5EWWA

Crystal structure of the human brpf1 bromodomain in complex with seed21
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
113
structure length
113
Chain Sequence
EMQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Peregrin
publication title Crystal structure of the human BRPF1 bromodomain in complex with SEED21
rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 41
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2015-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5ewwA00
4TQNA 5EA1A 4HBWA 5FFWA 5H1UA 3NXBA 4PCEA 4NR6A 4LYWA 4BHWA 5EVAA 2I7KA 4LRGA 3QZTA 5CRMA 4QEWA 4QSTA 5CPEA 5I83A 5HQ5A 5L8UA 5LVRA 4QSPA 3O35A 3QZVA 4WIVA 3I3JA 3LQHA 4PTBA 4TYLA 5ENBA 2GRCA 4C66A 5FE9A 4X2IA 4O7FA 2R0SA 2G4AA 4YYKA 5KU3A 4A9EA 5IGMA 5FE2A 3SVHA 3S91A 4J1PA 5DKHA 5AMEA 5D3SA 5DYCA 4E96A 5A5PA 5D3PA 5BT4A 2F6NA 4XY9A 4TS8A 4NQMA 5TB6A 5A5QA 2R0YA 5F1LA 4OGJA 1JSPB 3P1EA 4J0RA 4TZ2A 5KTWA 5D3LA 4PKLA 4DONA 3O37A 4YY4A 4HBYA 4IOQA 5II1A 5C4QA 5FG5A 4YAXA 3RCWA 5CZGA 4O74A 5EK9A 5E9LA 5C89A 4Z6HA 4YYGA 4WHUA 5DYXA 5CQAA 3UVYA 4NXJA 4YYIA 5I88A 3UVWA 5FE0A 5LJ1A 3P1CA 3IU5A 4CUSA 5IG6A 2OSSA 5EISA 5ENCA 4QSVA 3JVLA 5F3AA 4LC2A 5HFQA 5H1VA 4YY6A 3ZYUA 3MXFA 4HXOA 2DKWA 4A9LA 5D3NA 4XUBA 4OGIA 5F61A 4O72A 2OO1A 5D3HA 1JM4B 4UYFB 4Z93A 4O7BA 5EPRA 5HEMA 5JI8A 5A82A 5EWHA 4QR5A 4QYLA 4N4GA 4UYEA 2N9GA 5FE4A 3JVKA 2I8NA 4BW4A 4QR4A 5DFBA 5FG6A 2D82A 3UV2A 4YYDA 4MEOA 4XUAA 4FLPA 2L84A 3JVMA 5KTXA 3P1DA 3UVXA 4LYIA 3D7CA 4QZSA 5EP7A 4NUCA 4NQNA 4YBSA 4QBMA 5D3RA 5I80A 4NYXA 2WP1A 5FE6A 4UIWA 5AD2A 4O76A 4IR3A 5D3JA 5L98A 5CUDA 5ENFA 4N4HA 5A5OA 3U5PA 3LQJA 4BW1A 4NS5A 3MQMA 5IIDA 5I7XA 2R0VA 5CUAA 3AADA 5ENJA 4YH4A 5A5NA 4ALGA 5CY9A 5F63A 2YEKA 3UV4A 4HXKA 3G0JA 4CURA 4HXRA 5EPSA 5FE7A 4MEPA 4NR5A 4NR7A 3P5OA 4Q0OA 5FFVA 5ETDA 4MR5A 5FE3A 3AQAA 4QC1A 5DFDA 4YK0A 4QNSA 2MJVB 4NR9A 4Y03A 4AKNA 2NXBA 3DWYA 2LSPB 5CQTA 2E3KA 4HBVA 2RI7A 5EM3A 4YADA 4CUPA 5F62A 2YDWA 5D0CA 3JVJA 4UITA 5ENHA 4XYAA 5DFCA 4Q0NA 5FH7A 4HBXA 3MB3A 2DWWA 3U5JA 4TTEA 4NYVA 2R10A 5LUUA 5E7DA 1X0JA 5C85A 5DX4A 4J0SA 4QSSA 4QSWA 5KHMA 4LZRA 5DY7A 5LJ0A 1E6IA 3MB4A 3FKMX 4CL9A 4LR6A 5F36A 4N4FA 4NR8A 5HRXA 4TT6A 4CUUA 4A9IA 4Z6IA 5F1HA 4PCIA 4GPJA 5H1TA 5HJCA 5L96A 5A81A 5BT5A 5K29A 5LKTA 5ENGA 5FB1A 4TU6A 4XY8A 4NRBA 5I1QA 4F3IA 4UYHA 4Z1QA 3HMEA 5FDZA 4TT4A 2DVSA 5DW1A 3P1FA 4NUEA 5TCMA 5CUCA 3S92A 3TLPA 4UYDA 5HELA 5EV9A 3Q2FA 5LKXA 5C7NA 4UYFA 2D9EA 4NR4A 4YYHA 4UIVA 4ZW1A 2DVQA 2FSAA 5ENEA 5HM0A 4O71A 5DKDA 5LVQA 5L99A 5A85A 2YW5A 4KV1A 2YYNA 5HLSA 4IR5A 4HXSA 5EICA 5J0DA 5I89A 3HMFA 4YATA 5D7XA 5G4SA 4O77A 4YC9A 2YEMA 5DKCA 5EQ1A 5IGLA 3GG3A 4NRCA 2L5EA 4PS5A 5E73A 2YELA 5IGNA 3O33A 5LKUA 5I86A 5LKZA 4YH3A 4LZSA 5CP5A 4NUDA 3IU6A 5ETBA 2E7NA 4QR3A 4QY4A 5EWDA 5CQ5A 4BW3A 4A9NA 4MEQA 4N3WA 5FG4A 3SVGA 4NRAA 4ZQLA 4QSXA 5EPBA 5C8GA 4BJXA 4QSRA 5CQ3A 3G0LA 5IGKA 4HXMA 2KTBB 4O7EA 4BW2A 5E0RA 5CUEA 4NYWA 3U5OA 3K2JA 2OUOA 3HMHA 5D25A 3QZSA 4LYSA 5HFRA 5FH8A 5LJ2A 3U5LA 4HXPA 5HRWA 4QSUA 5F5ZA 4Z1SA 4UIZA 4WHWA 5A83A 2RNXA 4A9OA 5I40A 2RS9B 2YQDA 5CQ7A 5F2PA 5II2A 4TT2A 3UV5A 4A9FA 4O70A 3MUKA 5A5SA 5D3TA 4IORA 4CFLA 4O75A 3UW9A 5FE5A 4QUTA 4CFKA 4QEUA 4HXNA 5EWCA 5E9KA 5F60A 4CUQA 4YYJA 5CUBA 5C87A 4MENA 5BT3A 5E3DA 4YBTA 4QB3A 5CUGA 5E9VA 4OUFA 2DVRA 4UIYA 5H85A 5L8TA 3U5NA 4LDFA 4A9JA 4IR6A 4QYDA 1EQFA 2DATA 4ZC9A 5COIA 4LZ2A 4TZ8A 5D24A 5FH6A 4O7AA 1ZS5A 4CUTA 4QUUA 4KCXA 5A5RA 5KO4A 5I7YA 4UYGA 2H60A 2WP2A 3LXJA 4ALHA 5E74A 3O36A 5DLXA 2L85A 5E9MA 5CS8A 5DYUA 4KV4A 1N72A 5DW2A 5JWMA 4J3IA 5FBXA 4QEVA 1WUMA 2RNYA 5ACYA 2RNWA 4QC3A 4QSQA 2E7OA 5EGUA 4YYNA 1WUGA 4MR4A 4CLBA 5G4RA 3Q2EA 5DBMA 5AD3A 5EI4A 5IBNA 4A9KA 5CFWA 5HENA 5CGPA 3UVDA 3O34A 5AMFA 4TU4A 5FFYA 5DYAA 5CU8A 5EWWA 5FE1A 5L97A 5HRVA 5A7CA 5FB0A 4HXLA 4YABA 4A9MA 3ONIA 4O78A 3DAIA 2RO1A 3MULA 2RFJA 4MR3A 5KTUA 5EU1A 4O7CA 5E9IA 3U5MA 5FE8A 4PY6A 4IR4A 2F6JA 5ENIA 3SVFA 4IOOA 4A9HA 5HCLA 1F68A 5E9YA 2DVVA 5CQ8A 5CTLA 4UIUA 5EWVA 4YYMA 4UIXA 3U5KA 3LQIA 4YBMA 4RVRA 5CRZA 5E3GA 5CQ4A 5HQ7A 5F25A 5I29A 4MR6A 4N4IA 5CQ6A 4C67A 5D26A 3LJWA 5DLZA 5HQ6A
chains in the Genus database with same CATH superfamily
4TQNA 5EA1A 4HBWA 5FFWA 5H1UA 3NXBA 4PCEA 4NR6A 4LYWA 4BHWA 5EVAA 2I7KA 4LRGA 3QZTA 5CRMA 4QEWA 4QSTA 5CPEA 5I83A 5HQ5A 5L8UA 5LVRA 4QSPA 3O35A 3QZVA 4WIVA 3I3JA 3LQHA 3ERRA 4PTBA 4TYLA 5ENBA 2GRCA 4C66A 5FE9A 4X2IA 4O7FA 2R0SA 2G4AA 4YYKA 5KU3A 4A9EA 5IGMA 5FE2A 3SVHA 3S91A 4J1PA 5DKHA 5AMEA 5D3SA 5DYCA 4E96A 5A5PA 5D3PA 5BT4A 2F6NA 4XY9A 4TS8A 4NQMA 5TB6A 5A5QA 2R0YA 5F1LA 4OGJA 1JSPB 3P1EA 4J0RA 4TZ2A 5KTWA 5D3LA 4PKLA 4DONA 3O37A 4YY4A 4HBYA 4IOQA 5II1A 5C4QA 5FG5A 4YAXA 3D1DA 3RCWA 5CZGA 4O74A 5EK9A 5E9LA 5C89A 4Z6HA 4YYGA 4WHUA 5DYXA 5CQAA 3UVYA 4NXJA 4YYIA 5I88A 3UVWA 5FE0A 5LJ1A 3P1CA 3IU5A 4CUSA 5IG6A 2OSSA 5EISA 5ENCA 4QSVA 3JVLA 5F3AA 4LC2A 5HFQA 5H1VA 4YY6A 3ZYUA 3MXFA 4HXOA 2DKWA 4A9LA 5D3NA 4XUBA 4OGIA 5F61A 4O72A 2OO1A 5D3HA 1JM4B 4UYFB 4Z93A 4O7BA 5EPRA 5HEMA 5JI8A 5A82A 5EWHA 4QR5A 4QYLA 4N4GA 4UYEA 2N9GA 5FE4A 1ZKRA 3JVKA 2I8NA 4BW4A 4QR4A 5DFBA 5FG6A 2D82A 3UV2A 4YYDA 4MEOA 4XUAA 4FLPA 2L84A 3JVMA 5KTXA 3P1DA 3UVXA 4LYIA 3D7CA 4QZSA 5EP7A 4NUCA 4NQNA 4YBSA 4QBMA 5D3RA 5I80A 4NYXA 2WP1A 5FE6A 4UIWA 5AD2A 4O76A 4IR3A 5D3JA 5L98A 5CUDA 5ENFA 4N4HA 5A5OA 3U5PA 3LQJA 4BW1A 4NS5A 3MQMA 5IIDA 5I7XA 2R0VA 5CUAA 3AADA 5ENJA 4YH4A 5A5NA 4ALGA 5CY9A 5F63A 2YEKA 3UV4A 4HXKA 3G0JA 4CURA 4HXRA 5EPSA 5FE7A 4MEPA 4NR5A 4NR7A 3P5OA 4Q0OA 5FFVA 5ETDA 4MR5A 5FE3A 3AQAA 4QC1A 5DFDA 4YK0A 4QNSA 2MJVB 4NR9A 4AKIA 4Y03A 4AKNA 2NXBA 3DWYA 3VKGA 2LSPB 5CQTA 2E3KA 4HBVA 2RI7A 5EM3A 4YADA 4CUPA 5F62A 2YDWA 5D0CA 3JVJA 4UITA 5ENHA 4XYAA 5DFCA 4Q0NA 5FH7A 4HBXA 3MB3A 2DWWA 3U5JA 4TTEA 4NYVA 2R10A 5LUUA 5E7DA 1PUOA 1X0JA 5C85A 5DX4A 4J0SA 2EJNA 4QSSA 4QSWA 5KHMA 4LZRA 5DY7A 5LJ0A 1E6IA 3MB4A 3FKMX 4CL9A 4LR6A 5F36A 4N4FA 4NR8A 5HRXA 4TT6A 4CUUA 4A9IA 4Z6IA 5F1HA 4PCIA 4GPJA 5H1TA 5HJCA 5L96A 5A81A 5BT5A 5K29A 5LKTA 5ENGA 5FB1A 4TU6A 4XY8A 4NRBA 5I1QA 4F3IA 4UYHA 4Z1QA 3HMEA 5FDZA 4TT4A 2DVSA 5DW1A 3P1FA 4NUEA 5TCMA 5CUCA 3S92A 3TLPA 4UYDA 5HELA 5EV9A 3Q2FA 5LKXA 5C7NA 4UYFA 2D9EA 4NR4A 4YYHA 4UIVA 4ZW1A 2DVQA 2FSAA 5ENEA 5HM0A 4O71A 5DKDA 5LVQA 5L99A 5A85A 2YW5A 4KV1A 2YYNA 5HLSA 4IR5A 4HXSA 5EICA 5J0DA 4AKHA 5I89A 3HMFA 4YATA 5D7XA 5G4SA 4O77A 4YC9A 2YEMA 5DKCA 5EQ1A 5IGLA 3GG3A 4NRCA 2L5EA 4PS5A 5E73A 2YELA 5IGNA 3O33A 5LKUA 5I86A 5LKZA 4YH3A 4LZSA 5CP5A 4NUDA 3IU6A 5ETBA 2E7NA 4QR3A 4QY4A 5EWDA 4AI6A 5CQ5A 4BW3A 4A9NA 4MEQA 4N3WA 5FG4A 3SVGA 4NRAA 4ZQLA 4QSXA 5EPBA 5C8GA 4BJXA 4QSRA 5CQ3A 3G0LA 5IGKA 4HXMA 2KTBB 4O7EA 4BW2A 5E0RA 5CUEA 4NYWA 3U5OA 3K2JA 2OUOA 3HMHA 5D25A 3QZSA 4LYSA 5HFRA 5FH8A 5LJ2A 3U5LA 4HXPA 5HRWA 4QSUA 5F5ZA 4Z1SA 4UIZA 4WHWA 5A83A 2RNXA 4A9OA 5I40A 2RS9B 2YQDA 5CQ7A 5F2PA 5II2A 4TT2A 3UV5A 4A9FA 4O70A 3MUKA 5A5SA 5D3TA 4IORA 4CFLA 4O75A 3UW9A 5FE5A 4QUTA 4CFKA 4QEUA 4HXNA 5EWCA 5E9KA 5F60A 4CUQA 4YYJA 5CUBA 5C87A 4MENA 5BT3A 5E3DA 4YBTA 4QB3A 5CUGA 5E9VA 4OUFA 2DVRA 4UIYA 5H85A 5L8TA 3U5NA 4LDFA 4A9JA 4IR6A 4QYDA 1EQFA 2DATA 4ZC9A 5COIA 4LZ2A 4TZ8A 5D24A 5FH6A 4O7AA 1ZS5A 4CUTA 4QUUA 4KCXA 5A5RA 5KO4A 5I7YA 4UYGA 2H60A 2WP2A 3LXJA 4ALHA 5E74A 3O36A 5DLXA 2L85A 5E9MA 5CS8A 5DYUA 4KV4A 1N72A 5DW2A 5JWMA 4J3IA 5FBXA 4QEVA 1WUMA 2RNYA 5ACYA 2RNWA 4QC3A 4QSQA 2E7OA 5EGUA 4YYNA 1WUGA 4MR4A 4CLBA 5G4RA 3Q2EA 5DBMA 5AD3A 5EI4A 5IBNA 4A9KA 5CFWA 5HENA 3VKHA 5CGPA 3UVDA 3O34A 5AMFA 4TU4A 5FFYA 5DYAA 5CU8A 5EWWA 5FE1A 5L97A 5HRVA 5A7CA 5FB0A 4HXLA 4YABA 4A9MA 3ONIA 4O78A 3DAIA 2RO1A 3MULA 2RFJA 4MR3A 5KTUA 5EU1A 4O7CA 5E9IA 3U5MA 5FE8A 4PY6A 4IR4A 2F6JA 5ENIA 3D1BA 3SVFA 4IOOA 4A9HA 5HCLA 1F68A 5E9YA 2DVVA 5CQ8A 5CTLA 4UIUA 5EWVA 4YYMA 4UIXA 3U5KA 3LQIA 4YBMA 4RVRA 5CRZA 5E3GA 5CQ4A 5HQ7A 4AKGA 5F25A 5I29A 4MR6A 4N4IA 5CQ6A 4C67A 5D26A 3LJWA 5DLZA 5HQ6A
chains in the Genus database with same CATH topology
4TQNA 5EA1A 4HBWA 5FFWA 5H1UA 3NXBA 4PCEA 4NR6A 4LYWA 4BHWA 5EVAA 2I7KA 4LRGA 3QZTA 5CRMA 4QEWA 4QSTA 5CPEA 5I83A 5HQ5A 5L8UA 5LVRA 4QSPA 3O35A 3QZVA 4WIVA 3I3JA 3LQHA 4PTBA 4TYLA 5ENBA 2GRCA 4C66A 5FE9A 4X2IA 4O7FA 2R0SA 2G4AA 4YYKA 5KU3A 4A9EA 5IGMA 5FE2A 3SVHA 3S91A 4J1PA 5DKHA 5AMEA 5D3SA 5DYCA 4E96A 5A5PA 5D3PA 5BT4A 2F6NA 4XY9A 4TS8A 4NQMA 5TB6A 5A5QA 2R0YA 5F1LA 4OGJA 1JSPB 3P1EA 4J0RA 4TZ2A 5KTWA 5D3LA 4PKLA 4DONA 3O37A 4YY4A 4HBYA 4IOQA 5II1A 5C4QA 5FG5A 4YAXA 3RCWA 5CZGA 4O74A 5EK9A 5E9LA 5C89A 4Z6HA 4YYGA 4WHUA 5DYXA 5CQAA 3UVYA 4NXJA 4YYIA 5I88A 3UVWA 5FE0A 5LJ1A 3P1CA 3IU5A 4CUSA 5IG6A 2OSSA 5EISA 5ENCA 4QSVA 3JVLA 5F3AA 4LC2A 5HFQA 5H1VA 4YY6A 3ZYUA 3MXFA 4HXOA 2DKWA 4A9LA 5D3NA 4XUBA 4OGIA 5F61A 4O72A 2OO1A 5D3HA 1JM4B 4UYFB 4Z93A 4O7BA 5EPRA 5HEMA 5JI8A 5A82A 5EWHA 4QR5A 4QYLA 4N4GA 4UYEA 2N9GA 5FE4A 3JVKA 2I8NA 4BW4A 4QR4A 5DFBA 5FG6A 2D82A 3UV2A 4YYDA 4MEOA 4XUAA 4FLPA 2L84A 3JVMA 5KTXA 3P1DA 3UVXA 4LYIA 3D7CA 4QZSA 5EP7A 4NUCA 4NQNA 4YBSA 4QBMA 5D3RA 5I80A 4NYXA 2WP1A 5FE6A 4UIWA 5AD2A 4O76A 4IR3A 5D3JA 5L98A 5CUDA 5ENFA 4N4HA 5A5OA 3U5PA 3LQJA 4BW1A 4NS5A 3MQMA 5IIDA 5I7XA 2R0VA 5CUAA 3AADA 5ENJA 4YH4A 5A5NA 4ALGA 5CY9A 5F63A 2YEKA 3UV4A 4HXKA 3G0JA 4CURA 4HXRA 5EPSA 5FE7A 4MEPA 4NR5A 4NR7A 3P5OA 4Q0OA 5FFVA 5ETDA 4MR5A 5FE3A 3AQAA 4QC1A 5DFDA 4YK0A 4QNSA 2MJVB 4NR9A 4Y03A 4AKNA 2NXBA 3DWYA 2LSPB 5CQTA 2E3KA 4HBVA 2RI7A 5EM3A 4YADA 4CUPA 5F62A 2YDWA 5D0CA 3JVJA 4UITA 5ENHA 4XYAA 5DFCA 4Q0NA 5FH7A 4HBXA 3MB3A 2DWWA 3U5JA 4TTEA 4NYVA 2R10A 5LUUA 5E7DA 1X0JA 5C85A 5DX4A 4J0SA 4QSSA 4QSWA 5KHMA 4LZRA 5DY7A 5LJ0A 1E6IA 3MB4A 3FKMX 4CL9A 4LR6A 5F36A 4N4FA 4NR8A 5HRXA 4TT6A 4CUUA 4A9IA 4Z6IA 5F1HA 4PCIA 4GPJA 5H1TA 5HJCA 5L96A 5A81A 5BT5A 5K29A 5LKTA 5ENGA 5FB1A 4TU6A 4XY8A 4NRBA 5I1QA 4F3IA 4UYHA 4Z1QA 3HMEA 5FDZA 4TT4A 2DVSA 5DW1A 3P1FA 4NUEA 5TCMA 5CUCA 3S92A 3TLPA 4UYDA 5HELA 5EV9A 3Q2FA 5LKXA 5C7NA 4UYFA 2D9EA 4NR4A 4YYHA 4UIVA 4ZW1A 2DVQA 2FSAA 5ENEA 5HM0A 4O71A 5DKDA 5LVQA 5L99A 5A85A 2YW5A 4KV1A 2YYNA 5HLSA 4IR5A 4HXSA 5EICA 5J0DA 5I89A 3HMFA 4YATA 5D7XA 5G4SA 4O77A 4YC9A 2YEMA 5DKCA 5EQ1A 5IGLA 3GG3A 4NRCA 2L5EA 4PS5A 5E73A 2YELA 5IGNA 3O33A 5LKUA 5I86A 5LKZA 4YH3A 4LZSA 5CP5A 4NUDA 3IU6A 5ETBA 2E7NA 4QR3A 4QY4A 5EWDA 5CQ5A 4BW3A 4A9NA 4MEQA 4N3WA 5FG4A 3SVGA 4NRAA 4ZQLA 4QSXA 5EPBA 5C8GA 4BJXA 4QSRA 5CQ3A 3G0LA 5IGKA 4HXMA 2KTBB 4O7EA 4BW2A 5E0RA 5CUEA 4NYWA 3U5OA 3K2JA 2OUOA 3HMHA 5D25A 3QZSA 4LYSA 5HFRA 5FH8A 5LJ2A 3U5LA 4HXPA 5HRWA 4QSUA 5F5ZA 4Z1SA 4UIZA 4WHWA 5A83A 2RNXA 4A9OA 5I40A 2RS9B 2YQDA 5CQ7A 5F2PA 5II2A 4TT2A 3UV5A 4A9FA 4O70A 3MUKA 5A5SA 5D3TA 4IORA 4CFLA 4O75A 3UW9A 5FE5A 4QUTA 4CFKA 4QEUA 4HXNA 5EWCA 5E9KA 5F60A 4CUQA 4YYJA 5CUBA 5C87A 4MENA 5BT3A 5E3DA 4YBTA 4QB3A 5CUGA 5E9VA 4OUFA 2DVRA 4UIYA 5H85A 5L8TA 3U5NA 4LDFA 4A9JA 4IR6A 4QYDA 1EQFA 2DATA 4ZC9A 5COIA 4LZ2A 4TZ8A 5D24A 5FH6A 4O7AA 1ZS5A 4CUTA 4QUUA 4KCXA 5A5RA 5KO4A 5I7YA 4UYGA 2H60A 2WP2A 3LXJA 4ALHA 5E74A 3O36A 5DLXA 2L85A 5E9MA 5CS8A 5DYUA 4KV4A 1N72A 5DW2A 5JWMA 4J3IA 5FBXA 4QEVA 1WUMA 2RNYA 5ACYA 2RNWA 4QC3A 4QSQA 2E7OA 5EGUA 4YYNA 1WUGA 4MR4A 4CLBA 5G4RA 3Q2EA 5DBMA 5AD3A 5EI4A 5IBNA 4A9KA 5CFWA 5HENA 5CGPA 3UVDA 3O34A 5AMFA 4TU4A 5FFYA 5DYAA 5CU8A 5EWWA 5FE1A 5L97A 5HRVA 5A7CA 5FB0A 4HXLA 4YABA 4A9MA 3ONIA 4O78A 3DAIA 2RO1A 3MULA 2RFJA 4MR3A 5KTUA 5EU1A 4O7CA 5E9IA 3U5MA 5FE8A 4PY6A 4IR4A 2F6JA 5ENIA 3SVFA 4IOOA 4A9HA 5HCLA 1F68A 5E9YA 2DVVA 5CQ8A 5CTLA 4UIUA 5EWVA 4YYMA 4UIXA 3U5KA 3LQIA 4YBMA 4RVRA 5CRZA 5E3GA 5CQ4A 5HQ7A 5F25A 5I29A 4MR6A 4N4IA 5CQ6A 4C67A 5D26A 3LJWA 5DLZA 5HQ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TQN A;  5EA1 A;  4HBW A;  5FFW A;  5H1U A;  3NXB A;  4PCE A;  4NR6 A;  4LYW A;  4BHW A;  5EVA A;  2I7K A;  4LRG A;  3QZT A;  5CRM A;  4QEW A;  4QST A;  5CPE A;  5I83 A;  5HQ5 A;  5L8U A;  5LVR A;  4QSP A;  3O35 A;  3QZV A;  4WIV A;  3I3J A;  3LQH A;  4PTB A;  4TYL A;  5ENB A;  2GRC A;  4C66 A;  5FE9 A;  4X2I A;  4O7F A;  2R0S A;  2G4A A;  4YYK A;  5KU3 A;  4A9E A;  5IGM A;  5FE2 A;  3SVH A;  3S91 A;  4J1P A;  5DKH A;  5AME A;  5D3S A;  5DYC A;  4E96 A;  5A5P A;  5D3P A;  5BT4 A;  2F6N A;  4XY9 A;  4TS8 A;  4NQM A;  5TB6 A;  5A5Q A;  2R0Y A;  5F1L A;  4OGJ A;  1JSP B;  3P1E A;  4J0R A;  4TZ2 A;  5KTW A;  5D3L A;  4PKL A;  4DON A;  3O37 A;  4YY4 A;  4HBY A;  4IOQ A;  5II1 A;  5C4Q A;  5FG5 A;  4YAX A;  3RCW A;  5CZG A;  4O74 A;  5EK9 A;  5E9L A;  5C89 A;  4Z6H A;  4YYG A;  4WHU A;  5DYX A;  5CQA A;  3UVY A;  4NXJ A;  4YYI A;  5I88 A;  3UVW A;  5FE0 A;  5LJ1 A;  3P1C A;  3IU5 A;  4CUS A;  5IG6 A;  2OSS A;  5EIS A;  5ENC A;  4QSV A;  3JVL A;  5F3A A;  4LC2 A;  5HFQ A;  5H1V A;  4YY6 A;  3ZYU A;  3MXF A;  4HXO A;  2DKW A;  4A9L A;  5D3N A;  4XUB A;  4OGI A;  5F61 A;  4O72 A;  2OO1 A;  5D3H A;  1JM4 B;  4UYF B;  4Z93 A;  4O7B A;  5EPR A;  5HEM A;  5JI8 A;  5A82 A;  5EWH A;  4QR5 A;  4QYL A;  4N4G A;  4UYE A;  2N9G A;  5FE4 A;  3JVK A;  2I8N A;  4BW4 A;  4QR4 A;  5DFB A;  5FG6 A;  2D82 A;  3UV2 A;  4YYD A;  4MEO A;  4XUA A;  4FLP A;  2L84 A;  3JVM A;  5KTX A;  3P1D A;  3UVX A;  4LYI A;  3D7C A;  4QZS A;  5EP7 A;  4NUC A;  4NQN A;  4YBS A;  4QBM A;  5D3R A;  5I80 A;  4NYX A;  2WP1 A;  5FE6 A;  4UIW A;  5AD2 A;  4O76 A;  4IR3 A;  5D3J A;  5L98 A;  5CUD A;  5ENF A;  4N4H A;  5A5O A;  3U5P A;  3LQJ A;  4BW1 A;  4NS5 A;  3MQM A;  5IID A;  5I7X A;  2R0V A;  5CUA A;  3AAD A;  5ENJ A;  4YH4 A;  5A5N A;  4ALG A;  5CY9 A;  5F63 A;  2YEK A;  3UV4 A;  4HXK A;  3G0J A;  4CUR A;  4HXR A;  5EPS A;  5FE7 A;  4MEP A;  4NR5 A;  4NR7 A;  3P5O A;  4Q0O A;  5FFV A;  5ETD A;  4MR5 A;  5FE3 A;  3AQA A;  4QC1 A;  5DFD A;  4YK0 A;  4QNS A;  2MJV B;  4NR9 A;  4Y03 A;  4AKN A;  2NXB A;  3DWY A;  2LSP B;  5CQT A;  2E3K A;  4HBV A;  2RI7 A;  5EM3 A;  4YAD A;  4CUP A;  5F62 A;  2YDW A;  5D0C A;  3JVJ A;  4UIT A;  5ENH A;  4XYA A;  5DFC A;  4Q0N A;  5FH7 A;  4HBX A;  3MB3 A;  2DWW A;  3U5J A;  4TTE A;  4NYV A;  2R10 A;  5LUU A;  5E7D A;  1X0J A;  5C85 A;  5DX4 A;  4J0S A;  4QSS A;  4QSW A;  5KHM A;  4LZR A;  5DY7 A;  5LJ0 A;  1E6I A;  3MB4 A;  3FKM X;  4CL9 A;  4LR6 A;  5F36 A;  4N4F A;  4NR8 A;  5HRX A;  4TT6 A;  4CUU A;  4A9I A;  4Z6I A;  5F1H A;  4PCI A;  4GPJ A;  5H1T A;  5HJC A;  5L96 A;  5A81 A;  5BT5 A;  5K29 A;  5LKT A;  5ENG A;  5FB1 A;  4TU6 A;  4XY8 A;  4NRB A;  5I1Q A;  4F3I A;  4UYH A;  4Z1Q A;  3HME A;  5FDZ A;  4TT4 A;  2DVS A;  5DW1 A;  3P1F A;  4NUE A;  5TCM A;  5CUC A;  3S92 A;  3TLP A;  4UYD A;  5HEL A;  5EV9 A;  3Q2F A;  5LKX A;  5C7N A;  4UYF A;  2D9E A;  4NR4 A;  4YYH A;  4UIV A;  4ZW1 A;  2DVQ A;  2FSA A;  5ENE A;  5HM0 A;  4O71 A;  5DKD A;  5LVQ A;  5L99 A;  5A85 A;  2YW5 A;  4KV1 A;  2YYN A;  5HLS A;  4IR5 A;  4HXS A;  5EIC A;  5J0D A;  5I89 A;  3HMF A;  4YAT A;  5D7X A;  5G4S A;  4O77 A;  4YC9 A;  2YEM A;  5DKC A;  5EQ1 A;  5IGL A;  3GG3 A;  4NRC A;  2L5E A;  4PS5 A;  5E73 A;  2YEL A;  5IGN A;  3O33 A;  5LKU A;  5I86 A;  5LKZ A;  4YH3 A;  4LZS A;  5CP5 A;  4NUD A;  3IU6 A;  5ETB A;  2E7N A;  4QR3 A;  4QY4 A;  5EWD A;  5CQ5 A;  4BW3 A;  4A9N A;  4MEQ A;  4N3W A;  5FG4 A;  3SVG A;  4NRA A;  4ZQL A;  4QSX A;  5EPB A;  5C8G A;  4BJX A;  4QSR A;  5CQ3 A;  3G0L A;  5IGK A;  4HXM A;  2KTB B;  4O7E A;  4BW2 A;  5E0R A;  5CUE A;  4NYW A;  3U5O A;  3K2J A;  2OUO A;  3HMH A;  5D25 A;  3QZS A;  4LYS A;  5HFR A;  5FH8 A;  5LJ2 A;  3U5L A;  4HXP A;  5HRW A;  4QSU A;  5F5Z A;  4Z1S A;  4UIZ A;  4WHW A;  5A83 A;  2RNX A;  4A9O A;  5I40 A;  2RS9 B;  2YQD A;  5CQ7 A;  5F2P A;  5II2 A;  4TT2 A;  3UV5 A;  4A9F A;  4O70 A;  3MUK A;  5A5S A;  5D3T A;  4IOR A;  4CFL A;  4O75 A;  3UW9 A;  5FE5 A;  4QUT A;  4CFK A;  4QEU A;  4HXN A;  5EWC A;  5E9K A;  5F60 A;  4CUQ A;  4YYJ A;  5CUB A;  5C87 A;  4MEN A;  5BT3 A;  5E3D A;  4YBT A;  4QB3 A;  5CUG A;  5E9V A;  4OUF A;  2DVR A;  4UIY A;  5H85 A;  5L8T A;  3U5N A;  4LDF A;  4A9J A;  4IR6 A;  4QYD A;  1EQF A;  2DAT A;  4ZC9 A;  5COI A;  4LZ2 A;  4TZ8 A;  5D24 A;  5FH6 A;  4O7A A;  1ZS5 A;  4CUT A;  4QUU A;  4KCX A;  5A5R A;  5KO4 A;  5I7Y A;  4UYG A;  2H60 A;  2WP2 A;  3LXJ A;  4ALH A;  5E74 A;  3O36 A;  5DLX A;  2L85 A;  5E9M A;  5CS8 A;  5DYU A;  4KV4 A;  1N72 A;  5DW2 A;  5JWM A;  4J3I A;  5FBX A;  4QEV A;  1WUM A;  2RNY A;  5ACY A;  2RNW A;  4QC3 A;  4QSQ A;  2E7O A;  5EGU A;  4YYN A;  1WUG A;  4MR4 A;  4CLB A;  5G4R A;  3Q2E A;  5DBM A;  5AD3 A;  5EI4 A;  5IBN A;  4A9K A;  5CFW A;  5HEN A;  5CGP A;  3UVD A;  3O34 A;  5AMF A;  4TU4 A;  5FFY A;  5DYA A;  5CU8 A;  5EWW A;  5FE1 A;  5L97 A;  5HRV A;  5A7C A;  5FB0 A;  4HXL A;  4YAB A;  4A9M A;  3ONI A;  4O78 A;  3DAI A;  2RO1 A;  3MUL A;  2RFJ A;  4MR3 A;  5KTU A;  5EU1 A;  4O7C A;  5E9I A;  3U5M A;  5FE8 A;  4PY6 A;  4IR4 A;  2F6J A;  5ENI A;  3SVF A;  4IOO A;  4A9H A;  5HCL A;  1F68 A;  5E9Y A;  2DVV A;  5CQ8 A;  5CTL A;  4UIU A;  5EWV A;  4YYM A;  4UIX A;  3U5K A;  3LQI A;  4YBM A;  4RVR A;  5CRZ A;  5E3G A;  5CQ4 A;  5HQ7 A;  5F25 A;  5I29 A;  4MR6 A;  4N4I A;  5CQ6 A;  4C67 A;  5D26 A;  3LJW A;  5DLZ A;  5HQ6 A; 
#chains in the Genus database with same CATH topology
 4TQN A;  5EA1 A;  4HBW A;  5FFW A;  5H1U A;  3NXB A;  4PCE A;  4NR6 A;  4LYW A;  4BHW A;  5EVA A;  2I7K A;  4LRG A;  3QZT A;  5CRM A;  4QEW A;  4QST A;  5CPE A;  5I83 A;  5HQ5 A;  5L8U A;  5LVR A;  4QSP A;  3O35 A;  3QZV A;  4WIV A;  3I3J A;  3LQH A;  3ERR A;  4PTB A;  4TYL A;  5ENB A;  2GRC A;  4C66 A;  5FE9 A;  4X2I A;  4O7F A;  2R0S A;  2G4A A;  4YYK A;  5KU3 A;  4A9E A;  5IGM A;  5FE2 A;  3SVH A;  3S91 A;  4J1P A;  5DKH A;  5AME A;  5D3S A;  5DYC A;  4E96 A;  5A5P A;  5D3P A;  5BT4 A;  2F6N A;  4XY9 A;  4TS8 A;  4NQM A;  5TB6 A;  5A5Q A;  2R0Y A;  5F1L A;  4OGJ A;  1JSP B;  3P1E A;  4J0R A;  4TZ2 A;  5KTW A;  5D3L A;  4PKL A;  4DON A;  3O37 A;  4YY4 A;  4HBY A;  4IOQ A;  5II1 A;  5C4Q A;  5FG5 A;  4YAX A;  3D1D A;  3RCW A;  5CZG A;  4O74 A;  5EK9 A;  5E9L A;  5C89 A;  4Z6H A;  4YYG A;  4WHU A;  5DYX A;  5CQA A;  3UVY A;  4NXJ A;  4YYI A;  5I88 A;  3UVW A;  5FE0 A;  5LJ1 A;  3P1C A;  3IU5 A;  4CUS A;  5IG6 A;  2OSS A;  5EIS A;  5ENC A;  4QSV A;  3JVL A;  5F3A A;  4LC2 A;  5HFQ A;  5H1V A;  4YY6 A;  3ZYU A;  3MXF A;  4HXO A;  2DKW A;  4A9L A;  5D3N A;  4XUB A;  4OGI A;  5F61 A;  4O72 A;  2OO1 A;  5D3H A;  1JM4 B;  4UYF B;  4Z93 A;  4O7B A;  5EPR A;  5HEM A;  5JI8 A;  5A82 A;  5EWH A;  4QR5 A;  4QYL A;  4N4G A;  4UYE A;  2N9G A;  5FE4 A;  1ZKR A;  3JVK A;  2I8N A;  4BW4 A;  4QR4 A;  5DFB A;  5FG6 A;  2D82 A;  3UV2 A;  4YYD A;  4MEO A;  4XUA A;  4FLP A;  2L84 A;  3JVM A;  5KTX A;  3P1D A;  3UVX A;  4LYI A;  3D7C A;  4QZS A;  5EP7 A;  4NUC A;  4NQN A;  4YBS A;  4QBM A;  5D3R A;  5I80 A;  4NYX A;  2WP1 A;  5FE6 A;  4UIW A;  5AD2 A;  4O76 A;  4IR3 A;  5D3J A;  5L98 A;  5CUD A;  5ENF A;  4N4H A;  5A5O A;  3U5P A;  3LQJ A;  4BW1 A;  4NS5 A;  3MQM A;  5IID A;  5I7X A;  2R0V A;  5CUA A;  3AAD A;  5ENJ A;  4YH4 A;  5A5N A;  4ALG A;  5CY9 A;  5F63 A;  2YEK A;  3UV4 A;  4HXK A;  3G0J A;  4CUR A;  4HXR A;  5EPS A;  5FE7 A;  4MEP A;  4NR5 A;  4NR7 A;  3P5O A;  4Q0O A;  5FFV A;  5ETD A;  4MR5 A;  5FE3 A;  3AQA A;  4QC1 A;  5DFD A;  4YK0 A;  4QNS A;  2MJV B;  4NR9 A;  4AKI A;  4Y03 A;  4AKN A;  2NXB A;  3DWY A;  3VKG A;  2LSP B;  5CQT A;  2E3K A;  4HBV A;  2RI7 A;  5EM3 A;  4YAD A;  4CUP A;  5F62 A;  2YDW A;  5D0C A;  3JVJ A;  4UIT A;  5ENH A;  4XYA A;  5DFC A;  4Q0N A;  5FH7 A;  4HBX A;  3MB3 A;  2DWW A;  3U5J A;  4TTE A;  4NYV A;  2R10 A;  5LUU A;  5E7D A;  1PUO A;  1X0J A;  5C85 A;  5DX4 A;  4J0S A;  2EJN A;  4QSS A;  4QSW A;  5KHM A;  4LZR A;  5DY7 A;  5LJ0 A;  1E6I A;  3MB4 A;  3FKM X;  4CL9 A;  4LR6 A;  5F36 A;  4N4F A;  4NR8 A;  5HRX A;  4TT6 A;  4CUU A;  4A9I A;  4Z6I A;  5F1H A;  4PCI A;  4GPJ A;  5H1T A;  5HJC A;  5L96 A;  5A81 A;  5BT5 A;  5K29 A;  5LKT A;  5ENG A;  5FB1 A;  4TU6 A;  4XY8 A;  4NRB A;  5I1Q A;  4F3I A;  4UYH A;  4Z1Q A;  3HME A;  5FDZ A;  4TT4 A;  2DVS A;  5DW1 A;  3P1F A;  4NUE A;  5TCM A;  5CUC A;  3S92 A;  3TLP A;  4UYD A;  5HEL A;  5EV9 A;  3Q2F A;  5LKX A;  5C7N A;  4UYF A;  2D9E A;  4NR4 A;  4YYH A;  4UIV A;  4ZW1 A;  2DVQ A;  2FSA A;  5ENE A;  5HM0 A;  4O71 A;  5DKD A;  5LVQ A;  5L99 A;  5A85 A;  2YW5 A;  4KV1 A;  2YYN A;  5HLS A;  4IR5 A;  4HXS A;  5EIC A;  5J0D A;  4AKH A;  5I89 A;  3HMF A;  4YAT A;  5D7X A;  5G4S A;  4O77 A;  4YC9 A;  2YEM A;  5DKC A;  5EQ1 A;  5IGL A;  3GG3 A;  4NRC A;  2L5E A;  4PS5 A;  5E73 A;  2YEL A;  5IGN A;  3O33 A;  5LKU A;  5I86 A;  5LKZ A;  4YH3 A;  4LZS A;  5CP5 A;  4NUD A;  3IU6 A;  5ETB A;  2E7N A;  4QR3 A;  4QY4 A;  5EWD A;  4AI6 A;  5CQ5 A;  4BW3 A;  4A9N A;  4MEQ A;  4N3W A;  5FG4 A;  3SVG A;  4NRA A;  4ZQL A;  4QSX A;  5EPB A;  5C8G A;  4BJX A;  4QSR A;  5CQ3 A;  3G0L A;  5IGK A;  4HXM A;  2KTB B;  4O7E A;  4BW2 A;  5E0R A;  5CUE A;  4NYW A;  3U5O A;  3K2J A;  2OUO A;  3HMH A;  5D25 A;  3QZS A;  4LYS A;  5HFR A;  5FH8 A;  5LJ2 A;  3U5L A;  4HXP A;  5HRW A;  4QSU A;  5F5Z A;  4Z1S A;  4UIZ A;  4WHW A;  5A83 A;  2RNX A;  4A9O A;  5I40 A;  2RS9 B;  2YQD A;  5CQ7 A;  5F2P A;  5II2 A;  4TT2 A;  3UV5 A;  4A9F A;  4O70 A;  3MUK A;  5A5S A;  5D3T A;  4IOR A;  4CFL A;  4O75 A;  3UW9 A;  5FE5 A;  4QUT A;  4CFK A;  4QEU A;  4HXN A;  5EWC A;  5E9K A;  5F60 A;  4CUQ A;  4YYJ A;  5CUB A;  5C87 A;  4MEN A;  5BT3 A;  5E3D A;  4YBT A;  4QB3 A;  5CUG A;  5E9V A;  4OUF A;  2DVR A;  4UIY A;  5H85 A;  5L8T A;  3U5N A;  4LDF A;  4A9J A;  4IR6 A;  4QYD A;  1EQF A;  2DAT A;  4ZC9 A;  5COI A;  4LZ2 A;  4TZ8 A;  5D24 A;  5FH6 A;  4O7A A;  1ZS5 A;  4CUT A;  4QUU A;  4KCX A;  5A5R A;  5KO4 A;  5I7Y A;  4UYG A;  2H60 A;  2WP2 A;  3LXJ A;  4ALH A;  5E74 A;  3O36 A;  5DLX A;  2L85 A;  5E9M A;  5CS8 A;  5DYU A;  4KV4 A;  1N72 A;  5DW2 A;  5JWM A;  4J3I A;  5FBX A;  4QEV A;  1WUM A;  2RNY A;  5ACY A;  2RNW A;  4QC3 A;  4QSQ A;  2E7O A;  5EGU A;  4YYN A;  1WUG A;  4MR4 A;  4CLB A;  5G4R A;  3Q2E A;  5DBM A;  5AD3 A;  5EI4 A;  5IBN A;  4A9K A;  5CFW A;  5HEN A;  3VKH A;  5CGP A;  3UVD A;  3O34 A;  5AMF A;  4TU4 A;  5FFY A;  5DYA A;  5CU8 A;  5EWW A;  5FE1 A;  5L97 A;  5HRV A;  5A7C A;  5FB0 A;  4HXL A;  4YAB A;  4A9M A;  3ONI A;  4O78 A;  3DAI A;  2RO1 A;  3MUL A;  2RFJ A;  4MR3 A;  5KTU A;  5EU1 A;  4O7C A;  5E9I A;  3U5M A;  5FE8 A;  4PY6 A;  4IR4 A;  2F6J A;  5ENI A;  3D1B A;  3SVF A;  4IOO A;  4A9H A;  5HCL A;  1F68 A;  5E9Y A;  2DVV A;  5CQ8 A;  5CTL A;  4UIU A;  5EWV A;  4YYM A;  4UIX A;  3U5K A;  3LQI A;  4YBM A;  4RVR A;  5CRZ A;  5E3G A;  5CQ4 A;  5HQ7 A;  4AKG A;  5F25 A;  5I29 A;  4MR6 A;  4N4I A;  5CQ6 A;  4C67 A;  5D26 A;  3LJW A;  5DLZ A;  5HQ6 A; 
#chains in the Genus database with same CATH homology
 4TQN A;  5EA1 A;  4HBW A;  5FFW A;  5H1U A;  3NXB A;  4PCE A;  4NR6 A;  4LYW A;  4BHW A;  5EVA A;  2I7K A;  4LRG A;  3QZT A;  5CRM A;  4QEW A;  4QST A;  5CPE A;  5I83 A;  5HQ5 A;  5L8U A;  5LVR A;  4QSP A;  3O35 A;  3QZV A;  4WIV A;  3I3J A;  3LQH A;  4PTB A;  4TYL A;  5ENB A;  2GRC A;  4C66 A;  5FE9 A;  4X2I A;  4O7F A;  2R0S A;  2G4A A;  4YYK A;  5KU3 A;  4A9E A;  5IGM A;  5FE2 A;  3SVH A;  3S91 A;  4J1P A;  5DKH A;  5AME A;  5D3S A;  5DYC A;  4E96 A;  5A5P A;  5D3P A;  5BT4 A;  2F6N A;  4XY9 A;  4TS8 A;  4NQM A;  5TB6 A;  5A5Q A;  2R0Y A;  5F1L A;  4OGJ A;  1JSP B;  3P1E A;  4J0R A;  4TZ2 A;  5KTW A;  5D3L A;  4PKL A;  4DON A;  3O37 A;  4YY4 A;  4HBY A;  4IOQ A;  5II1 A;  5C4Q A;  5FG5 A;  4YAX A;  3RCW A;  5CZG A;  4O74 A;  5EK9 A;  5E9L A;  5C89 A;  4Z6H A;  4YYG A;  4WHU A;  5DYX A;  5CQA A;  3UVY A;  4NXJ A;  4YYI A;  5I88 A;  3UVW A;  5FE0 A;  5LJ1 A;  3P1C A;  3IU5 A;  4CUS A;  5IG6 A;  2OSS A;  5EIS A;  5ENC A;  4QSV A;  3JVL A;  5F3A A;  4LC2 A;  5HFQ A;  5H1V A;  4YY6 A;  3ZYU A;  3MXF A;  4HXO A;  2DKW A;  4A9L A;  5D3N A;  4XUB A;  4OGI A;  5F61 A;  4O72 A;  2OO1 A;  5D3H A;  1JM4 B;  4UYF B;  4Z93 A;  4O7B A;  5EPR A;  5HEM A;  5JI8 A;  5A82 A;  5EWH A;  4QR5 A;  4QYL A;  4N4G A;  4UYE A;  2N9G A;  5FE4 A;  3JVK A;  2I8N A;  4BW4 A;  4QR4 A;  5DFB A;  5FG6 A;  2D82 A;  3UV2 A;  4YYD A;  4MEO A;  4XUA A;  4FLP A;  2L84 A;  3JVM A;  5KTX A;  3P1D A;  3UVX A;  4LYI A;  3D7C A;  4QZS A;  5EP7 A;  4NUC A;  4NQN A;  4YBS A;  4QBM A;  5D3R A;  5I80 A;  4NYX A;  2WP1 A;  5FE6 A;  4UIW A;  5AD2 A;  4O76 A;  4IR3 A;  5D3J A;  5L98 A;  5CUD A;  5ENF A;  4N4H A;  5A5O A;  3U5P A;  3LQJ A;  4BW1 A;  4NS5 A;  3MQM A;  5IID A;  5I7X A;  2R0V A;  5CUA A;  3AAD A;  5ENJ A;  4YH4 A;  5A5N A;  4ALG A;  5CY9 A;  5F63 A;  2YEK A;  3UV4 A;  4HXK A;  3G0J A;  4CUR A;  4HXR A;  5EPS A;  5FE7 A;  4MEP A;  4NR5 A;  4NR7 A;  3P5O A;  4Q0O A;  5FFV A;  5ETD A;  4MR5 A;  5FE3 A;  3AQA A;  4QC1 A;  5DFD A;  4YK0 A;  4QNS A;  2MJV B;  4NR9 A;  4Y03 A;  4AKN A;  2NXB A;  3DWY A;  2LSP B;  5CQT A;  2E3K A;  4HBV A;  2RI7 A;  5EM3 A;  4YAD A;  4CUP A;  5F62 A;  2YDW A;  5D0C A;  3JVJ A;  4UIT A;  5ENH A;  4XYA A;  5DFC A;  4Q0N A;  5FH7 A;  4HBX A;  3MB3 A;  2DWW A;  3U5J A;  4TTE A;  4NYV A;  2R10 A;  5LUU A;  5E7D A;  1X0J A;  5C85 A;  5DX4 A;  4J0S A;  4QSS A;  4QSW A;  5KHM A;  4LZR A;  5DY7 A;  5LJ0 A;  1E6I A;  3MB4 A;  3FKM X;  4CL9 A;  4LR6 A;  5F36 A;  4N4F A;  4NR8 A;  5HRX A;  4TT6 A;  4CUU A;  4A9I A;  4Z6I A;  5F1H A;  4PCI A;  4GPJ A;  5H1T A;  5HJC A;  5L96 A;  5A81 A;  5BT5 A;  5K29 A;  5LKT A;  5ENG A;  5FB1 A;  4TU6 A;  4XY8 A;  4NRB A;  5I1Q A;  4F3I A;  4UYH A;  4Z1Q A;  3HME A;  5FDZ A;  4TT4 A;  2DVS A;  5DW1 A;  3P1F A;  4NUE A;  5TCM A;  5CUC A;  3S92 A;  3TLP A;  4UYD A;  5HEL A;  5EV9 A;  3Q2F A;  5LKX A;  5C7N A;  4UYF A;  2D9E A;  4NR4 A;  4YYH A;  4UIV A;  4ZW1 A;  2DVQ A;  2FSA A;  5ENE A;  5HM0 A;  4O71 A;  5DKD A;  5LVQ A;  5L99 A;  5A85 A;  2YW5 A;  4KV1 A;  2YYN A;  5HLS A;  4IR5 A;  4HXS A;  5EIC A;  5J0D A;  5I89 A;  3HMF A;  4YAT A;  5D7X A;  5G4S A;  4O77 A;  4YC9 A;  2YEM A;  5DKC A;  5EQ1 A;  5IGL A;  3GG3 A;  4NRC A;  2L5E A;  4PS5 A;  5E73 A;  2YEL A;  5IGN A;  3O33 A;  5LKU A;  5I86 A;  5LKZ A;  4YH3 A;  4LZS A;  5CP5 A;  4NUD A;  3IU6 A;  5ETB A;  2E7N A;  4QR3 A;  4QY4 A;  5EWD A;  5CQ5 A;  4BW3 A;  4A9N A;  4MEQ A;  4N3W A;  5FG4 A;  3SVG A;  4NRA A;  4ZQL A;  4QSX A;  5EPB A;  5C8G A;  4BJX A;  4QSR A;  5CQ3 A;  3G0L A;  5IGK A;  4HXM A;  2KTB B;  4O7E A;  4BW2 A;  5E0R A;  5CUE A;  4NYW A;  3U5O A;  3K2J A;  2OUO A;  3HMH A;  5D25 A;  3QZS A;  4LYS A;  5HFR A;  5FH8 A;  5LJ2 A;  3U5L A;  4HXP A;  5HRW A;  4QSU A;  5F5Z A;  4Z1S A;  4UIZ A;  4WHW A;  5A83 A;  2RNX A;  4A9O A;  5I40 A;  2RS9 B;  2YQD A;  5CQ7 A;  5F2P A;  5II2 A;  4TT2 A;  3UV5 A;  4A9F A;  4O70 A;  3MUK A;  5A5S A;  5D3T A;  4IOR A;  4CFL A;  4O75 A;  3UW9 A;  5FE5 A;  4QUT A;  4CFK A;  4QEU A;  4HXN A;  5EWC A;  5E9K A;  5F60 A;  4CUQ A;  4YYJ A;  5CUB A;  5C87 A;  4MEN A;  5BT3 A;  5E3D A;  4YBT A;  4QB3 A;  5CUG A;  5E9V A;  4OUF A;  2DVR A;  4UIY A;  5H85 A;  5L8T A;  3U5N A;  4LDF A;  4A9J A;  4IR6 A;  4QYD A;  1EQF A;  2DAT A;  4ZC9 A;  5COI A;  4LZ2 A;  4TZ8 A;  5D24 A;  5FH6 A;  4O7A A;  1ZS5 A;  4CUT A;  4QUU A;  4KCX A;  5A5R A;  5KO4 A;  5I7Y A;  4UYG A;  2H60 A;  2WP2 A;  3LXJ A;  4ALH A;  5E74 A;  3O36 A;  5DLX A;  2L85 A;  5E9M A;  5CS8 A;  5DYU A;  4KV4 A;  1N72 A;  5DW2 A;  5JWM A;  4J3I A;  5FBX A;  4QEV A;  1WUM A;  2RNY A;  5ACY A;  2RNW A;  4QC3 A;  4QSQ A;  2E7O A;  5EGU A;  4YYN A;  1WUG A;  4MR4 A;  4CLB A;  5G4R A;  3Q2E A;  5DBM A;  5AD3 A;  5EI4 A;  5IBN A;  4A9K A;  5CFW A;  5HEN A;  5CGP A;  3UVD A;  3O34 A;  5AMF A;  4TU4 A;  5FFY A;  5DYA A;  5CU8 A;  5EWW A;  5FE1 A;  5L97 A;  5HRV A;  5A7C A;  5FB0 A;  4HXL A;  4YAB A;  4A9M A;  3ONI A;  4O78 A;  3DAI A;  2RO1 A;  3MUL A;  2RFJ A;  4MR3 A;  5KTU A;  5EU1 A;  4O7C A;  5E9I A;  3U5M A;  5FE8 A;  4PY6 A;  4IR4 A;  2F6J A;  5ENI A;  3SVF A;  4IOO A;  4A9H A;  5HCL A;  1F68 A;  5E9Y A;  2DVV A;  5CQ8 A;  5CTL A;  4UIU A;  5EWV A;  4YYM A;  4UIX A;  3U5K A;  3LQI A;  4YBM A;  4RVR A;  5CRZ A;  5E3G A;  5CQ4 A;  5HQ7 A;  5F25 A;  5I29 A;  4MR6 A;  4N4I A;  5CQ6 A;  4C67 A;  5D26 A;  3LJW A;  5DLZ A;  5HQ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...