKUA 2YEMA 4Q0OA 4O7AA 5L99A 4WHWA 5F2PA 4UYDA 2G4AA 5CUAA 5EVAA 5FE1A 4BHWA 5HRXA 4AKIA 4TT4A 5JWMA 3HMEA 1X0JA 5EK9A 4YY6A 2L84A 5CUCA 3UVDA 4A9OA 2E7OA 5DYCA 4HBYA 4A9KA 4TT6A 5L96A 4LC2A 2F6NA 5A5NA 4AI6A 5KU3A 3VKHA 5JI8A 4QC1A 2DVRA 5F1HA 4HXRA 4UYFA 4BW3A 2WP1A 4LDFA 4UYFB 5TCMA 5I86A 1ZKRA 3U5LA 4PCEA 4Q0NA 5DFBA 4LZ2A 4ZW1A 5DKDA 5IBNA 4QR4A 4Z1QA 5LJ1A 4N4IA 3NXBA 4QC3A 4TQNA 2YDWA 2YELA 3GG3A 4YYHA 5ETDA 5IGLA 5A5RA 5HRWA 4KV1A 4O75A 4CURA 2D82A 5EWWA 5CP5A 2DWWA 5FBXA 3QZVA 4BW4A 5A5OA 4TT2A 5LVQA 3MB3A 3RCWA 4NRBA 1WUMA 3LQJA 3P5OA 3Q2FA 5F61A 3JVJA 5D24A 4RVRA 5FDZA 5LJ2A 4QEUA 5ETBA 2DATA 4PKLA 5IGMA 5C87A 3UVWA 4QEVA 2MJVB 4YADA 4O70A 4PCIA 2DKWA 5I88A 4ALHA 3QZSA 5AMFA 2RI7A 5A7CA 4YATA 4NRAA 4CLBA 5DW2A 5IG6A 4ALGA 3JVLA 5A5QA 4YYNA 2RNYA 5CGPA 5C89A 5LVRA 5II1A 5CRMA 5HQ7A 4YYIA 5L8UA 4J1PA 4WIVA 3G0LA 3ERRA 4OGIA 4A9FA 4PS5A 4ZQLA 5EICA 3K2JA 5EP7A 4J3IA 3SVGA 5J0DA 4HBXA 5HEMA 5C8GA 5IGKA 3D7CA 3AQAA 5D7XA 5F63A 5CY9A 4HXSA 5CUDA 3LQIA 5CTLA 4CL9A 5ENHA 5II2A 2N9GA 2R0VA 2RS9B 4IOQA 4J0SA 4ZC9A 3U5OA 5KTWA 5AD2A 3VKGA 5FE6A 4X2IA 4MR6A 5L97A 1ZS5A 5H1VA 5F1LA 5I83A 3IU6A 3FKMX 5KO4A 4F3IA 5D3RA 3I3JA 4UIVA 4HXLA 4GPJA 5DYUA 4NR8A 5E9LA 5EPSA 2DVSA 4E96A 4PTBA 3HMFA 3U5KA 4IR4A 5EQ1A 4YYKA 4YYMA 4O78A 5L8TA 4MR3A 5LKZA 4HXPA 4Z1SA 4NYWA 5LJ0A 4KV4A 5G4RA 4NUDA 5ENEA 3O37A 5COIA 5HLSA 5E9YA 5FH7A 4CUSA 4YK0A 4TU6A 5FB0A 4CUQA 4NR4A 5E7DA 5FE5A 5CUEA 3O35A 4O7FA 4Z6IA 5L98A 3UV4A 3U5JA 5D3LA 4KCXA 5CUBA 5EISA 3ONIA 4MEPA 5D3TA 4NS5A 5FH6A 5AMEA 2E7NA 4N4FA 3SVHA 4XUAA 4NQNA 3U5MA 5FG5A 4A9HA 5D3PA 5CQ5A 5I1QA 5F62A 5A5PA 1EQFA 4QSPA 4LZSA 5HENA 4CUPA 5CUGA 4XYAA 4O7EA 5FE9A 2YYNA 4UIUA 5HFQA 5CQAA 5EI4A 5ENIA 2OO1A 2OSSA 4QZSA 2EJNA 5A82A 5E0RA 4QR3A 5E9VA 4C67A 4UIYA 5CZGA 4YAXA 4QSXA 4YBSA 2L85A 4DONA 4YYGA 5TB6A 5D3HA 3G0JA 5I7XA 5H85A 5E73A 4O71A 5ENBA 5IGNA 5EWVA 4NR9A 4YBMA 2R0YA 5EWHA 5CQ7A 4UYGA 2YQDA 5FFYA 5D3JA 4XY9A 4QNSA 5C85A 3LXJA 4FLPA 4IORA 1JM4B 5CS8A 4QB3A 5EM3A 5BT5A 3IU5A 4A9EA 4LYSA 3HMHA 5DYXA 5A85A 4IOOA 5F25A 5DFCA 4AKGA 4UIZA 2GRCA 4HXOA 5H1UA 5FFVA 4IR3A 3SVFA 4O72A 4A9NA 5E3DA 3AADA 5CRZA 2RNXA 4HXMA 4MENA 4N3WA 5D25A 5A5SA 5CU8A 3P1FA 5EWDA 4QSSA 4N4GA 4N4HA 4OGJA 5FE8A 4IR5A 4MR4A 5EPRA 3U5NA 5CQ8A 5EPBA 3U5PA 5HELA 4YBTA 5A83A 4BW1A 4O74A 4NYXA 5CQTA 5H1TA 5CPEA 4YY4A 3P1EA 2RFJA 5FFWA 1E6IA 4PY6A 3O34A 4XUBA 4QBMA 5KTXA 5BT4A 3MULA 4LZRA 4AKNA 5LKXA 5HM0A 5CFWA 4QSWA 4NRCA 3P1DA 5KHMA 5ENFA 5FE7A 3MQMA 4QSUA 5HQ5A 4NUEA 2OUOA 4HBWA 2NXBA 5DBMA 5DYAA 5ENJA 5ENCA 3S92A 3TLPA 5IIDA 2F6JA 5HCLA 2D9EA 4CUUA 5DLZA 5CQ3A 4BJXA 5DX4A 5HQ6A 2L5EA 5D0CA 5DFDA 5ACYA 5EV9A 2DVVA 5HRVA 4NR6A 2I8NA 4O7CA 2RNWA 4TYLA 4Z6HA 5DW1A 5HFRA 2YW5A 1N72A 2I7KA 5EA1A 3S91A 4TZ8A 4MEOA 4Y03A 5FG4A 4AKHA 4YYDA 4NYVA 4A9LA 2H60A 5E74A 4HXNA 5FB1A 4NXJA 3O36A 4QSTA 4QY4A 4C66A 5FE3A 4UYHA 5C7NA 5EWCA 5LKTA 5BT3A 4QSVA 3D1DA 4NUCA 4TU4A 3UV2A 4CUTA 5F60A 5HJCA 2LSPB 4LR6A 5I29A 2RO1A 4IR6A 4CFKA 5DKCA 1PUOA 5EGUA 5G4SA 4YYJA 2YEKA 4UIXA 4MEQA 4QYDA 4YABA 3O33A 5E3GA 4UIWA 5A81A 4TZ2A 3Q2EA 4QEWA 1WUGA 3UVXA 4A9JA 5D3NA 2WP2A 5D26A 3MXFA 4QR5A 5FG6A 3MUKA 3LJWA 3D1BA 5K29A 5FE4A 5DLXA
chains in the Genus database with same CATH topology
3MB4A 3UW9A 4A9IA 5FH8A 5DY7A 1JSPB 4Z93A 3UV5A 3P1CA 5I40A 4UITA 4A9MA 4QSQA 5LUUA 3LQHA 5I89A 4NR5A 4QYLA 4LRGA 4HBVA 5FE0A 4WHUA 3QZTA 5FE2A 4YC9A 4OUFA 4QUTA 4UYEA 5I80A 2DVQA 4NQMA 3JVMA 5CQ4A 4YH4A 2FSAA 4QSRA 4TTEA 2KTBB 5AD3A 5ENGA 4NR7A 5EU1A 5C4QA 2E3KA 4QUUA 4TS8A 5D3SA 3DAIA 3UVYA 5F5ZA 4YH3A 3JVKA 4LYWA 5E9KA 5F3AA 4BW2A 4HXKA 3ZYUA 4LYIA 3DWYA 4O77A 2R10A 5CQ6A 5E9IA 4O7BA 4XY8A 4MR5A 5DKHA 4J0RA 5KTUA 5I7YA 1F68A 4O76A 5E9MA 2R0SA 5F36A 4CFLA 5LKUA 2YEMA 4Q0OA 4O7AA 5L99A 4WHWA 5F2PA 4UYDA 2G4AA 5CUAA 5EVAA 5FE1A 4BHWA 5HRXA 4TT4A 5JWMA 3HMEA 1X0JA 5EK9A 4YY6A 2L84A 5CUCA 3UVDA 4A9OA 2E7OA 5DYCA 4HBYA 4A9KA 4TT6A 5L96A 4LC2A 2F6NA 5A5NA 5KU3A 5JI8A 4QC1A 2DVRA 5F1HA 4HXRA 4UYFA 4BW3A 2WP1A 4LDFA 4UYFB 5TCMA 5I86A 3U5LA 4PCEA 4Q0NA 5DFBA 4LZ2A 4ZW1A 5DKDA 5IBNA 4QR4A 4Z1QA 5LJ1A 4N4IA 3NXBA 4QC3A 4TQNA 2YDWA 2YELA 3GG3A 4YYHA 5ETDA 5IGLA 5A5RA 5HRWA 4KV1A 4O75A 4CURA 2D82A 5EWWA 5CP5A 2DWWA 5FBXA 3QZVA 4BW4A 5A5OA 4TT2A 5LVQA 3MB3A 3RCWA 4NRBA 1WUMA 3LQJA 3P5OA 3Q2FA 5F61A 3JVJA 5D24A 4RVRA 5FDZA 5LJ2A 4QEUA 5ETBA 2DATA 4PKLA 5IGMA 5C87A 3UVWA 4QEVA 2MJVB 4YADA 4O70A 4PCIA 2DKWA 5I88A 4ALHA 3QZSA 5AMFA 2RI7A 5A7CA 4YATA 4NRAA 4CLBA 5DW2A 5IG6A 4ALGA 3JVLA 5A5QA 4YYNA 2RNYA 5CGPA 5C89A 5LVRA 5II1A 5CRMA 5HQ7A 4YYIA 5L8UA 4J1PA 4WIVA 3G0LA 4OGIA 4A9FA 4PS5A 4ZQLA 5EICA 3K2JA 5EP7A 4J3IA 3SVGA 5J0DA 4HBXA 5HEMA 5C8GA 5IGKA 3D7CA 3AQAA 5D7XA 5F63A 5CY9A 4HXSA 5CUDA 3LQIA 5CTLA 4CL9A 5ENHA 5II2A 2N9GA 2R0VA 2RS9B 4IOQA 4J0SA 4ZC9A 3U5OA 5KTWA 5AD2A 5FE6A 4X2IA 4MR6A 5L97A 1ZS5A 5H1VA 5F1LA 5I83A 3IU6A 3FKMX 5KO4A 4F3IA 5D3RA 3I3JA 4UIVA 4HXLA 4GPJA 5DYUA 4NR8A 5E9LA 5EPSA 2DVSA 4E96A 4PTBA 3HMFA 3U5KA 4IR4A 5EQ1A 4YYKA 4YYMA 4O78A 5L8TA 4MR3A 5LKZA 4HXPA 4Z1SA 4NYWA 5LJ0A 4KV4A 5G4RA 4NUDA 5ENEA 3O37A 5COIA 5HLSA 5E9YA 5FH7A 4CUSA 4YK0A 4TU6A 5FB0A 4CUQA 4NR4A 5E7DA 5FE5A 5CUEA 3O35A 4O7FA 4Z6IA 5L98A 3UV4A 3U5JA 5D3LA 4KCXA 5CUBA 5EISA 3ONIA 4MEPA 5D3TA 4NS5A 5FH6A 5AMEA 2E7NA 4N4FA 3SVHA 4XUAA 4NQNA 3U5MA 5FG5A 4A9HA 5D3PA 5CQ5A 5I1QA 5F62A 5A5PA 1EQFA 4QSPA 4LZSA 5HENA 4CUPA 5CUGA 4XYAA 4O7EA 5FE9A 2YYNA 4UIUA 5HFQA 5CQAA 5EI4A 5ENIA 2OO1A 2OSSA 4QZSA 5A82A 5E0RA 4QR3A 5E9VA 4C67A 4UIYA 5CZGA 4YAXA 4QSXA 4YBSA 2L85A 4DONA 4YYGA 5TB6A 5D3HA 3G0JA 5I7XA 5H85A 5E73A 4O71A 5ENBA 5IGNA 5EWVA 4NR9A 4YBMA 2R0YA 5EWHA 5CQ7A 4UYGA 2YQDA 5FFYA 5D3JA 4XY9A 4QNSA 5C85A 3LXJA 4FLPA 4IORA 1JM4B 5CS8A 4QB3A 5EM3A 5BT5A 3IU5A 4A9EA 4LYSA 3HMHA 5DYXA 5A85A 4IOOA 5F25A 5DFCA 4UIZA 2GRCA 4HXOA 5H1UA 5FFVA 4IR3A 3SVFA 4O72A 4A9NA 5E3DA 3AADA 5CRZA 2RNXA 4HXMA 4MENA 4N3WA 5D25A 5A5SA 5CU8A 3P1FA 5EWDA 4QSSA 4N4GA 4N4HA 4OGJA 5FE8A 4IR5A 4MR4A 5EPRA 3U5NA 5CQ8A 5EPBA 3U5PA 5HELA 4YBTA 5A83A 4BW1A 4O74A 4NYXA 5CQTA 5H1TA 5CPEA 4YY4A 3P1EA 2RFJA 5FFWA 1E6IA 4PY6A 3O34A 4XUBA 4QBMA 5KTXA 5BT4A 3MULA 4LZRA 4AKNA 5LKXA 5HM0A 5CFWA 4QSWA 4NRCA 3P1DA 5KHMA 5ENFA 5FE7A 3MQMA 4QSUA 5HQ5A 4NUEA 2OUOA 4HBWA 2NXBA 5DBMA 5DYAA 5ENJA 5ENCA 3S92A 3TLPA 5IIDA 2F6JA 5HCLA 2D9EA 4CUUA 5DLZA 5CQ3A 4BJXA 5DX4A 5HQ6A 2L5EA 5D0CA 5DFDA 5ACYA 5EV9A 2DVVA 5HRVA 4NR6A 2I8NA 4O7CA 2RNWA 4TYLA 4Z6HA 5DW1A 5HFRA 2YW5A 1N72A 2I7KA 5EA1A 3S91A 4TZ8A 4MEOA 4Y03A 5FG4A 4YYDA 4NYVA 4A9LA 2H60A 5E74A 4HXNA 5FB1A 4NXJA 3O36A 4QSTA 4QY4A 4C66A 5FE3A 4UYHA 5C7NA 5EWCA 5LKTA 5BT3A 4QSVA 4NUCA 4TU4A 3UV2A 4CUTA 5F60A 5HJCA 2LSPB 4LR6A 5I29A 2RO1A 4IR6A 4CFKA 5DKCA 5EGUA 5G4SA 4YYJA 2YEKA 4UIXA 4MEQA 4QYDA 4YABA 3O33A 5E3GA 4UIWA 5A81A 4TZ2A 3Q2EA 4QEWA 1WUGA 3UVXA 4A9JA 5D3NA 2WP2A 5D26A 3MXFA 4QR5A 5FG6A 3MUKA 3LJWA 5K29A 5FE4A 5DLXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MB4 A;  3UW9 A;  4A9I A;  5FH8 A;  5DY7 A;  1JSP B;  4Z93 A;  3UV5 A;  3P1C A;  5I40 A;  4UIT A;  4A9M A;  4QSQ A;  5LUU A;  3LQH A;  5I89 A;  4NR5 A;  4QYL A;  4LRG A;  4HBV A;  5FE0 A;  4WHU A;  3QZT A;  5FE2 A;  4YC9 A;  4OUF A;  4QUT A;  4UYE A;  5I80 A;  2DVQ A;  4NQM A;  3JVM A;  5CQ4 A;  4YH4 A;  2FSA A;  4QSR A;  4TTE A;  2KTB B;  5AD3 A;  5ENG A;  4NR7 A;  5EU1 A;  5C4Q A;  2E3K A;  4QUU A;  4TS8 A;  5D3S A;  3DAI A;  3UVY A;  5F5Z A;  4YH3 A;  3JVK A;  4LYW A;  5E9K A;  5F3A A;  4BW2 A;  4HXK A;  3ZYU A;  4LYI A;  3DWY A;  4O77 A;  2R10 A;  5CQ6 A;  5E9I A;  4O7B A;  4XY8 A;  4MR5 A;  5DKH A;  4J0R A;  5KTU A;  5I7Y A;  1F68 A;  4O76 A;  5E9M A;  2R0S A;  5F36 A;  4CFL A;  5LKU A;  2YEM A;  4Q0O A;  4O7A A;  5L99 A;  4WHW A;  5F2P A;  4UYD A;  2G4A A;  5CUA A;  5EVA A;  5FE1 A;  4BHW A;  5HRX A;  4TT4 A;  5JWM A;  3HME A;  1X0J A;  5EK9 A;  4YY6 A;  2L84 A;  5CUC A;  3UVD A;  4A9O A;  2E7O A;  5DYC A;  4HBY A;  4A9K A;  4TT6 A;  5L96 A;  4LC2 A;  2F6N A;  5A5N A;  5KU3 A;  5JI8 A;  4QC1 A;  2DVR A;  5F1H A;  4HXR A;  4UYF A;  4BW3 A;  2WP1 A;  4LDF A;  4UYF B;  5TCM A;  5I86 A;  3U5L A;  4PCE A;  4Q0N A;  5DFB A;  4LZ2 A;  4ZW1 A;  5DKD A;  5IBN A;  4QR4 A;  4Z1Q A;  5LJ1 A;  4N4I A;  3NXB A;  4QC3 A;  4TQN A;  2YDW A;  2YEL A;  3GG3 A;  4YYH A;  5ETD A;  5IGL A;  5A5R A;  5HRW A;  4KV1 A;  4O75 A;  4CUR A;  2D82 A;  5EWW A;  5CP5 A;  2DWW A;  5FBX A;  3QZV A;  4BW4 A;  5A5O A;  4TT2 A;  5LVQ A;  3MB3 A;  3RCW A;  4NRB A;  1WUM A;  3LQJ A;  3P5O A;  3Q2F A;  5F61 A;  3JVJ A;  5D24 A;  4RVR A;  5FDZ A;  5LJ2 A;  4QEU A;  5ETB A;  2DAT A;  4PKL A;  5IGM A;  5C87 A;  3UVW A;  4QEV A;  2MJV B;  4YAD A;  4O70 A;  4PCI A;  2DKW A;  5I88 A;  4ALH A;  3QZS A;  5AMF A;  2RI7 A;  5A7C A;  4YAT A;  4NRA A;  4CLB A;  5DW2 A;  5IG6 A;  4ALG A;  3JVL A;  5A5Q A;  4YYN A;  2RNY A;  5CGP A;  5C89 A;  5LVR A;  5II1 A;  5CRM A;  5HQ7 A;  4YYI A;  5L8U A;  4J1P A;  4WIV A;  3G0L A;  4OGI A;  4A9F A;  4PS5 A;  4ZQL A;  5EIC A;  3K2J A;  5EP7 A;  4J3I A;  3SVG A;  5J0D A;  4HBX A;  5HEM A;  5C8G A;  5IGK A;  3D7C A;  3AQA A;  5D7X A;  5F63 A;  5CY9 A;  4HXS A;  5CUD A;  3LQI A;  5CTL A;  4CL9 A;  5ENH A;  5II2 A;  2N9G A;  2R0V A;  2RS9 B;  4IOQ A;  4J0S A;  4ZC9 A;  3U5O A;  5KTW A;  5AD2 A;  5FE6 A;  4X2I A;  4MR6 A;  5L97 A;  1ZS5 A;  5H1V A;  5F1L A;  5I83 A;  3IU6 A;  3FKM X;  5KO4 A;  4F3I A;  5D3R A;  3I3J A;  4UIV A;  4HXL A;  4GPJ A;  5DYU A;  4NR8 A;  5E9L A;  5EPS A;  2DVS A;  4E96 A;  4PTB A;  3HMF A;  3U5K A;  4IR4 A;  5EQ1 A;  4YYK A;  4YYM A;  4O78 A;  5L8T A;  4MR3 A;  5LKZ A;  4HXP A;  4Z1S A;  4NYW A;  5LJ0 A;  4KV4 A;  5G4R A;  4NUD A;  5ENE A;  3O37 A;  5COI A;  5HLS A;  5E9Y A;  5FH7 A;  4CUS A;  4YK0 A;  4TU6 A;  5FB0 A;  4CUQ A;  4NR4 A;  5E7D A;  5FE5 A;  5CUE A;  3O35 A;  4O7F A;  4Z6I A;  5L98 A;  3UV4 A;  3U5J A;  5D3L A;  4KCX A;  5CUB A;  5EIS A;  3ONI A;  4MEP A;  5D3T A;  4NS5 A;  5FH6 A;  5AME A;  2E7N A;  4N4F A;  3SVH A;  4XUA A;  4NQN A;  3U5M A;  5FG5 A;  4A9H A;  5D3P A;  5CQ5 A;  5I1Q A;  5F62 A;  5A5P A;  1EQF A;  4QSP A;  4LZS A;  5HEN A;  4CUP A;  5CUG A;  4XYA A;  4O7E A;  5FE9 A;  2YYN A;  4UIU A;  5HFQ A;  5CQA A;  5EI4 A;  5ENI A;  2OO1 A;  2OSS A;  4QZS A;  5A82 A;  5E0R A;  4QR3 A;  5E9V A;  4C67 A;  4UIY A;  5CZG A;  4YAX A;  4QSX A;  4YBS A;  2L85 A;  4DON A;  4YYG A;  5TB6 A;  5D3H A;  3G0J A;  5I7X A;  5H85 A;  5E73 A;  4O71 A;  5ENB A;  5IGN A;  5EWV A;  4NR9 A;  4YBM A;  2R0Y A;  5EWH A;  5CQ7 A;  4UYG A;  2YQD A;  5FFY A;  5D3J A;  4XY9 A;  4QNS A;  5C85 A;  3LXJ A;  4FLP A;  4IOR A;  1JM4 B;  5CS8 A;  4QB3 A;  5EM3 A;  5BT5 A;  3IU5 A;  4A9E A;  4LYS A;  3HMH A;  5DYX A;  5A85 A;  4IOO A;  5F25 A;  5DFC A;  4UIZ A;  2GRC A;  4HXO A;  5H1U A;  5FFV A;  4IR3 A;  3SVF A;  4O72 A;  4A9N A;  5E3D A;  3AAD A;  5CRZ A;  2RNX A;  4HXM A;  4MEN A;  4N3W A;  5D25 A;  5A5S A;  5CU8 A;  3P1F A;  5EWD A;  4QSS A;  4N4G A;  4N4H A;  4OGJ A;  5FE8 A;  4IR5 A;  4MR4 A;  5EPR A;  3U5N A;  5CQ8 A;  5EPB A;  3U5P A;  5HEL A;  4YBT A;  5A83 A;  4BW1 A;  4O74 A;  4NYX A;  5CQT A;  5H1T A;  5CPE A;  4YY4 A;  3P1E A;  2RFJ A;  5FFW A;  1E6I A;  4PY6 A;  3O34 A;  4XUB A;  4QBM A;  5KTX A;  5BT4 A;  3MUL A;  4LZR A;  4AKN A;  5LKX A;  5HM0 A;  5CFW A;  4QSW A;  4NRC A;  3P1D A;  5KHM A;  5ENF A;  5FE7 A;  3MQM A;  4QSU A;  5HQ5 A;  4NUE A;  2OUO A;  4HBW A;  2NXB A;  5DBM A;  5DYA A;  5ENJ A;  5ENC A;  3S92 A;  3TLP A;  5IID A;  2F6J A;  5HCL A;  2D9E A;  4CUU A;  5DLZ A;  5CQ3 A;  4BJX A;  5DX4 A;  5HQ6 A;  2L5E A;  5D0C A;  5DFD A;  5ACY A;  5EV9 A;  2DVV A;  5HRV A;  4NR6 A;  2I8N A;  4O7C A;  2RNW A;  4TYL A;  4Z6H A;  5DW1 A;  5HFR A;  2YW5 A;  1N72 A;  2I7K A;  5EA1 A;  3S91 A;  4TZ8 A;  4MEO A;  4Y03 A;  5FG4 A;  4YYD A;  4NYV A;  4A9L A;  2H60 A;  5E74 A;  4HXN A;  5FB1 A;  4NXJ A;  3O36 A;  4QST A;  4QY4 A;  4C66 A;  5FE3 A;  4UYH A;  5C7N A;  5EWC A;  5LKT A;  5BT3 A;  4QSV A;  4NUC A;  4TU4 A;  3UV2 A;  4CUT A;  5F60 A;  5HJC A;  2LSP B;  4LR6 A;  5I29 A;  2RO1 A;  4IR6 A;  4CFK A;  5DKC A;  5EGU A;  5G4S A;  4YYJ A;  2YEK A;  4UIX A;  4MEQ A;  4QYD A;  4YAB A;  3O33 A;  5E3G A;  4UIW A;  5A81 A;  4TZ2 A;  3Q2E A;  4QEW A;  1WUG A;  3UVX A;  4A9J A;  5D3N A;  2WP2 A;  5D26 A;  3MXF A;  4QR5 A;  5FG6 A;  3MUK A;  3LJW A;  5K29 A;  5FE4 A;  5DLX A; 
#chains in the Genus database with same CATH topology
 3MB4 A;  3UW9 A;  4A9I A;  5FH8 A;  5DY7 A;  1JSP B;  4Z93 A;  3UV5 A;  3P1C A;  5I40 A;  4UIT A;  4A9M A;  4QSQ A;  5LUU A;  3LQH A;  5I89 A;  4NR5 A;  4QYL A;  4LRG A;  4HBV A;  5FE0 A;  4WHU A;  3QZT A;  5FE2 A;  4YC9 A;  4OUF A;  4QUT A;  4UYE A;  5I80 A;  2DVQ A;  4NQM A;  3JVM A;  5CQ4 A;  4YH4 A;  2FSA A;  4QSR A;  4TTE A;  2KTB B;  5AD3 A;  5ENG A;  4NR7 A;  5EU1 A;  5C4Q A;  2E3K A;  4QUU A;  4TS8 A;  5D3S A;  3DAI A;  3UVY A;  5F5Z A;  4YH3 A;  3JVK A;  4LYW A;  5E9K A;  5F3A A;  4BW2 A;  4HXK A;  3ZYU A;  4LYI A;  3DWY A;  4O77 A;  2R10 A;  5CQ6 A;  5E9I A;  4O7B A;  4XY8 A;  4MR5 A;  5DKH A;  4J0R A;  5KTU A;  5I7Y A;  1F68 A;  4O76 A;  5E9M A;  2R0S A;  5F36 A;  4CFL A;  5LKU A;  2YEM A;  4Q0O A;  4O7A A;  5L99 A;  4WHW A;  5F2P A;  4UYD A;  2G4A A;  5CUA A;  5EVA A;  5FE1 A;  4BHW A;  5HRX A;  4AKI A;  4TT4 A;  5JWM A;  3HME A;  1X0J A;  5EK9 A;  4YY6 A;  2L84 A;  5CUC A;  3UVD A;  4A9O A;  2E7O A;  5DYC A;  4HBY A;  4A9K A;  4TT6 A;  5L96 A;  4LC2 A;  2F6N A;  5A5N A;  4AI6 A;  5KU3 A;  3VKH A;  5JI8 A;  4QC1 A;  2DVR A;  5F1H A;  4HXR A;  4UYF A;  4BW3 A;  2WP1 A;  4LDF A;  4UYF B;  5TCM A;  5I86 A;  1ZKR A;  3U5L A;  4PCE A;  4Q0N A;  5DFB A;  4LZ2 A;  4ZW1 A;  5DKD A;  5IBN A;  4QR4 A;  4Z1Q A;  5LJ1 A;  4N4I A;  3NXB A;  4QC3 A;  4TQN A;  2YDW A;  2YEL A;  3GG3 A;  4YYH A;  5ETD A;  5IGL A;  5A5R A;  5HRW A;  4KV1 A;  4O75 A;  4CUR A;  2D82 A;  5EWW A;  5CP5 A;  2DWW A;  5FBX A;  3QZV A;  4BW4 A;  5A5O A;  4TT2 A;  5LVQ A;  3MB3 A;  3RCW A;  4NRB A;  1WUM A;  3LQJ A;  3P5O A;  3Q2F A;  5F61 A;  3JVJ A;  5D24 A;  4RVR A;  5FDZ A;  5LJ2 A;  4QEU A;  5ETB A;  2DAT A;  4PKL A;  5IGM A;  5C87 A;  3UVW A;  4QEV A;  2MJV B;  4YAD A;  4O70 A;  4PCI A;  2DKW A;  5I88 A;  4ALH A;  3QZS A;  5AMF A;  2RI7 A;  5A7C A;  4YAT A;  4NRA A;  4CLB A;  5DW2 A;  5IG6 A;  4ALG A;  3JVL A;  5A5Q A;  4YYN A;  2RNY A;  5CGP A;  5C89 A;  5LVR A;  5II1 A;  5CRM A;  5HQ7 A;  4YYI A;  5L8U A;  4J1P A;  4WIV A;  3G0L A;  3ERR A;  4OGI A;  4A9F A;  4PS5 A;  4ZQL A;  5EIC A;  3K2J A;  5EP7 A;  4J3I A;  3SVG A;  5J0D A;  4HBX A;  5HEM A;  5C8G A;  5IGK A;  3D7C A;  3AQA A;  5D7X A;  5F63 A;  5CY9 A;  4HXS A;  5CUD A;  3LQI A;  5CTL A;  4CL9 A;  5ENH A;  5II2 A;  2N9G A;  2R0V A;  2RS9 B;  4IOQ A;  4J0S A;  4ZC9 A;  3U5O A;  5KTW A;  5AD2 A;  3VKG A;  5FE6 A;  4X2I A;  4MR6 A;  5L97 A;  1ZS5 A;  5H1V A;  5F1L A;  5I83 A;  3IU6 A;  3FKM X;  5KO4 A;  4F3I A;  5D3R A;  3I3J A;  4UIV A;  4HXL A;  4GPJ A;  5DYU A;  4NR8 A;  5E9L A;  5EPS A;  2DVS A;  4E96 A;  4PTB A;  3HMF A;  3U5K A;  4IR4 A;  5EQ1 A;  4YYK A;  4YYM A;  4O78 A;  5L8T A;  4MR3 A;  5LKZ A;  4HXP A;  4Z1S A;  4NYW A;  5LJ0 A;  4KV4 A;  5G4R A;  4NUD A;  5ENE A;  3O37 A;  5COI A;  5HLS A;  5E9Y A;  5FH7 A;  4CUS A;  4YK0 A;  4TU6 A;  5FB0 A;  4CUQ A;  4NR4 A;  5E7D A;  5FE5 A;  5CUE A;  3O35 A;  4O7F A;  4Z6I A;  5L98 A;  3UV4 A;  3U5J A;  5D3L A;  4KCX A;  5CUB A;  5EIS A;  3ONI A;  4MEP A;  5D3T A;  4NS5 A;  5FH6 A;  5AME A;  2E7N A;  4N4F A;  3SVH A;  4XUA A;  4NQN A;  3U5M A;  5FG5 A;  4A9H A;  5D3P A;  5CQ5 A;  5I1Q A;  5F62 A;  5A5P A;  1EQF A;  4QSP A;  4LZS A;  5HEN A;  4CUP A;  5CUG A;  4XYA A;  4O7E A;  5FE9 A;  2YYN A;  4UIU A;  5HFQ A;  5CQA A;  5EI4 A;  5ENI A;  2OO1 A;  2OSS A;  4QZS A;  2EJN A;  5A82 A;  5E0R A;  4QR3 A;  5E9V A;  4C67 A;  4UIY A;  5CZG A;  4YAX A;  4QSX A;  4YBS A;  2L85 A;  4DON A;  4YYG A;  5TB6 A;  5D3H A;  3G0J A;  5I7X A;  5H85 A;  5E73 A;  4O71 A;  5ENB A;  5IGN A;  5EWV A;  4NR9 A;  4YBM A;  2R0Y A;  5EWH A;  5CQ7 A;  4UYG A;  2YQD A;  5FFY A;  5D3J A;  4XY9 A;  4QNS A;  5C85 A;  3LXJ A;  4FLP A;  4IOR A;  1JM4 B;  5CS8 A;  4QB3 A;  5EM3 A;  5BT5 A;  3IU5 A;  4A9E A;  4LYS A;  3HMH A;  5DYX A;  5A85 A;  4IOO A;  5F25 A;  5DFC A;  4AKG A;  4UIZ A;  2GRC A;  4HXO A;  5H1U A;  5FFV A;  4IR3 A;  3SVF A;  4O72 A;  4A9N A;  5E3D A;  3AAD A;  5CRZ A;  2RNX A;  4HXM A;  4MEN A;  4N3W A;  5D25 A;  5A5S A;  5CU8 A;  3P1F A;  5EWD A;  4QSS A;  4N4G A;  4N4H A;  4OGJ A;  5FE8 A;  4IR5 A;  4MR4 A;  5EPR A;  3U5N A;  5CQ8 A;  5EPB A;  3U5P A;  5HEL A;  4YBT A;  5A83 A;  4BW1 A;  4O74 A;  4NYX A;  5CQT A;  5H1T A;  5CPE A;  4YY4 A;  3P1E A;  2RFJ A;  5FFW A;  1E6I A;  4PY6 A;  3O34 A;  4XUB A;  4QBM A;  5KTX A;  5BT4 A;  3MUL A;  4LZR A;  4AKN A;  5LKX A;  5HM0 A;  5CFW A;  4QSW A;  4NRC A;  3P1D A;  5KHM A;  5ENF A;  5FE7 A;  3MQM A;  4QSU A;  5HQ5 A;  4NUE A;  2OUO A;  4HBW A;  2NXB A;  5DBM A;  5DYA A;  5ENJ A;  5ENC A;  3S92 A;  3TLP A;  5IID A;  2F6J A;  5HCL A;  2D9E A;  4CUU A;  5DLZ A;  5CQ3 A;  4BJX A;  5DX4 A;  5HQ6 A;  2L5E A;  5D0C A;  5DFD A;  5ACY A;  5EV9 A;  2DVV A;  5HRV A;  4NR6 A;  2I8N A;  4O7C A;  2RNW A;  4TYL A;  4Z6H A;  5DW1 A;  5HFR A;  2YW5 A;  1N72 A;  2I7K A;  5EA1 A;  3S91 A;  4TZ8 A;  4MEO A;  4Y03 A;  5FG4 A;  4AKH A;  4YYD A;  4NYV A;  4A9L A;  2H60 A;  5E74 A;  4HXN A;  5FB1 A;  4NXJ A;  3O36 A;  4QST A;  4QY4 A;  4C66 A;  5FE3 A;  4UYH A;  5C7N A;  5EWC A;  5LKT A;  5BT3 A;  4QSV A;  3D1D A;  4NUC A;  4TU4 A;  3UV2 A;  4CUT A;  5F60 A;  5HJC A;  2LSP B;  4LR6 A;  5I29 A;  2RO1 A;  4IR6 A;  4CFK A;  5DKC A;  1PUO A;  5EGU A;  5G4S A;  4YYJ A;  2YEK A;  4UIX A;  4MEQ A;  4QYD A;  4YAB A;  3O33 A;  5E3G A;  4UIW A;  5A81 A;  4TZ2 A;  3Q2E A;  4QEW A;  1WUG A;  3UVX A;  4A9J A;  5D3N A;  2WP2 A;  5D26 A;  3MXF A;  4QR5 A;  5FG6 A;  3MUK A;  3LJW A;  3D1B A;  5K29 A;  5FE4 A;  5DLX A; 
#chains in the Genus database with same CATH homology
 3MB4 A;  3UW9 A;  4A9I A;  5FH8 A;  5DY7 A;  1JSP B;  4Z93 A;  3UV5 A;  3P1C A;  5I40 A;  4UIT A;  4A9M A;  4QSQ A;  5LUU A;  3LQH A;  5I89 A;  4NR5 A;  4QYL A;  4LRG A;  4HBV A;  5FE0 A;  4WHU A;  3QZT A;  5FE2 A;  4YC9 A;  4OUF A;  4QUT A;  4UYE A;  5I80 A;  2DVQ A;  4NQM A;  3JVM A;  5CQ4 A;  4YH4 A;  2FSA A;  4QSR A;  4TTE A;  2KTB B;  5AD3 A;  5ENG A;  4NR7 A;  5EU1 A;  5C4Q A;  2E3K A;  4QUU A;  4TS8 A;  5D3S A;  3DAI A;  3UVY A;  5F5Z A;  4YH3 A;  3JVK A;  4LYW A;  5E9K A;  5F3A A;  4BW2 A;  4HXK A;  3ZYU A;  4LYI A;  3DWY A;  4O77 A;  2R10 A;  5CQ6 A;  5E9I A;  4O7B A;  4XY8 A;  4MR5 A;  5DKH A;  4J0R A;  5KTU A;  5I7Y A;  1F68 A;  4O76 A;  5E9M A;  2R0S A;  5F36 A;  4CFL A;  5LKU A;  2YEM A;  4Q0O A;  4O7A A;  5L99 A;  4WHW A;  5F2P A;  4UYD A;  2G4A A;  5CUA A;  5EVA A;  5FE1 A;  4BHW A;  5HRX A;  4TT4 A;  5JWM A;  3HME A;  1X0J A;  5EK9 A;  4YY6 A;  2L84 A;  5CUC A;  3UVD A;  4A9O A;  2E7O A;  5DYC A;  4HBY A;  4A9K A;  4TT6 A;  5L96 A;  4LC2 A;  2F6N A;  5A5N A;  5KU3 A;  5JI8 A;  4QC1 A;  2DVR A;  5F1H A;  4HXR A;  4UYF A;  4BW3 A;  2WP1 A;  4LDF A;  4UYF B;  5TCM A;  5I86 A;  3U5L A;  4PCE A;  4Q0N A;  5DFB A;  4LZ2 A;  4ZW1 A;  5DKD A;  5IBN A;  4QR4 A;  4Z1Q A;  5LJ1 A;  4N4I A;  3NXB A;  4QC3 A;  4TQN A;  2YDW A;  2YEL A;  3GG3 A;  4YYH A;  5ETD A;  5IGL A;  5A5R A;  5HRW A;  4KV1 A;  4O75 A;  4CUR A;  2D82 A;  5EWW A;  5CP5 A;  2DWW A;  5FBX A;  3QZV A;  4BW4 A;  5A5O A;  4TT2 A;  5LVQ A;  3MB3 A;  3RCW A;  4NRB A;  1WUM A;  3LQJ A;  3P5O A;  3Q2F A;  5F61 A;  3JVJ A;  5D24 A;  4RVR A;  5FDZ A;  5LJ2 A;  4QEU A;  5ETB A;  2DAT A;  4PKL A;  5IGM A;  5C87 A;  3UVW A;  4QEV A;  2MJV B;  4YAD A;  4O70 A;  4PCI A;  2DKW A;  5I88 A;  4ALH A;  3QZS A;  5AMF A;  2RI7 A;  5A7C A;  4YAT A;  4NRA A;  4CLB A;  5DW2 A;  5IG6 A;  4ALG A;  3JVL A;  5A5Q A;  4YYN A;  2RNY A;  5CGP A;  5C89 A;  5LVR A;  5II1 A;  5CRM A;  5HQ7 A;  4YYI A;  5L8U A;  4J1P A;  4WIV A;  3G0L A;  4OGI A;  4A9F A;  4PS5 A;  4ZQL A;  5EIC A;  3K2J A;  5EP7 A;  4J3I A;  3SVG A;  5J0D A;  4HBX A;  5HEM A;  5C8G A;  5IGK A;  3D7C A;  3AQA A;  5D7X A;  5F63 A;  5CY9 A;  4HXS A;  5CUD A;  3LQI A;  5CTL A;  4CL9 A;  5ENH A;  5II2 A;  2N9G A;  2R0V A;  2RS9 B;  4IOQ A;  4J0S A;  4ZC9 A;  3U5O A;  5KTW A;  5AD2 A;  5FE6 A;  4X2I A;  4MR6 A;  5L97 A;  1ZS5 A;  5H1V A;  5F1L A;  5I83 A;  3IU6 A;  3FKM X;  5KO4 A;  4F3I A;  5D3R A;  3I3J A;  4UIV A;  4HXL A;  4GPJ A;  5DYU A;  4NR8 A;  5E9L A;  5EPS A;  2DVS A;  4E96 A;  4PTB A;  3HMF A;  3U5K A;  4IR4 A;  5EQ1 A;  4YYK A;  4YYM A;  4O78 A;  5L8T A;  4MR3 A;  5LKZ A;  4HXP A;  4Z1S A;  4NYW A;  5LJ0 A;  4KV4 A;  5G4R A;  4NUD A;  5ENE A;  3O37 A;  5COI A;  5HLS A;  5E9Y A;  5FH7 A;  4CUS A;  4YK0 A;  4TU6 A;  5FB0 A;  4CUQ A;  4NR4 A;  5E7D A;  5FE5 A;  5CUE A;  3O35 A;  4O7F A;  4Z6I A;  5L98 A;  3UV4 A;  3U5J A;  5D3L A;  4KCX A;  5CUB A;  5EIS A;  3ONI A;  4MEP A;  5D3T A;  4NS5 A;  5FH6 A;  5AME A;  2E7N A;  4N4F A;  3SVH A;  4XUA A;  4NQN A;  3U5M A;  5FG5 A;  4A9H A;  5D3P A;  5CQ5 A;  5I1Q A;  5F62 A;  5A5P A;  1EQF A;  4QSP A;  4LZS A;  5HEN A;  4CUP A;  5CUG A;  4XYA A;  4O7E A;  5FE9 A;  2YYN A;  4UIU A;  5HFQ A;  5CQA A;  5EI4 A;  5ENI A;  2OO1 A;  2OSS A;  4QZS A;  5A82 A;  5E0R A;  4QR3 A;  5E9V A;  4C67 A;  4UIY A;  5CZG A;  4YAX A;  4QSX A;  4YBS A;  2L85 A;  4DON A;  4YYG A;  5TB6 A;  5D3H A;  3G0J A;  5I7X A;  5H85 A;  5E73 A;  4O71 A;  5ENB A;  5IGN A;  5EWV A;  4NR9 A;  4YBM A;  2R0Y A;  5EWH A;  5CQ7 A;  4UYG A;  2YQD A;  5FFY A;  5D3J A;  4XY9 A;  4QNS A;  5C85 A;  3LXJ A;  4FLP A;  4IOR A;  1JM4 B;  5CS8 A;  4QB3 A;  5EM3 A;  5BT5 A;  3IU5 A;  4A9E A;  4LYS A;  3HMH A;  5DYX A;  5A85 A;  4IOO A;  5F25 A;  5DFC A;  4UIZ A;  2GRC A;  4HXO A;  5H1U A;  5FFV A;  4IR3 A;  3SVF A;  4O72 A;  4A9N A;  5E3D A;  3AAD A;  5CRZ A;  2RNX A;  4HXM A;  4MEN A;  4N3W A;  5D25 A;  5A5S A;  5CU8 A;  3P1F A;  5EWD A;  4QSS A;  4N4G A;  4N4H A;  4OGJ A;  5FE8 A;  4IR5 A;  4MR4 A;  5EPR A;  3U5N A;  5CQ8 A;  5EPB A;  3U5P A;  5HEL A;  4YBT A;  5A83 A;  4BW1 A;  4O74 A;  4NYX A;  5CQT A;  5H1T A;  5CPE A;  4YY4 A;  3P1E A;  2RFJ A;  5FFW A;  1E6I A;  4PY6 A;  3O34 A;  4XUB A;  4QBM A;  5KTX A;  5BT4 A;  3MUL A;  4LZR A;  4AKN A;  5LKX A;  5HM0 A;  5CFW A;  4QSW A;  4NRC A;  3P1D A;  5KHM A;  5ENF A;  5FE7 A;  3MQM A;  4QSU A;  5HQ5 A;  4NUE A;  2OUO A;  4HBW A;  2NXB A;  5DBM A;  5DYA A;  5ENJ A;  5ENC A;  3S92 A;  3TLP A;  5IID A;  2F6J A;  5HCL A;  2D9E A;  4CUU A;  5DLZ A;  5CQ3 A;  4BJX A;  5DX4 A;  5HQ6 A;  2L5E A;  5D0C A;  5DFD A;  5ACY A;  5EV9 A;  2DVV A;  5HRV A;  4NR6 A;  2I8N A;  4O7C A;  2RNW A;  4TYL A;  4Z6H A;  5DW1 A;  5HFR A;  2YW5 A;  1N72 A;  2I7K A;  5EA1 A;  3S91 A;  4TZ8 A;  4MEO A;  4Y03 A;  5FG4 A;  4YYD A;  4NYV A;  4A9L A;  2H60 A;  5E74 A;  4HXN A;  5FB1 A;  4NXJ A;  3O36 A;  4QST A;  4QY4 A;  4C66 A;  5FE3 A;  4UYH A;  5C7N A;  5EWC A;  5LKT A;  5BT3 A;  4QSV A;  4NUC A;  4TU4 A;  3UV2 A;  4CUT A;  5F60 A;  5HJC A;  2LSP B;  4LR6 A;  5I29 A;  2RO1 A;  4IR6 A;  4CFK A;  5DKC A;  5EGU A;  5G4S A;  4YYJ A;  2YEK A;  4UIX A;  4MEQ A;  4QYD A;  4YAB A;  3O33 A;  5E3G A;  4UIW A;  5A81 A;  4TZ2 A;  3Q2E A;  4QEW A;  1WUG A;  3UVX A;  4A9J A;  5D3N A;  2WP2 A;  5D26 A;  3MXF A;  4QR5 A;  5FG6 A;  3MUK A;  3LJW A;  5K29 A;  5FE4 A;  5DLX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...