2RO1A

Nmr solution structures of human kap1 phd finger-bromodomain
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
189
structure length
189
Chain Sequence
SATICRVCQKPGDLVMCNQCEFCFHLDCHLPALQDVPGEEWSCSLCHVLPDLKEEDGSLSLDGADSTGVVAKLSPANQRKCERVLLALFCHEPCRPLHQLATDSTFSLDQPGGTLDLTLIRARLQEKLSPPYSSPQEFAQDVGRMFKQFNKLTEDKADVQSIIGLQRFFETRMNEAFGDTKFSAVLVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription intermediary factor 1-beta
publication title Structural insights into human KAP1 PHD finger-bromodomain and its role in gene silencing
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 32
structure length 189
sequence length 189
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2008-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2ro1A00
4NR6A 4CUUA 5LVRA 4QSRA 5CTLA 4AKNA 1F68A 5FE8A 5L99A 5DLXA 4MR5A 4YH4A 3P1FA 3TLPA 4A9FA 4O77A 5EWVA 3LXJA 4IOQA 4MEPA 5EWDA 5CQ6A 5L8UA 5D3PA 5D26A 4UYDA 5LJ0A 4J0RA 3K2JA 2YEKA 5EISA 4UITA 5LJ1A 5AMFA 5D3NA 3UVXA 4O72A 2DKWA 5AMEA 4UYHA 5D3LA 5HFQA 3DWYA 4QY4A 5ENEA 4A9HA 5KU3A 4LDFA 4NQMA 5FE3A 5G4SA 2G4AA 5FB1A 5FE0A 5FE4A 5F2PA 2D82A 5FB0A 3FKMX 4UIUA 4QSTA 5L98A 5EPRA 3O36A 5I86A 4Z6HA 2YYNA 5ENBA 4YBSA 3Q2EA 4NYVA 4PY6A 5HRWA 5HELA 5A7CA 4OGJA 4TZ2A 3G0LA 3U5OA 2LSPB 5FH6A 3ZYUA 5IGKA 5G4RA 2YEMA 1N72A 5TCMA 4HBVA 5CY9A 4NRBA 3HMEA 4NUCA 3UVWA 4HXMA 4UYFB 5E74A 4BW2A 5D3RA 4MEOA 5F61A 3UV2A 3UV4A 4NR9A 4YATA 5FFVA 5I88A 2YQDA 5DFBA 4CFKA 3U5LA 4BW4A 3O34A 5I83A 5LJ2A 4OGIA 4PTBA 1JSPB 5IGNA 5II1A 3U5PA 4QB3A 5KTUA 5H1UA 2H60A 2FSAA 4J1PA 4HBYA 4MENA 5CZGA 5EK9A 5A85A 3SVFA 4HXKA 2DVQA 4O7AA 5E9IA 4YABA 5CUEA 3LQHA 5LKZA 4YYMA 5DKHA 5EM3A 5L97A 3JVKA 4E96A 5EA1A 4YYJA 2E7OA 5FE7A 5DKDA 5AD2A 4QEWA 2DWWA 5A5PA 3SVHA 2YELA 5CUBA 2F6NA 2DVVA 4Z6IA 5DYCA 5E9YA 5ETDA 5HJCA 2GRCA 5E0RA 5JI8A 5DY7A 2RO1A 4QUTA 4BW3A 5E9KA 5HFRA 2NXBA 5FE1A 5C4QA 3ONIA 2L5EA 5FG5A 4KCXA 4XUAA 4MEQA 4YAXA 4LYIA 4QSUA 4ZQLA 4J3IA 5EICA 5FG6A 4QR4A 4LC2A 5CQ5A 5I89A 4QSSA 5A82A 5IG6A 3NXBA 4ALGA 5ENFA 5IIDA 5C85A 5CUGA 4QUUA 3S92A 3U5NA 4Z93A 4TT6A 4GPJA 4MR4A 2OSSA 5EGUA 2L84A 3RCWA 3QZSA 3AQAA 5FE9A 4O7CA 4YYNA 4QZSA 2DVSA 4YH3A 4CUPA 4CUTA 4TU4A 1E6IA 5J0DA 4BW1A 1X0JA 5DYUA 4QSPA 4YYHA 4A9OA 4UIVA 5FE5A 5CS8A 5I80A 5FFWA 5HRXA 5H85A 3IU5A 5E7DA 3IU6A 5E3DA 5DYXA 5JWMA 5ENIA 4N4FA 4QR5A 4C67A 4NUEA 5CGPA 5F36A 4XUBA 5E9VA 4XY9A 4Y03A 5EV9A 4QYDA 4A9JA 5CQAA 4TT4A 1ZS5A 4NS5A 4LR6A 3I3JA 5LVQA 2YW5A 5CFWA 5CP5A 5DYAA 4IR6A 4LZRA 4HBWA 3HMFA 4WIVA 3UVYA 5HQ6A 5D24A 3QZTA 2RFJA 4A9NA 4A9LA 3U5KA 5C89A 5EPSA 3U5MA 4NRAA 5IBNA 5F63A 5C8GA 5I29A 4UIZA 5DW2A 4UIXA 5EQ1A 3O35A 2OUOA 4YBMA 4ZW1A 5I7XA 4HXOA 3QZVA 5LKTA 5D3JA 5E9LA 5EPBA 4RVRA 5CQ4A 5A83A 3LJWA 4N4GA 3P1DA 5TB6A 5CPEA 4UIYA 4YY4A 4CLBA 5CUAA 2I7KA 5IGLA 4PCIA 2RI7A 4QSWA 5E3GA 5CRZA 5DX4A 4CUQA 5FBXA 4MR6A 5D3HA 2E7NA 4PS5A 4BJXA 5FG4A 5F5ZA 3HMHA 4TU6A 4NYXA 4UYGA 4UYEA 5CQ8A 4NR7A 4ALHA 5HQ7A 5ENJA 2E3KA 4O71A 4CURA 5ETBA 4TQNA 3U5JA 5A5QA 4BHWA 5CQ3A 5F25A 4QSXA 5I40A 5KTWA 5BT4A 2D9EA 4IR4A 4HXNA 5EVAA 3MULA 4YC9A 2KTBB 5CUDA 4UIWA 3UW9A 4WHUA 3O37A 5EU1A 3SVGA 5ENHA 4QNSA 2RNYA 4NR8A 2DVRA 4HXPA 5D7XA 4YYGA 5H1TA 3MB3A 3JVJA 4IR3A 4TTEA 5D0CA 5COIA 4QEUA 5ACYA 4LRGA 5HM0A 4QC1A 5F62A 4O78A 4Z1SA 5I7YA 4YYDA 5EWHA 1WUGA 5A5RA 5LUUA 2OO1A 4DONA 3D7CA 4O7FA 4YADA 4Q0OA 4IOOA 2RNXA 5DBMA 4J0SA 4NQNA 5FFYA 5KHMA 4LYWA 4LZSA 2F6JA 4WHWA 4LZ2A 4MR3A 5EWCA 5LKXA 4FLPA 2R0VA 4O7BA 4IR5A 3S91A 4N4IA 4HBXA 5FH7A 3GG3A 3P1CA 5D25A 4TZ8A 4NRCA 3UVDA 5ENGA 4A9KA 2RNWA 3MXFA 4QSVA 3MUKA 4CL9A 5FE6A 4IORA 3AADA 5DFCA 5E73A 2N9GA 3Q2FA 4O76A 4XYAA 5K29A 5DFDA 4KV4A 3G0JA 4LYSA 5C87A 4QBMA 5ENCA 4NUDA 4QEVA 4Z1QA 3O33A 2I8NA 3UV5A 5FE2A 2R10A 4N3WA 4YBTA 5DKCA 2L85A 4O74A 5A5NA 4NR5A 5II2A 4F3IA 4O70A 5D3TA 2RS9B 4TT2A 4YYIA 5LKUA 4Q0NA 3LQJA 4YK0A 4NR4A 5KO4A 1EQFA 1WUMA 4X2IA 5HLSA 2WP2A 4QYLA 5D3SA 5A5SA 4HXSA 3JVMA 3JVLA 4HXRA 5HRVA 5KTXA 2MJVB 4YY6A 5FDZA 4NXJA 5E9MA 5F1HA 4PCEA 3DAIA 4O7EA 2YDWA 4A9MA 5CQ7A 5L8TA 4N4HA 5CU8A 5FH8A 4OUFA 3P1EA 5CQTA 5BT3A 1JM4B 4TS8A 5EP7A 5L96A 4QR3A 5A5OA 5HENA 2WP1A 5F1LA 5CUCA 5EWWA 3P5OA 5DW1A 3MQMA 4A9IA 5A81A 4PKLA 4A9EA 2R0YA 5BT5A 2DATA 3MB4A 5EI4A 5C7NA 4UYFA 5IGMA 4QSQA 5DLZA 5F3AA 4CUSA 4NYWA 4O75A 4QC3A 4YYKA 4CFLA 5I1QA 5F60A 4ZC9A 5HCLA 4XY8A 5CRMA 5AD3A 5H1VA 2R0SA 4HXLA 4TYLA 4C66A 3LQIA 5HQ5A 5HEMA 4KV1A
chains in the Genus database with same CATH superfamily
4NR6A 4CUUA 5LVRA 4QSRA 5CTLA 4AKNA 1F68A 5FE8A 5L99A 5DLXA 4MR5A 4YH4A 3P1FA 3TLPA 4A9FA 4O77A 5EWVA 3LXJA 4IOQA 4MEPA 5EWDA 5CQ6A 5L8UA 5D3PA 5D26A 4UYDA 5LJ0A 4J0RA 3K2JA 2YEKA 5EISA 4UITA 5LJ1A 5AMFA 5D3NA 3UVXA 4O72A 2DKWA 5AMEA 4UYHA 5D3LA 5HFQA 3DWYA 4QY4A 5ENEA 4A9HA 5KU3A 4LDFA 4NQMA 4AKHA 5FE3A 5G4SA 2G4AA 5FB1A 5FE0A 5FE4A 5F2PA 2D82A 5FB0A 3FKMX 4UIUA 4QSTA 5L98A 5EPRA 3O36A 5I86A 3ERRA 4Z6HA 2YYNA 5ENBA 4YBSA 3Q2EA 4NYVA 4PY6A 5HRWA 5HELA 5A7CA 4OGJA 4TZ2A 3G0LA 3U5OA 2LSPB 5FH6A 3ZYUA 5IGKA 5G4RA 2YEMA 1N72A 5TCMA 4HBVA 5CY9A 4NRBA 3HMEA 4NUCA 3UVWA 4HXMA 4UYFB 5E74A 4BW2A 5D3RA 4MEOA 5F61A 3UV2A 3UV4A 4NR9A 4YATA 5FFVA 5I88A 2YQDA 5DFBA 4CFKA 3U5LA 4BW4A 3O34A 5I83A 5LJ2A 4OGIA 4PTBA 1PUOA 1JSPB 5IGNA 5II1A 3U5PA 4QB3A 5KTUA 3VKGA 5H1UA 2H60A 2FSAA 4J1PA 4HBYA 4MENA 5CZGA 5EK9A 5A85A 4AI6A 3SVFA 4HXKA 2DVQA 4O7AA 5E9IA 3VKHA 4YABA 5CUEA 3LQHA 5LKZA 4YYMA 5DKHA 5EM3A 5L97A 3JVKA 4E96A 5EA1A 4YYJA 2E7OA 5FE7A 5DKDA 5AD2A 4QEWA 2DWWA 5A5PA 3SVHA 2YELA 5CUBA 2F6NA 2DVVA 4Z6IA 5DYCA 5E9YA 5ETDA 5HJCA 2GRCA 5E0RA 5JI8A 5DY7A 2RO1A 4QUTA 4BW3A 5E9KA 5HFRA 2NXBA 5FE1A 5C4QA 3ONIA 2L5EA 5FG5A 4KCXA 4XUAA 4MEQA 4YAXA 4LYIA 4QSUA 4ZQLA 4J3IA 5EICA 5FG6A 4QR4A 4LC2A 5CQ5A 5I89A 4QSSA 5A82A 5IG6A 3NXBA 4ALGA 5ENFA 5IIDA 5C85A 5CUGA 4QUUA 3S92A 3U5NA 4Z93A 4TT6A 4GPJA 4MR4A 2OSSA 5EGUA 2L84A 3RCWA 3QZSA 3AQAA 5FE9A 4O7CA 4YYNA 3D1BA 4QZSA 2DVSA 4YH3A 4CUPA 4CUTA 4TU4A 1E6IA 5J0DA 4BW1A 1X0JA 5DYUA 4QSPA 4YYHA 4A9OA 4UIVA 5FE5A 5CS8A 5I80A 5FFWA 5HRXA 5H85A 3IU5A 5E7DA 3IU6A 5E3DA 5DYXA 5JWMA 5ENIA 4N4FA 4QR5A 4C67A 4NUEA 5CGPA 5F36A 4XUBA 5E9VA 4XY9A 4Y03A 5EV9A 4QYDA 4A9JA 5CQAA 4TT4A 1ZS5A 4NS5A 4LR6A 3I3JA 5LVQA 2YW5A 5CFWA 5CP5A 5DYAA 4IR6A 4LZRA 4HBWA 3HMFA 4WIVA 3UVYA 5HQ6A 5D24A 3QZTA 1ZKRA 2RFJA 4A9NA 4A9LA 3U5KA 5C89A 5EPSA 3U5MA 4NRAA 5IBNA 5F63A 5C8GA 5I29A 4UIZA 5DW2A 4UIXA 5EQ1A 3O35A 2OUOA 4YBMA 4ZW1A 2EJNA 5I7XA 4HXOA 3QZVA 5LKTA 5D3JA 5E9LA 4AKGA 5EPBA 4RVRA 5CQ4A 5A83A 3LJWA 4N4GA 3P1DA 5TB6A 5CPEA 4UIYA 4YY4A 4CLBA 5CUAA 2I7KA 5IGLA 4PCIA 2RI7A 4QSWA 5E3GA 5CRZA 5DX4A 4CUQA 5FBXA 4MR6A 5D3HA 2E7NA 4PS5A 4BJXA 5FG4A 5F5ZA 3HMHA 4TU6A 4NYXA 4UYGA 4UYEA 5CQ8A 4NR7A 4ALHA 5HQ7A 5ENJA 2E3KA 4O71A 4CURA 5ETBA 4TQNA 3U5JA 5A5QA 4BHWA 5CQ3A 5F25A 4QSXA 5I40A 5KTWA 5BT4A 3D1DA 2D9EA 4IR4A 4HXNA 5EVAA 3MULA 4YC9A 2KTBB 5CUDA 4UIWA 3UW9A 4WHUA 3O37A 5EU1A 3SVGA 5ENHA 4QNSA 2RNYA 4NR8A 2DVRA 4HXPA 5D7XA 4YYGA 5H1TA 3MB3A 3JVJA 4IR3A 4TTEA 5D0CA 5COIA 4QEUA 5ACYA 4LRGA 5HM0A 4QC1A 5F62A 4O78A 4Z1SA 5I7YA 4YYDA 5EWHA 1WUGA 5A5RA 5LUUA 2OO1A 4DONA 3D7CA 4O7FA 4YADA 4Q0OA 4IOOA 2RNXA 5DBMA 4J0SA 4NQNA 5FFYA 5KHMA 4LYWA 4LZSA 2F6JA 4WHWA 4LZ2A 4MR3A 5EWCA 5LKXA 4FLPA 2R0VA 4O7BA 4IR5A 3S91A 4N4IA 4HBXA 5FH7A 3GG3A 3P1CA 5D25A 4TZ8A 4NRCA 3UVDA 5ENGA 4AKIA 4A9KA 2RNWA 3MXFA 4QSVA 3MUKA 4CL9A 5FE6A 4IORA 3AADA 5DFCA 5E73A 2N9GA 3Q2FA 4O76A 4XYAA 5K29A 5DFDA 4KV4A 3G0JA 4LYSA 5C87A 4QBMA 5ENCA 4NUDA 4QEVA 4Z1QA 3O33A 2I8NA 3UV5A 5FE2A 2R10A 4N3WA 4YBTA 5DKCA 2L85A 4O74A 5A5NA 4NR5A 5II2A 4F3IA 4O70A 5D3TA 2RS9B 4TT2A 4YYIA 5LKUA 4Q0NA 3LQJA 4YK0A 4NR4A 5KO4A 1EQFA 1WUMA 4X2IA 5HLSA 2WP2A 4QYLA 5D3SA 5A5SA 4HXSA 3JVMA 3JVLA 4HXRA 5HRVA 5KTXA 2MJVB 4YY6A 5FDZA 4NXJA 5E9MA 5F1HA 4PCEA 3DAIA 4O7EA 2YDWA 4A9MA 5CQ7A 5L8TA 4N4HA 5CU8A 5FH8A 4OUFA 3P1EA 5CQTA 5BT3A 1JM4B 4TS8A 5EP7A 5L96A 4QR3A 5A5OA 5HENA 2WP1A 5F1LA 5CUCA 5EWWA 3P5OA 5DW1A 3MQMA 4A9IA 5A81A 4PKLA 4A9EA 2R0YA 5BT5A 2DATA 3MB4A 5EI4A 5C7NA 4UYFA 5IGMA 4QSQA 5DLZA 5F3AA 4CUSA 4NYWA 4O75A 4QC3A 4YYKA 4CFLA 5I1QA 5F60A 4ZC9A 5HCLA 4XY8A 5CRMA 5AD3A 5H1VA 2R0SA 4HXLA 4TYLA 4C66A 3LQIA 5HQ5A 5HEMA 4KV1A
chains in the Genus database with same CATH topology
4NR6A 4CUUA 5LVRA 4QSRA 5CTLA 4AKNA 1F68A 5FE8A 5L99A 5DLXA 4MR5A 4YH4A 3P1FA 3TLPA 4A9FA 4O77A 5EWVA 3LXJA 4IOQA 4MEPA 5EWDA 5CQ6A 5L8UA 5D3PA 5D26A 4UYDA 5LJ0A 4J0RA 3K2JA 2YEKA 5EISA 4UITA 5LJ1A 5AMFA 5D3NA 3UVXA 4O72A 2DKWA 5AMEA 4UYHA 5D3LA 5HFQA 3DWYA 4QY4A 5ENEA 4A9HA 5KU3A 4LDFA 4NQMA 5FE3A 5G4SA 2G4AA 5FB1A 5FE0A 5FE4A 5F2PA 2D82A 5FB0A 3FKMX 4UIUA 4QSTA 5L98A 5EPRA 3O36A 5I86A 4Z6HA 2YYNA 5ENBA 4YBSA 3Q2EA 4NYVA 4PY6A 5HRWA 5HELA 5A7CA 4OGJA 4TZ2A 3G0LA 3U5OA 2LSPB 5FH6A 3ZYUA 5IGKA 5G4RA 2YEMA 1N72A 5TCMA 4HBVA 5CY9A 4NRBA 3HMEA 4NUCA 3UVWA 4HXMA 4UYFB 5E74A 4BW2A 5D3RA 4MEOA 5F61A 3UV2A 3UV4A 4NR9A 4YATA 5FFVA 5I88A 2YQDA 5DFBA 4CFKA 3U5LA 4BW4A 3O34A 5I83A 5LJ2A 4OGIA 4PTBA 1JSPB 5IGNA 5II1A 3U5PA 4QB3A 5KTUA 5H1UA 2H60A 2FSAA 4J1PA 4HBYA 4MENA 5CZGA 5EK9A 5A85A 3SVFA 4HXKA 2DVQA 4O7AA 5E9IA 4YABA 5CUEA 3LQHA 5LKZA 4YYMA 5DKHA 5EM3A 5L97A 3JVKA 4E96A 5EA1A 4YYJA 2E7OA 5FE7A 5DKDA 5AD2A 4QEWA 2DWWA 5A5PA 3SVHA 2YELA 5CUBA 2F6NA 2DVVA 4Z6IA 5DYCA 5E9YA 5ETDA 5HJCA 2GRCA 5E0RA 5JI8A 5DY7A 2RO1A 4QUTA 4BW3A 5E9KA 5HFRA 2NXBA 5FE1A 5C4QA 3ONIA 2L5EA 5FG5A 4KCXA 4XUAA 4MEQA 4YAXA 4LYIA 4QSUA 4ZQLA 4J3IA 5EICA 5FG6A 4QR4A 4LC2A 5CQ5A 5I89A 4QSSA 5A82A 5IG6A 3NXBA 4ALGA 5ENFA 5IIDA 5C85A 5CUGA 4QUUA 3S92A 3U5NA 4Z93A 4TT6A 4GPJA 4MR4A 2OSSA 5EGUA 2L84A 3RCWA 3QZSA 3AQAA 5FE9A 4O7CA 4YYNA 4QZSA 2DVSA 4YH3A 4CUPA 4CUTA 4TU4A 1E6IA 5J0DA 4BW1A 1X0JA 5DYUA 4QSPA 4YYHA 4A9OA 4UIVA 5FE5A 5CS8A 5I80A 5FFWA 5HRXA 5H85A 3IU5A 5E7DA 3IU6A 5E3DA 5DYXA 5JWMA 5ENIA 4N4FA 4QR5A 4C67A 4NUEA 5CGPA 5F36A 4XUBA 5E9VA 4XY9A 4Y03A 5EV9A 4QYDA 4A9JA 5CQAA 4TT4A 1ZS5A 4NS5A 4LR6A 3I3JA 5LVQA 2YW5A 5CFWA 5CP5A 5DYAA 4IR6A 4LZRA 4HBWA 3HMFA 4WIVA 3UVYA 5HQ6A 5D24A 3QZTA 2RFJA 4A9NA 4A9LA 3U5KA 5C89A 5EPSA 3U5MA 4NRAA 5IBNA 5F63A 5C8GA 5I29A 4UIZA 5DW2A 4UIXA 5EQ1A 3O35A 2OUOA 4YBMA 4ZW1A 5I7XA 4HXOA 3QZVA 5LKTA 5D3JA 5E9LA 5EPBA 4RVRA 5CQ4A 5A83A 3LJWA 4N4GA 3P1DA 5TB6A 5CPEA 4UIYA 4YY4A 4CLBA 5CUAA 2I7KA 5IGLA 4PCIA 2RI7A 4QSWA 5E3GA 5CRZA 5DX4A 4CUQA 5FBXA 4MR6A 5D3HA 2E7NA 4PS5A 4BJXA 5FG4A 5F5ZA 3HMHA 4TU6A 4NYXA 4UYGA 4UYEA 5CQ8A 4NR7A 4ALHA 5HQ7A 5ENJA 2E3KA 4O71A 4CURA 5ETBA 4TQNA 3U5JA 5A5QA 4BHWA 5CQ3A 5F25A 4QSXA 5I40A 5KTWA 5BT4A 2D9EA 4IR4A 4HXNA 5EVAA 3MULA 4YC9A 2KTBB 5CUDA 4UIWA 3UW9A 4WHUA 3O37A 5EU1A 3SVGA 5ENHA 4QNSA 2RNYA 4NR8A 2DVRA 4HXPA 5D7XA 4YYGA 5H1TA 3MB3A 3JVJA 4IR3A 4TTEA 5D0CA 5COIA 4QEUA 5ACYA 4LRGA 5HM0A 4QC1A 5F62A 4O78A 4Z1SA 5I7YA 4YYDA 5EWHA 1WUGA 5A5RA 5LUUA 2OO1A 4DONA 3D7CA 4O7FA 4YADA 4Q0OA 4IOOA 2RNXA 5DBMA 4J0SA 4NQNA 5FFYA 5KHMA 4LYWA 4LZSA 2F6JA 4WHWA 4LZ2A 4MR3A 5EWCA 5LKXA 4FLPA 2R0VA 4O7BA 4IR5A 3S91A 4N4IA 4HBXA 5FH7A 3GG3A 3P1CA 5D25A 4TZ8A 4NRCA 3UVDA 5ENGA 4A9KA 2RNWA 3MXFA 4QSVA 3MUKA 4CL9A 5FE6A 4IORA 3AADA 5DFCA 5E73A 2N9GA 3Q2FA 4O76A 4XYAA 5K29A 5DFDA 4KV4A 3G0JA 4LYSA 5C87A 4QBMA 5ENCA 4NUDA 4QEVA 4Z1QA 3O33A 2I8NA 3UV5A 5FE2A 2R10A 4N3WA 4YBTA 5DKCA 2L85A 4O74A 5A5NA 4NR5A 5II2A 4F3IA 4O70A 5D3TA 2RS9B 4TT2A 4YYIA 5LKUA 4Q0NA 3LQJA 4YK0A 4NR4A 5KO4A 1EQFA 1WUMA 4X2IA 5HLSA 2WP2A 4QYLA 5D3SA 5A5SA 4HXSA 3JVMA 3JVLA 4HXRA 5HRVA 5KTXA 2MJVB 4YY6A 5FDZA 4NXJA 5E9MA 5F1HA 4PCEA 3DAIA 4O7EA 2YDWA 4A9MA 5CQ7A 5L8TA 4N4HA 5CU8A 5FH8A 4OUFA 3P1EA 5CQTA 5BT3A 1JM4B 4TS8A 5EP7A 5L96A 4QR3A 5A5OA 5HENA 2WP1A 5F1LA 5CUCA 5EWWA 3P5OA 5DW1A 3MQMA 4A9IA 5A81A 4PKLA 4A9EA 2R0YA 5BT5A 2DATA 3MB4A 5EI4A 5C7NA 4UYFA 5IGMA 4QSQA 5DLZA 5F3AA 4CUSA 4NYWA 4O75A 4QC3A 4YYKA 4CFLA 5I1QA 5F60A 4ZC9A 5HCLA 4XY8A 5CRMA 5AD3A 5H1VA 2R0SA 4HXLA 4TYLA 4C66A 3LQIA 5HQ5A 5HEMA 4KV1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NR6 A;  4CUU A;  5LVR A;  4QSR A;  5CTL A;  4AKN A;  1F68 A;  5FE8 A;  5L99 A;  5DLX A;  4MR5 A;  4YH4 A;  3P1F A;  3TLP A;  4A9F A;  4O77 A;  5EWV A;  3LXJ A;  4IOQ A;  4MEP A;  5EWD A;  5CQ6 A;  5L8U A;  5D3P A;  5D26 A;  4UYD A;  5LJ0 A;  4J0R A;  3K2J A;  2YEK A;  5EIS A;  4UIT A;  5LJ1 A;  5AMF A;  5D3N A;  3UVX A;  4O72 A;  2DKW A;  5AME A;  4UYH A;  5D3L A;  5HFQ A;  3DWY A;  4QY4 A;  5ENE A;  4A9H A;  5KU3 A;  4LDF A;  4NQM A;  5FE3 A;  5G4S A;  2G4A A;  5FB1 A;  5FE0 A;  5FE4 A;  5F2P A;  2D82 A;  5FB0 A;  3FKM X;  4UIU A;  4QST A;  5L98 A;  5EPR A;  3O36 A;  5I86 A;  4Z6H A;  2YYN A;  5ENB A;  4YBS A;  3Q2E A;  4NYV A;  4PY6 A;  5HRW A;  5HEL A;  5A7C A;  4OGJ A;  4TZ2 A;  3G0L A;  3U5O A;  2LSP B;  5FH6 A;  3ZYU A;  5IGK A;  5G4R A;  2YEM A;  1N72 A;  5TCM A;  4HBV A;  5CY9 A;  4NRB A;  3HME A;  4NUC A;  3UVW A;  4HXM A;  4UYF B;  5E74 A;  4BW2 A;  5D3R A;  4MEO A;  5F61 A;  3UV2 A;  3UV4 A;  4NR9 A;  4YAT A;  5FFV A;  5I88 A;  2YQD A;  5DFB A;  4CFK A;  3U5L A;  4BW4 A;  3O34 A;  5I83 A;  5LJ2 A;  4OGI A;  4PTB A;  1JSP B;  5IGN A;  5II1 A;  3U5P A;  4QB3 A;  5KTU A;  5H1U A;  2H60 A;  2FSA A;  4J1P A;  4HBY A;  4MEN A;  5CZG A;  5EK9 A;  5A85 A;  3SVF A;  4HXK A;  2DVQ A;  4O7A A;  5E9I A;  4YAB A;  5CUE A;  3LQH A;  5LKZ A;  4YYM A;  5DKH A;  5EM3 A;  5L97 A;  3JVK A;  4E96 A;  5EA1 A;  4YYJ A;  2E7O A;  5FE7 A;  5DKD A;  5AD2 A;  4QEW A;  2DWW A;  5A5P A;  3SVH A;  2YEL A;  5CUB A;  2F6N A;  2DVV A;  4Z6I A;  5DYC A;  5E9Y A;  5ETD A;  5HJC A;  2GRC A;  5E0R A;  5JI8 A;  5DY7 A;  2RO1 A;  4QUT A;  4BW3 A;  5E9K A;  5HFR A;  2NXB A;  5FE1 A;  5C4Q A;  3ONI A;  2L5E A;  5FG5 A;  4KCX A;  4XUA A;  4MEQ A;  4YAX A;  4LYI A;  4QSU A;  4ZQL A;  4J3I A;  5EIC A;  5FG6 A;  4QR4 A;  4LC2 A;  5CQ5 A;  5I89 A;  4QSS A;  5A82 A;  5IG6 A;  3NXB A;  4ALG A;  5ENF A;  5IID A;  5C85 A;  5CUG A;  4QUU A;  3S92 A;  3U5N A;  4Z93 A;  4TT6 A;  4GPJ A;  4MR4 A;  2OSS A;  5EGU A;  2L84 A;  3RCW A;  3QZS A;  3AQA A;  5FE9 A;  4O7C A;  4YYN A;  4QZS A;  2DVS A;  4YH3 A;  4CUP A;  4CUT A;  4TU4 A;  1E6I A;  5J0D A;  4BW1 A;  1X0J A;  5DYU A;  4QSP A;  4YYH A;  4A9O A;  4UIV A;  5FE5 A;  5CS8 A;  5I80 A;  5FFW A;  5HRX A;  5H85 A;  3IU5 A;  5E7D A;  3IU6 A;  5E3D A;  5DYX A;  5JWM A;  5ENI A;  4N4F A;  4QR5 A;  4C67 A;  4NUE A;  5CGP A;  5F36 A;  4XUB A;  5E9V A;  4XY9 A;  4Y03 A;  5EV9 A;  4QYD A;  4A9J A;  5CQA A;  4TT4 A;  1ZS5 A;  4NS5 A;  4LR6 A;  3I3J A;  5LVQ A;  2YW5 A;  5CFW A;  5CP5 A;  5DYA A;  4IR6 A;  4LZR A;  4HBW A;  3HMF A;  4WIV A;  3UVY A;  5HQ6 A;  5D24 A;  3QZT A;  2RFJ A;  4A9N A;  4A9L A;  3U5K A;  5C89 A;  5EPS A;  3U5M A;  4NRA A;  5IBN A;  5F63 A;  5C8G A;  5I29 A;  4UIZ A;  5DW2 A;  4UIX A;  5EQ1 A;  3O35 A;  2OUO A;  4YBM A;  4ZW1 A;  5I7X A;  4HXO A;  3QZV A;  5LKT A;  5D3J A;  5E9L A;  5EPB A;  4RVR A;  5CQ4 A;  5A83 A;  3LJW A;  4N4G A;  3P1D A;  5TB6 A;  5CPE A;  4UIY A;  4YY4 A;  4CLB A;  5CUA A;  2I7K A;  5IGL A;  4PCI A;  2RI7 A;  4QSW A;  5E3G A;  5CRZ A;  5DX4 A;  4CUQ A;  5FBX A;  4MR6 A;  5D3H A;  2E7N A;  4PS5 A;  4BJX A;  5FG4 A;  5F5Z A;  3HMH A;  4TU6 A;  4NYX A;  4UYG A;  4UYE A;  5CQ8 A;  4NR7 A;  4ALH A;  5HQ7 A;  5ENJ A;  2E3K A;  4O71 A;  4CUR A;  5ETB A;  4TQN A;  3U5J A;  5A5Q A;  4BHW A;  5CQ3 A;  5F25 A;  4QSX A;  5I40 A;  5KTW A;  5BT4 A;  2D9E A;  4IR4 A;  4HXN A;  5EVA A;  3MUL A;  4YC9 A;  2KTB B;  5CUD A;  4UIW A;  3UW9 A;  4WHU A;  3O37 A;  5EU1 A;  3SVG A;  5ENH A;  4QNS A;  2RNY A;  4NR8 A;  2DVR A;  4HXP A;  5D7X A;  4YYG A;  5H1T A;  3MB3 A;  3JVJ A;  4IR3 A;  4TTE A;  5D0C A;  5COI A;  4QEU A;  5ACY A;  4LRG A;  5HM0 A;  4QC1 A;  5F62 A;  4O78 A;  4Z1S A;  5I7Y A;  4YYD A;  5EWH A;  1WUG A;  5A5R A;  5LUU A;  2OO1 A;  4DON A;  3D7C A;  4O7F A;  4YAD A;  4Q0O A;  4IOO A;  2RNX A;  5DBM A;  4J0S A;  4NQN A;  5FFY A;  5KHM A;  4LYW A;  4LZS A;  2F6J A;  4WHW A;  4LZ2 A;  4MR3 A;  5EWC A;  5LKX A;  4FLP A;  2R0V A;  4O7B A;  4IR5 A;  3S91 A;  4N4I A;  4HBX A;  5FH7 A;  3GG3 A;  3P1C A;  5D25 A;  4TZ8 A;  4NRC A;  3UVD A;  5ENG A;  4A9K A;  2RNW A;  3MXF A;  4QSV A;  3MUK A;  4CL9 A;  5FE6 A;  4IOR A;  3AAD A;  5DFC A;  5E73 A;  2N9G A;  3Q2F A;  4O76 A;  4XYA A;  5K29 A;  5DFD A;  4KV4 A;  3G0J A;  4LYS A;  5C87 A;  4QBM A;  5ENC A;  4NUD A;  4QEV A;  4Z1Q A;  3O33 A;  2I8N A;  3UV5 A;  5FE2 A;  2R10 A;  4N3W A;  4YBT A;  5DKC A;  2L85 A;  4O74 A;  5A5N A;  4NR5 A;  5II2 A;  4F3I A;  4O70 A;  5D3T A;  2RS9 B;  4TT2 A;  4YYI A;  5LKU A;  4Q0N A;  3LQJ A;  4YK0 A;  4NR4 A;  5KO4 A;  1EQF A;  1WUM A;  4X2I A;  5HLS A;  2WP2 A;  4QYL A;  5D3S A;  5A5S A;  4HXS A;  3JVM A;  3JVL A;  4HXR A;  5HRV A;  5KTX A;  2MJV B;  4YY6 A;  5FDZ A;  4NXJ A;  5E9M A;  5F1H A;  4PCE A;  3DAI A;  4O7E A;  2YDW A;  4A9M A;  5CQ7 A;  5L8T A;  4N4H A;  5CU8 A;  5FH8 A;  4OUF A;  3P1E A;  5CQT A;  5BT3 A;  1JM4 B;  4TS8 A;  5EP7 A;  5L96 A;  4QR3 A;  5A5O A;  5HEN A;  2WP1 A;  5F1L A;  5CUC A;  5EWW A;  3P5O A;  5DW1 A;  3MQM A;  4A9I A;  5A81 A;  4PKL A;  4A9E A;  2R0Y A;  5BT5 A;  2DAT A;  3MB4 A;  5EI4 A;  5C7N A;  4UYF A;  5IGM A;  4QSQ A;  5DLZ A;  5F3A A;  4CUS A;  4NYW A;  4O75 A;  4QC3 A;  4YYK A;  4CFL A;  5I1Q A;  5F60 A;  4ZC9 A;  5HCL A;  4XY8 A;  5CRM A;  5AD3 A;  5H1V A;  2R0S A;  4HXL A;  4TYL A;  4C66 A;  3LQI A;  5HQ5 A;  5HEM A;  4KV1 A; 
#chains in the Genus database with same CATH topology
 4NR6 A;  4CUU A;  5LVR A;  4QSR A;  5CTL A;  4AKN A;  1F68 A;  5FE8 A;  5L99 A;  5DLX A;  4MR5 A;  4YH4 A;  3P1F A;  3TLP A;  4A9F A;  4O77 A;  5EWV A;  3LXJ A;  4IOQ A;  4MEP A;  5EWD A;  5CQ6 A;  5L8U A;  5D3P A;  5D26 A;  4UYD A;  5LJ0 A;  4J0R A;  3K2J A;  2YEK A;  5EIS A;  4UIT A;  5LJ1 A;  5AMF A;  5D3N A;  3UVX A;  4O72 A;  2DKW A;  5AME A;  4UYH A;  5D3L A;  5HFQ A;  3DWY A;  4QY4 A;  5ENE A;  4A9H A;  5KU3 A;  4LDF A;  4NQM A;  4AKH A;  5FE3 A;  5G4S A;  2G4A A;  5FB1 A;  5FE0 A;  5FE4 A;  5F2P A;  2D82 A;  5FB0 A;  3FKM X;  4UIU A;  4QST A;  5L98 A;  5EPR A;  3O36 A;  5I86 A;  3ERR A;  4Z6H A;  2YYN A;  5ENB A;  4YBS A;  3Q2E A;  4NYV A;  4PY6 A;  5HRW A;  5HEL A;  5A7C A;  4OGJ A;  4TZ2 A;  3G0L A;  3U5O A;  2LSP B;  5FH6 A;  3ZYU A;  5IGK A;  5G4R A;  2YEM A;  1N72 A;  5TCM A;  4HBV A;  5CY9 A;  4NRB A;  3HME A;  4NUC A;  3UVW A;  4HXM A;  4UYF B;  5E74 A;  4BW2 A;  5D3R A;  4MEO A;  5F61 A;  3UV2 A;  3UV4 A;  4NR9 A;  4YAT A;  5FFV A;  5I88 A;  2YQD A;  5DFB A;  4CFK A;  3U5L A;  4BW4 A;  3O34 A;  5I83 A;  5LJ2 A;  4OGI A;  4PTB A;  1PUO A;  1JSP B;  5IGN A;  5II1 A;  3U5P A;  4QB3 A;  5KTU A;  3VKG A;  5H1U A;  2H60 A;  2FSA A;  4J1P A;  4HBY A;  4MEN A;  5CZG A;  5EK9 A;  5A85 A;  4AI6 A;  3SVF A;  4HXK A;  2DVQ A;  4O7A A;  5E9I A;  3VKH A;  4YAB A;  5CUE A;  3LQH A;  5LKZ A;  4YYM A;  5DKH A;  5EM3 A;  5L97 A;  3JVK A;  4E96 A;  5EA1 A;  4YYJ A;  2E7O A;  5FE7 A;  5DKD A;  5AD2 A;  4QEW A;  2DWW A;  5A5P A;  3SVH A;  2YEL A;  5CUB A;  2F6N A;  2DVV A;  4Z6I A;  5DYC A;  5E9Y A;  5ETD A;  5HJC A;  2GRC A;  5E0R A;  5JI8 A;  5DY7 A;  2RO1 A;  4QUT A;  4BW3 A;  5E9K A;  5HFR A;  2NXB A;  5FE1 A;  5C4Q A;  3ONI A;  2L5E A;  5FG5 A;  4KCX A;  4XUA A;  4MEQ A;  4YAX A;  4LYI A;  4QSU A;  4ZQL A;  4J3I A;  5EIC A;  5FG6 A;  4QR4 A;  4LC2 A;  5CQ5 A;  5I89 A;  4QSS A;  5A82 A;  5IG6 A;  3NXB A;  4ALG A;  5ENF A;  5IID A;  5C85 A;  5CUG A;  4QUU A;  3S92 A;  3U5N A;  4Z93 A;  4TT6 A;  4GPJ A;  4MR4 A;  2OSS A;  5EGU A;  2L84 A;  3RCW A;  3QZS A;  3AQA A;  5FE9 A;  4O7C A;  4YYN A;  3D1B A;  4QZS A;  2DVS A;  4YH3 A;  4CUP A;  4CUT A;  4TU4 A;  1E6I A;  5J0D A;  4BW1 A;  1X0J A;  5DYU A;  4QSP A;  4YYH A;  4A9O A;  4UIV A;  5FE5 A;  5CS8 A;  5I80 A;  5FFW A;  5HRX A;  5H85 A;  3IU5 A;  5E7D A;  3IU6 A;  5E3D A;  5DYX A;  5JWM A;  5ENI A;  4N4F A;  4QR5 A;  4C67 A;  4NUE A;  5CGP A;  5F36 A;  4XUB A;  5E9V A;  4XY9 A;  4Y03 A;  5EV9 A;  4QYD A;  4A9J A;  5CQA A;  4TT4 A;  1ZS5 A;  4NS5 A;  4LR6 A;  3I3J A;  5LVQ A;  2YW5 A;  5CFW A;  5CP5 A;  5DYA A;  4IR6 A;  4LZR A;  4HBW A;  3HMF A;  4WIV A;  3UVY A;  5HQ6 A;  5D24 A;  3QZT A;  1ZKR A;  2RFJ A;  4A9N A;  4A9L A;  3U5K A;  5C89 A;  5EPS A;  3U5M A;  4NRA A;  5IBN A;  5F63 A;  5C8G A;  5I29 A;  4UIZ A;  5DW2 A;  4UIX A;  5EQ1 A;  3O35 A;  2OUO A;  4YBM A;  4ZW1 A;  2EJN A;  5I7X A;  4HXO A;  3QZV A;  5LKT A;  5D3J A;  5E9L A;  4AKG A;  5EPB A;  4RVR A;  5CQ4 A;  5A83 A;  3LJW A;  4N4G A;  3P1D A;  5TB6 A;  5CPE A;  4UIY A;  4YY4 A;  4CLB A;  5CUA A;  2I7K A;  5IGL A;  4PCI A;  2RI7 A;  4QSW A;  5E3G A;  5CRZ A;  5DX4 A;  4CUQ A;  5FBX A;  4MR6 A;  5D3H A;  2E7N A;  4PS5 A;  4BJX A;  5FG4 A;  5F5Z A;  3HMH A;  4TU6 A;  4NYX A;  4UYG A;  4UYE A;  5CQ8 A;  4NR7 A;  4ALH A;  5HQ7 A;  5ENJ A;  2E3K A;  4O71 A;  4CUR A;  5ETB A;  4TQN A;  3U5J A;  5A5Q A;  4BHW A;  5CQ3 A;  5F25 A;  4QSX A;  5I40 A;  5KTW A;  5BT4 A;  3D1D A;  2D9E A;  4IR4 A;  4HXN A;  5EVA A;  3MUL A;  4YC9 A;  2KTB B;  5CUD A;  4UIW A;  3UW9 A;  4WHU A;  3O37 A;  5EU1 A;  3SVG A;  5ENH A;  4QNS A;  2RNY A;  4NR8 A;  2DVR A;  4HXP A;  5D7X A;  4YYG A;  5H1T A;  3MB3 A;  3JVJ A;  4IR3 A;  4TTE A;  5D0C A;  5COI A;  4QEU A;  5ACY A;  4LRG A;  5HM0 A;  4QC1 A;  5F62 A;  4O78 A;  4Z1S A;  5I7Y A;  4YYD A;  5EWH A;  1WUG A;  5A5R A;  5LUU A;  2OO1 A;  4DON A;  3D7C A;  4O7F A;  4YAD A;  4Q0O A;  4IOO A;  2RNX A;  5DBM A;  4J0S A;  4NQN A;  5FFY A;  5KHM A;  4LYW A;  4LZS A;  2F6J A;  4WHW A;  4LZ2 A;  4MR3 A;  5EWC A;  5LKX A;  4FLP A;  2R0V A;  4O7B A;  4IR5 A;  3S91 A;  4N4I A;  4HBX A;  5FH7 A;  3GG3 A;  3P1C A;  5D25 A;  4TZ8 A;  4NRC A;  3UVD A;  5ENG A;  4AKI A;  4A9K A;  2RNW A;  3MXF A;  4QSV A;  3MUK A;  4CL9 A;  5FE6 A;  4IOR A;  3AAD A;  5DFC A;  5E73 A;  2N9G A;  3Q2F A;  4O76 A;  4XYA A;  5K29 A;  5DFD A;  4KV4 A;  3G0J A;  4LYS A;  5C87 A;  4QBM A;  5ENC A;  4NUD A;  4QEV A;  4Z1Q A;  3O33 A;  2I8N A;  3UV5 A;  5FE2 A;  2R10 A;  4N3W A;  4YBT A;  5DKC A;  2L85 A;  4O74 A;  5A5N A;  4NR5 A;  5II2 A;  4F3I A;  4O70 A;  5D3T A;  2RS9 B;  4TT2 A;  4YYI A;  5LKU A;  4Q0N A;  3LQJ A;  4YK0 A;  4NR4 A;  5KO4 A;  1EQF A;  1WUM A;  4X2I A;  5HLS A;  2WP2 A;  4QYL A;  5D3S A;  5A5S A;  4HXS A;  3JVM A;  3JVL A;  4HXR A;  5HRV A;  5KTX A;  2MJV B;  4YY6 A;  5FDZ A;  4NXJ A;  5E9M A;  5F1H A;  4PCE A;  3DAI A;  4O7E A;  2YDW A;  4A9M A;  5CQ7 A;  5L8T A;  4N4H A;  5CU8 A;  5FH8 A;  4OUF A;  3P1E A;  5CQT A;  5BT3 A;  1JM4 B;  4TS8 A;  5EP7 A;  5L96 A;  4QR3 A;  5A5O A;  5HEN A;  2WP1 A;  5F1L A;  5CUC A;  5EWW A;  3P5O A;  5DW1 A;  3MQM A;  4A9I A;  5A81 A;  4PKL A;  4A9E A;  2R0Y A;  5BT5 A;  2DAT A;  3MB4 A;  5EI4 A;  5C7N A;  4UYF A;  5IGM A;  4QSQ A;  5DLZ A;  5F3A A;  4CUS A;  4NYW A;  4O75 A;  4QC3 A;  4YYK A;  4CFL A;  5I1Q A;  5F60 A;  4ZC9 A;  5HCL A;  4XY8 A;  5CRM A;  5AD3 A;  5H1V A;  2R0S A;  4HXL A;  4TYL A;  4C66 A;  3LQI A;  5HQ5 A;  5HEM A;  4KV1 A; 
#chains in the Genus database with same CATH homology
 4NR6 A;  4CUU A;  5LVR A;  4QSR A;  5CTL A;  4AKN A;  1F68 A;  5FE8 A;  5L99 A;  5DLX A;  4MR5 A;  4YH4 A;  3P1F A;  3TLP A;  4A9F A;  4O77 A;  5EWV A;  3LXJ A;  4IOQ A;  4MEP A;  5EWD A;  5CQ6 A;  5L8U A;  5D3P A;  5D26 A;  4UYD A;  5LJ0 A;  4J0R A;  3K2J A;  2YEK A;  5EIS A;  4UIT A;  5LJ1 A;  5AMF A;  5D3N A;  3UVX A;  4O72 A;  2DKW A;  5AME A;  4UYH A;  5D3L A;  5HFQ A;  3DWY A;  4QY4 A;  5ENE A;  4A9H A;  5KU3 A;  4LDF A;  4NQM A;  5FE3 A;  5G4S A;  2G4A A;  5FB1 A;  5FE0 A;  5FE4 A;  5F2P A;  2D82 A;  5FB0 A;  3FKM X;  4UIU A;  4QST A;  5L98 A;  5EPR A;  3O36 A;  5I86 A;  4Z6H A;  2YYN A;  5ENB A;  4YBS A;  3Q2E A;  4NYV A;  4PY6 A;  5HRW A;  5HEL A;  5A7C A;  4OGJ A;  4TZ2 A;  3G0L A;  3U5O A;  2LSP B;  5FH6 A;  3ZYU A;  5IGK A;  5G4R A;  2YEM A;  1N72 A;  5TCM A;  4HBV A;  5CY9 A;  4NRB A;  3HME A;  4NUC A;  3UVW A;  4HXM A;  4UYF B;  5E74 A;  4BW2 A;  5D3R A;  4MEO A;  5F61 A;  3UV2 A;  3UV4 A;  4NR9 A;  4YAT A;  5FFV A;  5I88 A;  2YQD A;  5DFB A;  4CFK A;  3U5L A;  4BW4 A;  3O34 A;  5I83 A;  5LJ2 A;  4OGI A;  4PTB A;  1JSP B;  5IGN A;  5II1 A;  3U5P A;  4QB3 A;  5KTU A;  5H1U A;  2H60 A;  2FSA A;  4J1P A;  4HBY A;  4MEN A;  5CZG A;  5EK9 A;  5A85 A;  3SVF A;  4HXK A;  2DVQ A;  4O7A A;  5E9I A;  4YAB A;  5CUE A;  3LQH A;  5LKZ A;  4YYM A;  5DKH A;  5EM3 A;  5L97 A;  3JVK A;  4E96 A;  5EA1 A;  4YYJ A;  2E7O A;  5FE7 A;  5DKD A;  5AD2 A;  4QEW A;  2DWW A;  5A5P A;  3SVH A;  2YEL A;  5CUB A;  2F6N A;  2DVV A;  4Z6I A;  5DYC A;  5E9Y A;  5ETD A;  5HJC A;  2GRC A;  5E0R A;  5JI8 A;  5DY7 A;  2RO1 A;  4QUT A;  4BW3 A;  5E9K A;  5HFR A;  2NXB A;  5FE1 A;  5C4Q A;  3ONI A;  2L5E A;  5FG5 A;  4KCX A;  4XUA A;  4MEQ A;  4YAX A;  4LYI A;  4QSU A;  4ZQL A;  4J3I A;  5EIC A;  5FG6 A;  4QR4 A;  4LC2 A;  5CQ5 A;  5I89 A;  4QSS A;  5A82 A;  5IG6 A;  3NXB A;  4ALG A;  5ENF A;  5IID A;  5C85 A;  5CUG A;  4QUU A;  3S92 A;  3U5N A;  4Z93 A;  4TT6 A;  4GPJ A;  4MR4 A;  2OSS A;  5EGU A;  2L84 A;  3RCW A;  3QZS A;  3AQA A;  5FE9 A;  4O7C A;  4YYN A;  4QZS A;  2DVS A;  4YH3 A;  4CUP A;  4CUT A;  4TU4 A;  1E6I A;  5J0D A;  4BW1 A;  1X0J A;  5DYU A;  4QSP A;  4YYH A;  4A9O A;  4UIV A;  5FE5 A;  5CS8 A;  5I80 A;  5FFW A;  5HRX A;  5H85 A;  3IU5 A;  5E7D A;  3IU6 A;  5E3D A;  5DYX A;  5JWM A;  5ENI A;  4N4F A;  4QR5 A;  4C67 A;  4NUE A;  5CGP A;  5F36 A;  4XUB A;  5E9V A;  4XY9 A;  4Y03 A;  5EV9 A;  4QYD A;  4A9J A;  5CQA A;  4TT4 A;  1ZS5 A;  4NS5 A;  4LR6 A;  3I3J A;  5LVQ A;  2YW5 A;  5CFW A;  5CP5 A;  5DYA A;  4IR6 A;  4LZR A;  4HBW A;  3HMF A;  4WIV A;  3UVY A;  5HQ6 A;  5D24 A;  3QZT A;  2RFJ A;  4A9N A;  4A9L A;  3U5K A;  5C89 A;  5EPS A;  3U5M A;  4NRA A;  5IBN A;  5F63 A;  5C8G A;  5I29 A;  4UIZ A;  5DW2 A;  4UIX A;  5EQ1 A;  3O35 A;  2OUO A;  4YBM A;  4ZW1 A;  5I7X A;  4HXO A;  3QZV A;  5LKT A;  5D3J A;  5E9L A;  5EPB A;  4RVR A;  5CQ4 A;  5A83 A;  3LJW A;  4N4G A;  3P1D A;  5TB6 A;  5CPE A;  4UIY A;  4YY4 A;  4CLB A;  5CUA A;  2I7K A;  5IGL A;  4PCI A;  2RI7 A;  4QSW A;  5E3G A;  5CRZ A;  5DX4 A;  4CUQ A;  5FBX A;  4MR6 A;  5D3H A;  2E7N A;  4PS5 A;  4BJX A;  5FG4 A;  5F5Z A;  3HMH A;  4TU6 A;  4NYX A;  4UYG A;  4UYE A;  5CQ8 A;  4NR7 A;  4ALH A;  5HQ7 A;  5ENJ A;  2E3K A;  4O71 A;  4CUR A;  5ETB A;  4TQN A;  3U5J A;  5A5Q A;  4BHW A;  5CQ3 A;  5F25 A;  4QSX A;  5I40 A;  5KTW A;  5BT4 A;  2D9E A;  4IR4 A;  4HXN A;  5EVA A;  3MUL A;  4YC9 A;  2KTB B;  5CUD A;  4UIW A;  3UW9 A;  4WHU A;  3O37 A;  5EU1 A;  3SVG A;  5ENH A;  4QNS A;  2RNY A;  4NR8 A;  2DVR A;  4HXP A;  5D7X A;  4YYG A;  5H1T A;  3MB3 A;  3JVJ A;  4IR3 A;  4TTE A;  5D0C A;  5COI A;  4QEU A;  5ACY A;  4LRG A;  5HM0 A;  4QC1 A;  5F62 A;  4O78 A;  4Z1S A;  5I7Y A;  4YYD A;  5EWH A;  1WUG A;  5A5R A;  5LUU A;  2OO1 A;  4DON A;  3D7C A;  4O7F A;  4YAD A;  4Q0O A;  4IOO A;  2RNX A;  5DBM A;  4J0S A;  4NQN A;  5FFY A;  5KHM A;  4LYW A;  4LZS A;  2F6J A;  4WHW A;  4LZ2 A;  4MR3 A;  5EWC A;  5LKX A;  4FLP A;  2R0V A;  4O7B A;  4IR5 A;  3S91 A;  4N4I A;  4HBX A;  5FH7 A;  3GG3 A;  3P1C A;  5D25 A;  4TZ8 A;  4NRC A;  3UVD A;  5ENG A;  4A9K A;  2RNW A;  3MXF A;  4QSV A;  3MUK A;  4CL9 A;  5FE6 A;  4IOR A;  3AAD A;  5DFC A;  5E73 A;  2N9G A;  3Q2F A;  4O76 A;  4XYA A;  5K29 A;  5DFD A;  4KV4 A;  3G0J A;  4LYS A;  5C87 A;  4QBM A;  5ENC A;  4NUD A;  4QEV A;  4Z1Q A;  3O33 A;  2I8N A;  3UV5 A;  5FE2 A;  2R10 A;  4N3W A;  4YBT A;  5DKC A;  2L85 A;  4O74 A;  5A5N A;  4NR5 A;  5II2 A;  4F3I A;  4O70 A;  5D3T A;  2RS9 B;  4TT2 A;  4YYI A;  5LKU A;  4Q0N A;  3LQJ A;  4YK0 A;  4NR4 A;  5KO4 A;  1EQF A;  1WUM A;  4X2I A;  5HLS A;  2WP2 A;  4QYL A;  5D3S A;  5A5S A;  4HXS A;  3JVM A;  3JVL A;  4HXR A;  5HRV A;  5KTX A;  2MJV B;  4YY6 A;  5FDZ A;  4NXJ A;  5E9M A;  5F1H A;  4PCE A;  3DAI A;  4O7E A;  2YDW A;  4A9M A;  5CQ7 A;  5L8T A;  4N4H A;  5CU8 A;  5FH8 A;  4OUF A;  3P1E A;  5CQT A;  5BT3 A;  1JM4 B;  4TS8 A;  5EP7 A;  5L96 A;  4QR3 A;  5A5O A;  5HEN A;  2WP1 A;  5F1L A;  5CUC A;  5EWW A;  3P5O A;  5DW1 A;  3MQM A;  4A9I A;  5A81 A;  4PKL A;  4A9E A;  2R0Y A;  5BT5 A;  2DAT A;  3MB4 A;  5EI4 A;  5C7N A;  4UYF A;  5IGM A;  4QSQ A;  5DLZ A;  5F3A A;  4CUS A;  4NYW A;  4O75 A;  4QC3 A;  4YYK A;  4CFL A;  5I1Q A;  5F60 A;  4ZC9 A;  5HCL A;  4XY8 A;  5CRM A;  5AD3 A;  5H1V A;  2R0S A;  4HXL A;  4TYL A;  4C66 A;  3LQI A;  5HQ5 A;  5HEM A;  4KV1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...