5EWWA

Crystal structure of the human brpf1 bromodomain in complex with seed21
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
113
structure length
113
Chain Sequence
EMQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords Peregrin
publication title Crystal structure of the human BRPF1 bromodomain in complex with SEED21
rcsb
source organism Homo sapiens
total genus 41
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2015-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5ewwA00
4HXRA 4Q0NA 5E73A 3ZYUA 4CUPA 3G0LA 3UVXA 5KTUA 5F36A 5L8TA 5I83A 5K29A 5DW1A 5E9LA 4J1PA 5FG5A 5CTLA 5CQ5A 5FFWA 1EQFA 4TQNA 4YYJA 4UIVA 5E3DA 2E7OA 4A9OA 4NR4A 4BJXA 5D25A 4Q0OA 4N4HA 3GG3A 4BHWA 4LYSA 3U5NA 2YDWA 4YBSA 5HLSA 5ETDA 5ENHA 5FG4A 5IBNA 5EP7A 4IR3A 4XY9A 2E3KA 2G4AA 5D3LA 2L5EA 3U5KA 4A9EA 5HQ5A 4TTEA 2WP2A 4UIXA 4A9HA 4PTBA 5CPEA 4YY4A 4YATA 5II2A 4RVRA 2YQDA 4IR4A 1JSPB 5I88A 4QZSA 4YABA 4HBVA 5D3HA 3DAIA 3HMHA 3MQMA 4UYDA 5EI4A 4YYKA 4YK0A 5H1TA 4QY4A 5C7NA 3NXBA 2OSSA 4NR7A 5D3PA 3UVYA 4O78A 5KTWA 5EK9A 3IU5A 5L98A 4TU4A 5HENA 4N4GA 5EU1A 4NS5A 4MR3A 4AKNA 4QEVA 5H1UA 5IG6A 4HXKA 5D24A 5EWHA 3MXFA 5A5PA 5CFWA 5I40A 4QSUA 5EWCA 4CUUA 5F1HA 5D3RA 5EICA 4QNSA 5BT3A 5F2PA 3S91A 2E7NA 3U5PA 4QSTA 4FLPA 4LC2A 4YBMA 4OUFA 5FE1A 5FB1A 3UV4A 3MULA 4E96A 4O72A 4LYIA 2RNXA 4QSSA 5EISA 4A9MA 5L99A 2MJVB 2WP1A 4O70A 4YYMA 2D82A 4NR5A 5EM3A 2I7KA 4TYLA 5BT4A 5DW2A 3QZSA 5EWWA 5HEMA 4YYDA 4NYWA 3QZTA 4XUAA 5II1A 4HBWA 5I89A 4HXSA 5H1VA 5C87A 2L84A 5A82A 2F6NA 4KCXA 2RO1A 5ENIA 4LZRA 3P1DA 4XYAA 4YAXA 5CQ7A 4O77A 5I86A 4NQNA 4QR5A 5IGLA 4TZ8A 4QR4A 5A5RA 4TT2A 3JVKA 3U5LA 2DWWA 2RS9B 4QSQA 5F1LA 5FG6A 1ZS5A 3ONIA 5BT5A 4LZSA 4TZ2A 3JVMA 3I3JA 5A5SA 2YYNA 5HQ6A 4HXMA 5DYUA 4O76A 4UYFB 4QYLA 5HELA 5E9YA 4LR6A 3RCWA 1X0JA 4QC3A 4A9NA 2R0YA 4HXNA 5CY9A 5DYXA 5L8UA 5CGPA 4UYFA 5CS8A 5ENJA 5HQ7A 5E9VA 5E7DA 5G4RA 4XUBA 2RNWA 4CFKA 4TU6A 4YH3A 4IORA 5CUBA 5ENGA 3UVDA 3G0JA 4IR6A 5DX4A 3LQIA 5EPRA 4N3WA 5D0CA 5D7XA 5DY7A 3U5MA 3Q2FA 4YC9A 4J0RA 4A9FA 4NR9A 5TCMA 5KTXA 4NRBA 3U5OA 3P1EA 5I1QA 4NR6A 5A5NA 5A83A 2LSPB 5C89A 5CUGA 4QSVA 5DKHA 4HXPA 4HXLA 2I8NA 5D26A 3LJWA 2F6JA 4X2IA 5E9IA 5LKUA 5LKZA 2OUOA 4MEOA 2H60A 4HBXA 5E9MA 3IU6A 5ENFA 2RNYA 1N72A 3P5OA 5DFCA 5I7YA 4YADA 5EQ1A 3P1CA 2D9EA 5AD3A 4QBMA 4YYIA 4MR6A 5D3JA 4CUTA 5F25A 4CUQA 4QSWA 4MR4A 5HCLA 3O36A 4YBTA 4TS8A 3MUKA 4UYGA 4Z1QA 5D3SA 4NUDA 3HMEA 5DYCA 2R0SA 4WHUA 4QUUA 5LKXA 4J3IA 5DKDA 5COIA 5CQ3A 5J0DA 4PCIA 5CU8A 4NR8A 5EV9A 4NUEA 5E0RA 5E9KA 5C4QA 4A9LA 5IGKA 5FE9A 4UYHA 3Q2EA 4IR5A 4UITA 5EPBA 2DVSA 5DFBA 5I7XA 3O37A 4PCEA 4PY6A 5FFVA 5HRXA 4NXJA 4QSRA 4TT6A 5TB6A 4QR3A 4YYNA 1WUMA 5A5OA 5HM0A 5F3AA 5EGUA 4BW1A 4O7EA 4O71A 4NUCA 5EWVA 5DFDA 2GRCA 5CRZA 5CQAA 5ENEA 5FBXA 2KTBB 5JI8A 2OO1A 4N4FA 4UYEA 5JWMA 3UW9A 4GPJA 4QUTA 5CUDA 5FFYA 5FE4A 5FB0A 4C66A 5IIDA 5EVAA 4MR5A 1E6IA 4O74A 4LYWA 2L85A 5EWDA 3HMFA 3D7CA 5CZGA 5CRMA 5HRWA 4UIWA 4CFLA 4N4IA 5F63A 5AMEA 4NQMA 4ZC9A 5FH6A 5FE7A 4Z6HA 4MEQA 3DWYA 5HFRA 2R0VA 4NYXA 5FE6A 2RI7A 5KU3A 4ALGA 3JVLA 4Z6IA 5FDZA 3TLPA 5I29A 4MEPA 4PKLA 5LVRA 4TT4A 1WUGA 4KV1A 2DVVA 4NYVA 5DLXA 4O7AA 1F68A 4HBYA 4QB3A 3K2JA 5LJ1A 4WHWA 5ETBA 5DLZA 4CL9A 3LQJA 5CUAA 4XY8A 2YELA 4C67A 5DKCA 3MB3A 2FSAA 5G4SA 3O33A 4IOOA 5A7CA 4ALHA 5A5QA 4NRAA 3AQAA 3SVGA 5IGNA 4QEWA 4Z93A 1JM4B 3QZVA 5KHMA 4YH4A 4BW4A 2DVRA 4WIVA 5CUCA 2N9GA 3S92A 5LUUA 4YYGA 4Y03A 5CP5A 4LDFA 5H85A 3SVHA 5E3GA 4Z1SA 5A85A 5ACYA 5FE8A 4OGJA 5HRVA 5DYAA 3U5JA 4OGIA 5A81A 5E74A 5L97A 5FH7A 4UIYA 5LVQA 4LRGA 2YEKA 5ENBA 5I80A 4CURA 2DATA 4QSPA 5D3NA 4HXOA 3UV5A 5CQTA 5FE0A 3O35A 5D3TA 4CUSA 5F61A 4O7BA 5FE5A 5LJ2A 5LKTA 2YW5A 5F60A 5AMFA 5F62A 3SVFA 4CLBA 4F3IA 3MB4A 3JVJA 5FE3A 5EPSA 4QYDA 3P1FA 4O75A 4BW2A 4MENA 5FE2A 3FKMX 5CQ8A 4UIZA 5CUEA 2DKWA 5HJCA 4ZQLA 2R10A 3O34A 4ZW1A 4DONA 4IOQA 4UIUA 4BW3A 4YYHA 5EA1A 5CQ6A 5DBMA 4YY6A 4QEUA 5ENCA 2RFJA 4QSXA 5CQ4A 5L96A 4LZ2A 4O7FA 4A9KA 4A9IA 4PS5A 3UV2A 5HFQA 2YEMA 5C8GA 4J0SA 4NRCA 3LQHA 5C85A 2NXBA 5KO4A 2DVQA 4O7CA 4A9JA 4QC1A 4KV4A 3AADA 5LJ0A 5AD2A 5IGMA 3LXJA 5FH8A 3UVWA 5F5ZA
chains in the Genus database with same CATH superfamily
4HXRA 4Q0NA 5E73A 3ZYUA 4CUPA 3G0LA 3UVXA 5KTUA 5F36A 5L8TA 5I83A 5K29A 5DW1A 5E9LA 4J1PA 5FG5A 5CTLA 5CQ5A 5FFWA 1EQFA 4TQNA 4YYJA 4UIVA 5E3DA 2E7OA 4A9OA 4NR4A 4BJXA 5D25A 4Q0OA 4N4HA 3GG3A 4BHWA 4LYSA 3U5NA 2YDWA 4YBSA 5HLSA 5ETDA 5ENHA 5FG4A 5IBNA 5EP7A 3VKHA 4IR3A 4XY9A 2E3KA 2G4AA 5D3LA 2L5EA 3U5KA 4A9EA 5HQ5A 4TTEA 2WP2A 4UIXA 4A9HA 4PTBA 5CPEA 4YY4A 4YATA 5II2A 4RVRA 2YQDA 4IR4A 1JSPB 5I88A 4QZSA 4YABA 4HBVA 5D3HA 3DAIA 3HMHA 3MQMA 4UYDA 5EI4A 4YYKA 4YK0A 5H1TA 4QY4A 5C7NA 3NXBA 2OSSA 4AKHA 4NR7A 5D3PA 3UVYA 4O78A 5KTWA 5EK9A 3IU5A 5L98A 4TU4A 5HENA 4N4GA 5EU1A 4NS5A 4MR3A 4AKNA 4QEVA 5H1UA 5IG6A 4HXKA 5D24A 5EWHA 3MXFA 5A5PA 5CFWA 5I40A 4QSUA 5EWCA 4CUUA 5F1HA 5D3RA 5EICA 4QNSA 1PUOA 5BT3A 5F2PA 3S91A 2E7NA 3U5PA 4QSTA 4FLPA 4LC2A 4YBMA 4OUFA 5FE1A 5FB1A 3UV4A 3MULA 4E96A 4O72A 4LYIA 2RNXA 4QSSA 1ZKRA 5EISA 4A9MA 5L99A 2MJVB 2WP1A 4O70A 4YYMA 2D82A 4NR5A 5EM3A 2I7KA 4TYLA 5BT4A 5DW2A 3QZSA 5EWWA 5HEMA 4YYDA 4NYWA 3QZTA 4XUAA 5II1A 4HBWA 5I89A 4HXSA 5H1VA 5C87A 2L84A 5A82A 2F6NA 4KCXA 2RO1A 5ENIA 4LZRA 3P1DA 4XYAA 4YAXA 5CQ7A 4O77A 5I86A 4NQNA 4QR5A 5IGLA 4TZ8A 4QR4A 5A5RA 4TT2A 3JVKA 3U5LA 2DWWA 2RS9B 4QSQA 5F1LA 5FG6A 1ZS5A 3ONIA 5BT5A 4LZSA 4TZ2A 3JVMA 3I3JA 5A5SA 2YYNA 5HQ6A 3D1DA 4HXMA 5DYUA 4O76A 4UYFB 4QYLA 5HELA 5E9YA 4LR6A 3RCWA 1X0JA 4QC3A 4A9NA 2R0YA 4HXNA 5CY9A 5DYXA 5L8UA 5CGPA 4UYFA 5CS8A 5ENJA 5HQ7A 5E9VA 5E7DA 5G4RA 4XUBA 2RNWA 4CFKA 4TU6A 4YH3A 4IORA 5CUBA 5ENGA 3UVDA 3G0JA 4IR6A 5DX4A 3LQIA 5EPRA 4N3WA 5D0CA 5D7XA 5DY7A 3U5MA 3Q2FA 4YC9A 4J0RA 4A9FA 4NR9A 5TCMA 5KTXA 4NRBA 3U5OA 3P1EA 5I1QA 4NR6A 5A5NA 5A83A 2LSPB 5C89A 5CUGA 4QSVA 5DKHA 4HXPA 4HXLA 4AI6A 2I8NA 5D26A 3LJWA 2F6JA 4X2IA 5E9IA 5LKUA 5LKZA 2OUOA 4MEOA 2H60A 4HBXA 5E9MA 3IU6A 5ENFA 2RNYA 1N72A 3P5OA 5DFCA 5I7YA 4YADA 5EQ1A 3P1CA 2D9EA 5AD3A 4QBMA 4YYIA 4MR6A 5D3JA 4CUTA 5F25A 4CUQA 4QSWA 4MR4A 5HCLA 3O36A 4YBTA 4TS8A 3MUKA 4UYGA 4Z1QA 5D3SA 4NUDA 3HMEA 5DYCA 2R0SA 4WHUA 4QUUA 5LKXA 4J3IA 5DKDA 5COIA 5CQ3A 5J0DA 4PCIA 5CU8A 4NR8A 5EV9A 4NUEA 5E0RA 5E9KA 5C4QA 4A9LA 5IGKA 5FE9A 4UYHA 3Q2EA 4IR5A 4UITA 5EPBA 2DVSA 5DFBA 5I7XA 3O37A 4PCEA 4PY6A 5FFVA 5HRXA 4NXJA 4QSRA 4TT6A 5TB6A 4QR3A 4YYNA 1WUMA 5A5OA 5HM0A 5F3AA 5EGUA 4BW1A 4O7EA 4O71A 4NUCA 5EWVA 5DFDA 2GRCA 5CRZA 5CQAA 5ENEA 5FBXA 2KTBB 5JI8A 2OO1A 4N4FA 4UYEA 5JWMA 3UW9A 4GPJA 4QUTA 5CUDA 5FFYA 5FE4A 5FB0A 4C66A 5IIDA 5EVAA 4MR5A 1E6IA 4O74A 4LYWA 2L85A 5EWDA 3HMFA 4AKGA 3D7CA 5CZGA 5CRMA 5HRWA 4UIWA 4CFLA 4N4IA 5F63A 5AMEA 4AKIA 4NQMA 4ZC9A 5FH6A 5FE7A 4Z6HA 4MEQA 3DWYA 5HFRA 2R0VA 4NYXA 5FE6A 2RI7A 5KU3A 4ALGA 3JVLA 4Z6IA 5FDZA 3TLPA 5I29A 2EJNA 4MEPA 4PKLA 5LVRA 4TT4A 1WUGA 4KV1A 2DVVA 4NYVA 5DLXA 4O7AA 1F68A 4HBYA 4QB3A 3K2JA 5LJ1A 4WHWA 5ETBA 5DLZA 4CL9A 3LQJA 5CUAA 4XY8A 2YELA 4C67A 5DKCA 3MB3A 2FSAA 5G4SA 3O33A 4IOOA 5A7CA 4ALHA 5A5QA 4NRAA 3AQAA 3SVGA 5IGNA 4QEWA 4Z93A 1JM4B 3QZVA 5KHMA 4YH4A 4BW4A 2DVRA 4WIVA 5CUCA 2N9GA 3S92A 5LUUA 4YYGA 4Y03A 5CP5A 4LDFA 5H85A 3SVHA 5E3GA 4Z1SA 5A85A 5ACYA 5FE8A 4OGJA 5HRVA 5DYAA 3U5JA 4OGIA 5A81A 5E74A 5L97A 5FH7A 4UIYA 3D1BA 5LVQA 4LRGA 2YEKA 5ENBA 5I80A 4CURA 2DATA 4QSPA 5D3NA 4HXOA 3UV5A 5CQTA 5FE0A 3O35A 5D3TA 4CUSA 5F61A 4O7BA 5FE5A 5LJ2A 5LKTA 2YW5A 5F60A 5AMFA 5F62A 3SVFA 4CLBA 4F3IA 3MB4A 3JVJA 5FE3A 5EPSA 4QYDA 3P1FA 4O75A 4BW2A 3VKGA 3ERRA 4MENA 5FE2A 3FKMX 5CQ8A 4UIZA 5CUEA 2DKWA 5HJCA 4ZQLA 2R10A 3O34A 4ZW1A 4DONA 4IOQA 4UIUA 4BW3A 4YYHA 5EA1A 5CQ6A 5DBMA 4YY6A 4QEUA 5ENCA 2RFJA 4QSXA 5CQ4A 5L96A 4LZ2A 4O7FA 4A9KA 4A9IA 4PS5A 3UV2A 5HFQA 2YEMA 5C8GA 4J0SA 4NRCA 3LQHA 5C85A 2NXBA 5KO4A 2DVQA 4O7CA 4A9JA 4QC1A 4KV4A 3AADA 5LJ0A 5AD2A 5IGMA 3LXJA 5FH8A 3UVWA 5F5ZA
chains in the Genus database with same CATH topology
4HXRA 4Q0NA 5E73A 3ZYUA 4CUPA 3G0LA 3UVXA 5KTUA 5F36A 5L8TA 5I83A 5K29A 5DW1A 5E9LA 4J1PA 5FG5A 5CTLA 5CQ5A 5FFWA 1EQFA 4TQNA 4YYJA 4UIVA 5E3DA 2E7OA 4A9OA 4NR4A 4BJXA 5D25A 4Q0OA 4N4HA 3GG3A 4BHWA 4LYSA 3U5NA 2YDWA 4YBSA 5HLSA 5ETDA 5ENHA 5FG4A 5IBNA 5EP7A 4IR3A 4XY9A 2E3KA 2G4AA 5D3LA 2L5EA 3U5KA 4A9EA 5HQ5A 4TTEA 2WP2A 4UIXA 4A9HA 4PTBA 5CPEA 4YY4A 4YATA 5II2A 4RVRA 2YQDA 4IR4A 1JSPB 5I88A 4QZSA 4YABA 4HBVA 5D3HA 3DAIA 3HMHA 3MQMA 4UYDA 5EI4A 4YYKA 4YK0A 5H1TA 4QY4A 5C7NA 3NXBA 2OSSA 4NR7A 5D3PA 3UVYA 4O78A 5KTWA 5EK9A 3IU5A 5L98A 4TU4A 5HENA 4N4GA 5EU1A 4NS5A 4MR3A 4AKNA 4QEVA 5H1UA 5IG6A 4HXKA 5D24A 5EWHA 3MXFA 5A5PA 5CFWA 5I40A 4QSUA 5EWCA 4CUUA 5F1HA 5D3RA 5EICA 4QNSA 5BT3A 5F2PA 3S91A 2E7NA 3U5PA 4QSTA 4FLPA 4LC2A 4YBMA 4OUFA 5FE1A 5FB1A 3UV4A 3MULA 4E96A 4O72A 4LYIA 2RNXA 4QSSA 5EISA 4A9MA 5L99A 2MJVB 2WP1A 4O70A 4YYMA 2D82A 4NR5A 5EM3A 2I7KA 4TYLA 5BT4A 5DW2A 3QZSA 5EWWA 5HEMA 4YYDA 4NYWA 3QZTA 4XUAA 5II1A 4HBWA 5I89A 4HXSA 5H1VA 5C87A 2L84A 5A82A 2F6NA 4KCXA 2RO1A 5ENIA 4LZRA 3P1DA 4XYAA 4YAXA 5CQ7A 4O77A 5I86A 4NQNA 4QR5A 5IGLA 4TZ8A 4QR4A 5A5RA 4TT2A 3JVKA 3U5LA 2DWWA 2RS9B 4QSQA 5F1LA 5FG6A 1ZS5A 3ONIA 5BT5A 4LZSA 4TZ2A 3JVMA 3I3JA 5A5SA 2YYNA 5HQ6A 4HXMA 5DYUA 4O76A 4UYFB 4QYLA 5HELA 5E9YA 4LR6A 3RCWA 1X0JA 4QC3A 4A9NA 2R0YA 4HXNA 5CY9A 5DYXA 5L8UA 5CGPA 4UYFA 5CS8A 5ENJA 5HQ7A 5E9VA 5E7DA 5G4RA 4XUBA 2RNWA 4CFKA 4TU6A 4YH3A 4IORA 5CUBA 5ENGA 3UVDA 3G0JA 4IR6A 5DX4A 3LQIA 5EPRA 4N3WA 5D0CA 5D7XA 5DY7A 3U5MA 3Q2FA 4YC9A 4J0RA 4A9FA 4NR9A 5TCMA 5KTXA 4NRBA 3U5OA 3P1EA 5I1QA 4NR6A 5A5NA 5A83A 2LSPB 5C89A 5CUGA 4QSVA 5DKHA 4HXPA 4HXLA 2I8NA 5D26A 3LJWA 2F6JA 4X2IA 5E9IA 5LKUA 5LKZA 2OUOA 4MEOA 2H60A 4HBXA 5E9MA 3IU6A 5ENFA 2RNYA 1N72A 3P5OA 5DFCA 5I7YA 4YADA 5EQ1A 3P1CA 2D9EA 5AD3A 4QBMA 4YYIA 4MR6A 5D3JA 4CUTA 5F25A 4CUQA 4QSWA 4MR4A 5HCLA 3O36A 4YBTA 4TS8A 3MUKA 4UYGA 4Z1QA 5D3SA 4NUDA 3HMEA 5DYCA 2R0SA 4WHUA 4QUUA 5LKXA 4J3IA 5DKDA 5COIA 5CQ3A 5J0DA 4PCIA 5CU8A 4NR8A 5EV9A 4NUEA 5E0RA 5E9KA 5C4QA 4A9LA 5IGKA 5FE9A 4UYHA 3Q2EA 4IR5A 4UITA 5EPBA 2DVSA 5DFBA 5I7XA 3O37A 4PCEA 4PY6A 5FFVA 5HRXA 4NXJA 4QSRA 4TT6A 5TB6A 4QR3A 4YYNA 1WUMA 5A5OA 5HM0A 5F3AA 5EGUA 4BW1A 4O7EA 4O71A 4NUCA 5EWVA 5DFDA 2GRCA 5CRZA 5CQAA 5ENEA 5FBXA 2KTBB 5JI8A 2OO1A 4N4FA 4UYEA 5JWMA 3UW9A 4GPJA 4QUTA 5CUDA 5FFYA 5FE4A 5FB0A 4C66A 5IIDA 5EVAA 4MR5A 1E6IA 4O74A 4LYWA 2L85A 5EWDA 3HMFA 3D7CA 5CZGA 5CRMA 5HRWA 4UIWA 4CFLA 4N4IA 5F63A 5AMEA 4NQMA 4ZC9A 5FH6A 5FE7A 4Z6HA 4MEQA 3DWYA 5HFRA 2R0VA 4NYXA 5FE6A 2RI7A 5KU3A 4ALGA 3JVLA 4Z6IA 5FDZA 3TLPA 5I29A 4MEPA 4PKLA 5LVRA 4TT4A 1WUGA 4KV1A 2DVVA 4NYVA 5DLXA 4O7AA 1F68A 4HBYA 4QB3A 3K2JA 5LJ1A 4WHWA 5ETBA 5DLZA 4CL9A 3LQJA 5CUAA 4XY8A 2YELA 4C67A 5DKCA 3MB3A 2FSAA 5G4SA 3O33A 4IOOA 5A7CA 4ALHA 5A5QA 4NRAA 3AQAA 3SVGA 5IGNA 4QEWA 4Z93A 1JM4B 3QZVA 5KHMA 4YH4A 4BW4A 2DVRA 4WIVA 5CUCA 2N9GA 3S92A 5LUUA 4YYGA 4Y03A 5CP5A 4LDFA 5H85A 3SVHA 5E3GA 4Z1SA 5A85A 5ACYA 5FE8A 4OGJA 5HRVA 5DYAA 3U5JA 4OGIA 5A81A 5E74A 5L97A 5FH7A 4UIYA 5LVQA 4LRGA 2YEKA 5ENBA 5I80A 4CURA 2DATA 4QSPA 5D3NA 4HXOA 3UV5A 5CQTA 5FE0A 3O35A 5D3TA 4CUSA 5F61A 4O7BA 5FE5A 5LJ2A 5LKTA 2YW5A 5F60A 5AMFA 5F62A 3SVFA 4CLBA 4F3IA 3MB4A 3JVJA 5FE3A 5EPSA 4QYDA 3P1FA 4O75A 4BW2A 4MENA 5FE2A 3FKMX 5CQ8A 4UIZA 5CUEA 2DKWA 5HJCA 4ZQLA 2R10A 3O34A 4ZW1A 4DONA 4IOQA 4UIUA 4BW3A 4YYHA 5EA1A 5CQ6A 5DBMA 4YY6A 4QEUA 5ENCA 2RFJA 4QSXA 5CQ4A 5L96A 4LZ2A 4O7FA 4A9KA 4A9IA 4PS5A 3UV2A 5HFQA 2YEMA 5C8GA 4J0SA 4NRCA 3LQHA 5C85A 2NXBA 5KO4A 2DVQA 4O7CA 4A9JA 4QC1A 4KV4A 3AADA 5LJ0A 5AD2A 5IGMA 3LXJA 5FH8A 3UVWA 5F5ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HXR A;  4Q0N A;  5E73 A;  3ZYU A;  4CUP A;  3G0L A;  3UVX A;  5KTU A;  5F36 A;  5L8T A;  5I83 A;  5K29 A;  5DW1 A;  5E9L A;  4J1P A;  5FG5 A;  5CTL A;  5CQ5 A;  5FFW A;  1EQF A;  4TQN A;  4YYJ A;  4UIV A;  5E3D A;  2E7O A;  4A9O A;  4NR4 A;  4BJX A;  5D25 A;  4Q0O A;  4N4H A;  3GG3 A;  4BHW A;  4LYS A;  3U5N A;  2YDW A;  4YBS A;  5HLS A;  5ETD A;  5ENH A;  5FG4 A;  5IBN A;  5EP7 A;  4IR3 A;  4XY9 A;  2E3K A;  2G4A A;  5D3L A;  2L5E A;  3U5K A;  4A9E A;  5HQ5 A;  4TTE A;  2WP2 A;  4UIX A;  4A9H A;  4PTB A;  5CPE A;  4YY4 A;  4YAT A;  5II2 A;  4RVR A;  2YQD A;  4IR4 A;  1JSP B;  5I88 A;  4QZS A;  4YAB A;  4HBV A;  5D3H A;  3DAI A;  3HMH A;  3MQM A;  4UYD A;  5EI4 A;  4YYK A;  4YK0 A;  5H1T A;  4QY4 A;  5C7N A;  3NXB A;  2OSS A;  4NR7 A;  5D3P A;  3UVY A;  4O78 A;  5KTW A;  5EK9 A;  3IU5 A;  5L98 A;  4TU4 A;  5HEN A;  4N4G A;  5EU1 A;  4NS5 A;  4MR3 A;  4AKN A;  4QEV A;  5H1U A;  5IG6 A;  4HXK A;  5D24 A;  5EWH A;  3MXF A;  5A5P A;  5CFW A;  5I40 A;  4QSU A;  5EWC A;  4CUU A;  5F1H A;  5D3R A;  5EIC A;  4QNS A;  5BT3 A;  5F2P A;  3S91 A;  2E7N A;  3U5P A;  4QST A;  4FLP A;  4LC2 A;  4YBM A;  4OUF A;  5FE1 A;  5FB1 A;  3UV4 A;  3MUL A;  4E96 A;  4O72 A;  4LYI A;  2RNX A;  4QSS A;  5EIS A;  4A9M A;  5L99 A;  2MJV B;  2WP1 A;  4O70 A;  4YYM A;  2D82 A;  4NR5 A;  5EM3 A;  2I7K A;  4TYL A;  5BT4 A;  5DW2 A;  3QZS A;  5EWW A;  5HEM A;  4YYD A;  4NYW A;  3QZT A;  4XUA A;  5II1 A;  4HBW A;  5I89 A;  4HXS A;  5H1V A;  5C87 A;  2L84 A;  5A82 A;  2F6N A;  4KCX A;  2RO1 A;  5ENI A;  4LZR A;  3P1D A;  4XYA A;  4YAX A;  5CQ7 A;  4O77 A;  5I86 A;  4NQN A;  4QR5 A;  5IGL A;  4TZ8 A;  4QR4 A;  5A5R A;  4TT2 A;  3JVK A;  3U5L A;  2DWW A;  2RS9 B;  4QSQ A;  5F1L A;  5FG6 A;  1ZS5 A;  3ONI A;  5BT5 A;  4LZS A;  4TZ2 A;  3JVM A;  3I3J A;  5A5S A;  2YYN A;  5HQ6 A;  4HXM A;  5DYU A;  4O76 A;  4UYF B;  4QYL A;  5HEL A;  5E9Y A;  4LR6 A;  3RCW A;  1X0J A;  4QC3 A;  4A9N A;  2R0Y A;  4HXN A;  5CY9 A;  5DYX A;  5L8U A;  5CGP A;  4UYF A;  5CS8 A;  5ENJ A;  5HQ7 A;  5E9V A;  5E7D A;  5G4R A;  4XUB A;  2RNW A;  4CFK A;  4TU6 A;  4YH3 A;  4IOR A;  5CUB A;  5ENG A;  3UVD A;  3G0J A;  4IR6 A;  5DX4 A;  3LQI A;  5EPR A;  4N3W A;  5D0C A;  5D7X A;  5DY7 A;  3U5M A;  3Q2F A;  4YC9 A;  4J0R A;  4A9F A;  4NR9 A;  5TCM A;  5KTX A;  4NRB A;  3U5O A;  3P1E A;  5I1Q A;  4NR6 A;  5A5N A;  5A83 A;  2LSP B;  5C89 A;  5CUG A;  4QSV A;  5DKH A;  4HXP A;  4HXL A;  2I8N A;  5D26 A;  3LJW A;  2F6J A;  4X2I A;  5E9I A;  5LKU A;  5LKZ A;  2OUO A;  4MEO A;  2H60 A;  4HBX A;  5E9M A;  3IU6 A;  5ENF A;  2RNY A;  1N72 A;  3P5O A;  5DFC A;  5I7Y A;  4YAD A;  5EQ1 A;  3P1C A;  2D9E A;  5AD3 A;  4QBM A;  4YYI A;  4MR6 A;  5D3J A;  4CUT A;  5F25 A;  4CUQ A;  4QSW A;  4MR4 A;  5HCL A;  3O36 A;  4YBT A;  4TS8 A;  3MUK A;  4UYG A;  4Z1Q A;  5D3S A;  4NUD A;  3HME A;  5DYC A;  2R0S A;  4WHU A;  4QUU A;  5LKX A;  4J3I A;  5DKD A;  5COI A;  5CQ3 A;  5J0D A;  4PCI A;  5CU8 A;  4NR8 A;  5EV9 A;  4NUE A;  5E0R A;  5E9K A;  5C4Q A;  4A9L A;  5IGK A;  5FE9 A;  4UYH A;  3Q2E A;  4IR5 A;  4UIT A;  5EPB A;  2DVS A;  5DFB A;  5I7X A;  3O37 A;  4PCE A;  4PY6 A;  5FFV A;  5HRX A;  4NXJ A;  4QSR A;  4TT6 A;  5TB6 A;  4QR3 A;  4YYN A;  1WUM A;  5A5O A;  5HM0 A;  5F3A A;  5EGU A;  4BW1 A;  4O7E A;  4O71 A;  4NUC A;  5EWV A;  5DFD A;  2GRC A;  5CRZ A;  5CQA A;  5ENE A;  5FBX A;  2KTB B;  5JI8 A;  2OO1 A;  4N4F A;  4UYE A;  5JWM A;  3UW9 A;  4GPJ A;  4QUT A;  5CUD A;  5FFY A;  5FE4 A;  5FB0 A;  4C66 A;  5IID A;  5EVA A;  4MR5 A;  1E6I A;  4O74 A;  4LYW A;  2L85 A;  5EWD A;  3HMF A;  3D7C A;  5CZG A;  5CRM A;  5HRW A;  4UIW A;  4CFL A;  4N4I A;  5F63 A;  5AME A;  4NQM A;  4ZC9 A;  5FH6 A;  5FE7 A;  4Z6H A;  4MEQ A;  3DWY A;  5HFR A;  2R0V A;  4NYX A;  5FE6 A;  2RI7 A;  5KU3 A;  4ALG A;  3JVL A;  4Z6I A;  5FDZ A;  3TLP A;  5I29 A;  4MEP A;  4PKL A;  5LVR A;  4TT4 A;  1WUG A;  4KV1 A;  2DVV A;  4NYV A;  5DLX A;  4O7A A;  1F68 A;  4HBY A;  4QB3 A;  3K2J A;  5LJ1 A;  4WHW A;  5ETB A;  5DLZ A;  4CL9 A;  3LQJ A;  5CUA A;  4XY8 A;  2YEL A;  4C67 A;  5DKC A;  3MB3 A;  2FSA A;  5G4S A;  3O33 A;  4IOO A;  5A7C A;  4ALH A;  5A5Q A;  4NRA A;  3AQA A;  3SVG A;  5IGN A;  4QEW A;  4Z93 A;  1JM4 B;  3QZV A;  5KHM A;  4YH4 A;  4BW4 A;  2DVR A;  4WIV A;  5CUC A;  2N9G A;  3S92 A;  5LUU A;  4YYG A;  4Y03 A;  5CP5 A;  4LDF A;  5H85 A;  3SVH A;  5E3G A;  4Z1S A;  5A85 A;  5ACY A;  5FE8 A;  4OGJ A;  5HRV A;  5DYA A;  3U5J A;  4OGI A;  5A81 A;  5E74 A;  5L97 A;  5FH7 A;  4UIY A;  5LVQ A;  4LRG A;  2YEK A;  5ENB A;  5I80 A;  4CUR A;  2DAT A;  4QSP A;  5D3N A;  4HXO A;  3UV5 A;  5CQT A;  5FE0 A;  3O35 A;  5D3T A;  4CUS A;  5F61 A;  4O7B A;  5FE5 A;  5LJ2 A;  5LKT A;  2YW5 A;  5F60 A;  5AMF A;  5F62 A;  3SVF A;  4CLB A;  4F3I A;  3MB4 A;  3JVJ A;  5FE3 A;  5EPS A;  4QYD A;  3P1F A;  4O75 A;  4BW2 A;  4MEN A;  5FE2 A;  3FKM X;  5CQ8 A;  4UIZ A;  5CUE A;  2DKW A;  5HJC A;  4ZQL A;  2R10 A;  3O34 A;  4ZW1 A;  4DON A;  4IOQ A;  4UIU A;  4BW3 A;  4YYH A;  5EA1 A;  5CQ6 A;  5DBM A;  4YY6 A;  4QEU A;  5ENC A;  2RFJ A;  4QSX A;  5CQ4 A;  5L96 A;  4LZ2 A;  4O7F A;  4A9K A;  4A9I A;  4PS5 A;  3UV2 A;  5HFQ A;  2YEM A;  5C8G A;  4J0S A;  4NRC A;  3LQH A;  5C85 A;  2NXB A;  5KO4 A;  2DVQ A;  4O7C A;  4A9J A;  4QC1 A;  4KV4 A;  3AAD A;  5LJ0 A;  5AD2 A;  5IGM A;  3LXJ A;  5FH8 A;  3UVW A;  5F5Z A; 
#chains in the Genus database with same CATH topology
 4HXR A;  4Q0N A;  5E73 A;  3ZYU A;  4CUP A;  3G0L A;  3UVX A;  5KTU A;  5F36 A;  5L8T A;  5I83 A;  5K29 A;  5DW1 A;  5E9L A;  4J1P A;  5FG5 A;  5CTL A;  5CQ5 A;  5FFW A;  1EQF A;  4TQN A;  4YYJ A;  4UIV A;  5E3D A;  2E7O A;  4A9O A;  4NR4 A;  4BJX A;  5D25 A;  4Q0O A;  4N4H A;  3GG3 A;  4BHW A;  4LYS A;  3U5N A;  2YDW A;  4YBS A;  5HLS A;  5ETD A;  5ENH A;  5FG4 A;  5IBN A;  5EP7 A;  3VKH A;  4IR3 A;  4XY9 A;  2E3K A;  2G4A A;  5D3L A;  2L5E A;  3U5K A;  4A9E A;  5HQ5 A;  4TTE A;  2WP2 A;  4UIX A;  4A9H A;  4PTB A;  5CPE A;  4YY4 A;  4YAT A;  5II2 A;  4RVR A;  2YQD A;  4IR4 A;  1JSP B;  5I88 A;  4QZS A;  4YAB A;  4HBV A;  5D3H A;  3DAI A;  3HMH A;  3MQM A;  4UYD A;  5EI4 A;  4YYK A;  4YK0 A;  5H1T A;  4QY4 A;  5C7N A;  3NXB A;  2OSS A;  4AKH A;  4NR7 A;  5D3P A;  3UVY A;  4O78 A;  5KTW A;  5EK9 A;  3IU5 A;  5L98 A;  4TU4 A;  5HEN A;  4N4G A;  5EU1 A;  4NS5 A;  4MR3 A;  4AKN A;  4QEV A;  5H1U A;  5IG6 A;  4HXK A;  5D24 A;  5EWH A;  3MXF A;  5A5P A;  5CFW A;  5I40 A;  4QSU A;  5EWC A;  4CUU A;  5F1H A;  5D3R A;  5EIC A;  4QNS A;  1PUO A;  5BT3 A;  5F2P A;  3S91 A;  2E7N A;  3U5P A;  4QST A;  4FLP A;  4LC2 A;  4YBM A;  4OUF A;  5FE1 A;  5FB1 A;  3UV4 A;  3MUL A;  4E96 A;  4O72 A;  4LYI A;  2RNX A;  4QSS A;  1ZKR A;  5EIS A;  4A9M A;  5L99 A;  2MJV B;  2WP1 A;  4O70 A;  4YYM A;  2D82 A;  4NR5 A;  5EM3 A;  2I7K A;  4TYL A;  5BT4 A;  5DW2 A;  3QZS A;  5EWW A;  5HEM A;  4YYD A;  4NYW A;  3QZT A;  4XUA A;  5II1 A;  4HBW A;  5I89 A;  4HXS A;  5H1V A;  5C87 A;  2L84 A;  5A82 A;  2F6N A;  4KCX A;  2RO1 A;  5ENI A;  4LZR A;  3P1D A;  4XYA A;  4YAX A;  5CQ7 A;  4O77 A;  5I86 A;  4NQN A;  4QR5 A;  5IGL A;  4TZ8 A;  4QR4 A;  5A5R A;  4TT2 A;  3JVK A;  3U5L A;  2DWW A;  2RS9 B;  4QSQ A;  5F1L A;  5FG6 A;  1ZS5 A;  3ONI A;  5BT5 A;  4LZS A;  4TZ2 A;  3JVM A;  3I3J A;  5A5S A;  2YYN A;  5HQ6 A;  3D1D A;  4HXM A;  5DYU A;  4O76 A;  4UYF B;  4QYL A;  5HEL A;  5E9Y A;  4LR6 A;  3RCW A;  1X0J A;  4QC3 A;  4A9N A;  2R0Y A;  4HXN A;  5CY9 A;  5DYX A;  5L8U A;  5CGP A;  4UYF A;  5CS8 A;  5ENJ A;  5HQ7 A;  5E9V A;  5E7D A;  5G4R A;  4XUB A;  2RNW A;  4CFK A;  4TU6 A;  4YH3 A;  4IOR A;  5CUB A;  5ENG A;  3UVD A;  3G0J A;  4IR6 A;  5DX4 A;  3LQI A;  5EPR A;  4N3W A;  5D0C A;  5D7X A;  5DY7 A;  3U5M A;  3Q2F A;  4YC9 A;  4J0R A;  4A9F A;  4NR9 A;  5TCM A;  5KTX A;  4NRB A;  3U5O A;  3P1E A;  5I1Q A;  4NR6 A;  5A5N A;  5A83 A;  2LSP B;  5C89 A;  5CUG A;  4QSV A;  5DKH A;  4HXP A;  4HXL A;  4AI6 A;  2I8N A;  5D26 A;  3LJW A;  2F6J A;  4X2I A;  5E9I A;  5LKU A;  5LKZ A;  2OUO A;  4MEO A;  2H60 A;  4HBX A;  5E9M A;  3IU6 A;  5ENF A;  2RNY A;  1N72 A;  3P5O A;  5DFC A;  5I7Y A;  4YAD A;  5EQ1 A;  3P1C A;  2D9E A;  5AD3 A;  4QBM A;  4YYI A;  4MR6 A;  5D3J A;  4CUT A;  5F25 A;  4CUQ A;  4QSW A;  4MR4 A;  5HCL A;  3O36 A;  4YBT A;  4TS8 A;  3MUK A;  4UYG A;  4Z1Q A;  5D3S A;  4NUD A;  3HME A;  5DYC A;  2R0S A;  4WHU A;  4QUU A;  5LKX A;  4J3I A;  5DKD A;  5COI A;  5CQ3 A;  5J0D A;  4PCI A;  5CU8 A;  4NR8 A;  5EV9 A;  4NUE A;  5E0R A;  5E9K A;  5C4Q A;  4A9L A;  5IGK A;  5FE9 A;  4UYH A;  3Q2E A;  4IR5 A;  4UIT A;  5EPB A;  2DVS A;  5DFB A;  5I7X A;  3O37 A;  4PCE A;  4PY6 A;  5FFV A;  5HRX A;  4NXJ A;  4QSR A;  4TT6 A;  5TB6 A;  4QR3 A;  4YYN A;  1WUM A;  5A5O A;  5HM0 A;  5F3A A;  5EGU A;  4BW1 A;  4O7E A;  4O71 A;  4NUC A;  5EWV A;  5DFD A;  2GRC A;  5CRZ A;  5CQA A;  5ENE A;  5FBX A;  2KTB B;  5JI8 A;  2OO1 A;  4N4F A;  4UYE A;  5JWM A;  3UW9 A;  4GPJ A;  4QUT A;  5CUD A;  5FFY A;  5FE4 A;  5FB0 A;  4C66 A;  5IID A;  5EVA A;  4MR5 A;  1E6I A;  4O74 A;  4LYW A;  2L85 A;  5EWD A;  3HMF A;  4AKG A;  3D7C A;  5CZG A;  5CRM A;  5HRW A;  4UIW A;  4CFL A;  4N4I A;  5F63 A;  5AME A;  4AKI A;  4NQM A;  4ZC9 A;  5FH6 A;  5FE7 A;  4Z6H A;  4MEQ A;  3DWY A;  5HFR A;  2R0V A;  4NYX A;  5FE6 A;  2RI7 A;  5KU3 A;  4ALG A;  3JVL A;  4Z6I A;  5FDZ A;  3TLP A;  5I29 A;  2EJN A;  4MEP A;  4PKL A;  5LVR A;  4TT4 A;  1WUG A;  4KV1 A;  2DVV A;  4NYV A;  5DLX A;  4O7A A;  1F68 A;  4HBY A;  4QB3 A;  3K2J A;  5LJ1 A;  4WHW A;  5ETB A;  5DLZ A;  4CL9 A;  3LQJ A;  5CUA A;  4XY8 A;  2YEL A;  4C67 A;  5DKC A;  3MB3 A;  2FSA A;  5G4S A;  3O33 A;  4IOO A;  5A7C A;  4ALH A;  5A5Q A;  4NRA A;  3AQA A;  3SVG A;  5IGN A;  4QEW A;  4Z93 A;  1JM4 B;  3QZV A;  5KHM A;  4YH4 A;  4BW4 A;  2DVR A;  4WIV A;  5CUC A;  2N9G A;  3S92 A;  5LUU A;  4YYG A;  4Y03 A;  5CP5 A;  4LDF A;  5H85 A;  3SVH A;  5E3G A;  4Z1S A;  5A85 A;  5ACY A;  5FE8 A;  4OGJ A;  5HRV A;  5DYA A;  3U5J A;  4OGI A;  5A81 A;  5E74 A;  5L97 A;  5FH7 A;  4UIY A;  3D1B A;  5LVQ A;  4LRG A;  2YEK A;  5ENB A;  5I80 A;  4CUR A;  2DAT A;  4QSP A;  5D3N A;  4HXO A;  3UV5 A;  5CQT A;  5FE0 A;  3O35 A;  5D3T A;  4CUS A;  5F61 A;  4O7B A;  5FE5 A;  5LJ2 A;  5LKT A;  2YW5 A;  5F60 A;  5AMF A;  5F62 A;  3SVF A;  4CLB A;  4F3I A;  3MB4 A;  3JVJ A;  5FE3 A;  5EPS A;  4QYD A;  3P1F A;  4O75 A;  4BW2 A;  3VKG A;  3ERR A;  4MEN A;  5FE2 A;  3FKM X;  5CQ8 A;  4UIZ A;  5CUE A;  2DKW A;  5HJC A;  4ZQL A;  2R10 A;  3O34 A;  4ZW1 A;  4DON A;  4IOQ A;  4UIU A;  4BW3 A;  4YYH A;  5EA1 A;  5CQ6 A;  5DBM A;  4YY6 A;  4QEU A;  5ENC A;  2RFJ A;  4QSX A;  5CQ4 A;  5L96 A;  4LZ2 A;  4O7F A;  4A9K A;  4A9I A;  4PS5 A;  3UV2 A;  5HFQ A;  2YEM A;  5C8G A;  4J0S A;  4NRC A;  3LQH A;  5C85 A;  2NXB A;  5KO4 A;  2DVQ A;  4O7C A;  4A9J A;  4QC1 A;  4KV4 A;  3AAD A;  5LJ0 A;  5AD2 A;  5IGM A;  3LXJ A;  5FH8 A;  3UVW A;  5F5Z A; 
#chains in the Genus database with same CATH homology
 4HXR A;  4Q0N A;  5E73 A;  3ZYU A;  4CUP A;  3G0L A;  3UVX A;  5KTU A;  5F36 A;  5L8T A;  5I83 A;  5K29 A;  5DW1 A;  5E9L A;  4J1P A;  5FG5 A;  5CTL A;  5CQ5 A;  5FFW A;  1EQF A;  4TQN A;  4YYJ A;  4UIV A;  5E3D A;  2E7O A;  4A9O A;  4NR4 A;  4BJX A;  5D25 A;  4Q0O A;  4N4H A;  3GG3 A;  4BHW A;  4LYS A;  3U5N A;  2YDW A;  4YBS A;  5HLS A;  5ETD A;  5ENH A;  5FG4 A;  5IBN A;  5EP7 A;  4IR3 A;  4XY9 A;  2E3K A;  2G4A A;  5D3L A;  2L5E A;  3U5K A;  4A9E A;  5HQ5 A;  4TTE A;  2WP2 A;  4UIX A;  4A9H A;  4PTB A;  5CPE A;  4YY4 A;  4YAT A;  5II2 A;  4RVR A;  2YQD A;  4IR4 A;  1JSP B;  5I88 A;  4QZS A;  4YAB A;  4HBV A;  5D3H A;  3DAI A;  3HMH A;  3MQM A;  4UYD A;  5EI4 A;  4YYK A;  4YK0 A;  5H1T A;  4QY4 A;  5C7N A;  3NXB A;  2OSS A;  4NR7 A;  5D3P A;  3UVY A;  4O78 A;  5KTW A;  5EK9 A;  3IU5 A;  5L98 A;  4TU4 A;  5HEN A;  4N4G A;  5EU1 A;  4NS5 A;  4MR3 A;  4AKN A;  4QEV A;  5H1U A;  5IG6 A;  4HXK A;  5D24 A;  5EWH A;  3MXF A;  5A5P A;  5CFW A;  5I40 A;  4QSU A;  5EWC A;  4CUU A;  5F1H A;  5D3R A;  5EIC A;  4QNS A;  5BT3 A;  5F2P A;  3S91 A;  2E7N A;  3U5P A;  4QST A;  4FLP A;  4LC2 A;  4YBM A;  4OUF A;  5FE1 A;  5FB1 A;  3UV4 A;  3MUL A;  4E96 A;  4O72 A;  4LYI A;  2RNX A;  4QSS A;  5EIS A;  4A9M A;  5L99 A;  2MJV B;  2WP1 A;  4O70 A;  4YYM A;  2D82 A;  4NR5 A;  5EM3 A;  2I7K A;  4TYL A;  5BT4 A;  5DW2 A;  3QZS A;  5EWW A;  5HEM A;  4YYD A;  4NYW A;  3QZT A;  4XUA A;  5II1 A;  4HBW A;  5I89 A;  4HXS A;  5H1V A;  5C87 A;  2L84 A;  5A82 A;  2F6N A;  4KCX A;  2RO1 A;  5ENI A;  4LZR A;  3P1D A;  4XYA A;  4YAX A;  5CQ7 A;  4O77 A;  5I86 A;  4NQN A;  4QR5 A;  5IGL A;  4TZ8 A;  4QR4 A;  5A5R A;  4TT2 A;  3JVK A;  3U5L A;  2DWW A;  2RS9 B;  4QSQ A;  5F1L A;  5FG6 A;  1ZS5 A;  3ONI A;  5BT5 A;  4LZS A;  4TZ2 A;  3JVM A;  3I3J A;  5A5S A;  2YYN A;  5HQ6 A;  4HXM A;  5DYU A;  4O76 A;  4UYF B;  4QYL A;  5HEL A;  5E9Y A;  4LR6 A;  3RCW A;  1X0J A;  4QC3 A;  4A9N A;  2R0Y A;  4HXN A;  5CY9 A;  5DYX A;  5L8U A;  5CGP A;  4UYF A;  5CS8 A;  5ENJ A;  5HQ7 A;  5E9V A;  5E7D A;  5G4R A;  4XUB A;  2RNW A;  4CFK A;  4TU6 A;  4YH3 A;  4IOR A;  5CUB A;  5ENG A;  3UVD A;  3G0J A;  4IR6 A;  5DX4 A;  3LQI A;  5EPR A;  4N3W A;  5D0C A;  5D7X A;  5DY7 A;  3U5M A;  3Q2F A;  4YC9 A;  4J0R A;  4A9F A;  4NR9 A;  5TCM A;  5KTX A;  4NRB A;  3U5O A;  3P1E A;  5I1Q A;  4NR6 A;  5A5N A;  5A83 A;  2LSP B;  5C89 A;  5CUG A;  4QSV A;  5DKH A;  4HXP A;  4HXL A;  2I8N A;  5D26 A;  3LJW A;  2F6J A;  4X2I A;  5E9I A;  5LKU A;  5LKZ A;  2OUO A;  4MEO A;  2H60 A;  4HBX A;  5E9M A;  3IU6 A;  5ENF A;  2RNY A;  1N72 A;  3P5O A;  5DFC A;  5I7Y A;  4YAD A;  5EQ1 A;  3P1C A;  2D9E A;  5AD3 A;  4QBM A;  4YYI A;  4MR6 A;  5D3J A;  4CUT A;  5F25 A;  4CUQ A;  4QSW A;  4MR4 A;  5HCL A;  3O36 A;  4YBT A;  4TS8 A;  3MUK A;  4UYG A;  4Z1Q A;  5D3S A;  4NUD A;  3HME A;  5DYC A;  2R0S A;  4WHU A;  4QUU A;  5LKX A;  4J3I A;  5DKD A;  5COI A;  5CQ3 A;  5J0D A;  4PCI A;  5CU8 A;  4NR8 A;  5EV9 A;  4NUE A;  5E0R A;  5E9K A;  5C4Q A;  4A9L A;  5IGK A;  5FE9 A;  4UYH A;  3Q2E A;  4IR5 A;  4UIT A;  5EPB A;  2DVS A;  5DFB A;  5I7X A;  3O37 A;  4PCE A;  4PY6 A;  5FFV A;  5HRX A;  4NXJ A;  4QSR A;  4TT6 A;  5TB6 A;  4QR3 A;  4YYN A;  1WUM A;  5A5O A;  5HM0 A;  5F3A A;  5EGU A;  4BW1 A;  4O7E A;  4O71 A;  4NUC A;  5EWV A;  5DFD A;  2GRC A;  5CRZ A;  5CQA A;  5ENE A;  5FBX A;  2KTB B;  5JI8 A;  2OO1 A;  4N4F A;  4UYE A;  5JWM A;  3UW9 A;  4GPJ A;  4QUT A;  5CUD A;  5FFY A;  5FE4 A;  5FB0 A;  4C66 A;  5IID A;  5EVA A;  4MR5 A;  1E6I A;  4O74 A;  4LYW A;  2L85 A;  5EWD A;  3HMF A;  3D7C A;  5CZG A;  5CRM A;  5HRW A;  4UIW A;  4CFL A;  4N4I A;  5F63 A;  5AME A;  4NQM A;  4ZC9 A;  5FH6 A;  5FE7 A;  4Z6H A;  4MEQ A;  3DWY A;  5HFR A;  2R0V A;  4NYX A;  5FE6 A;  2RI7 A;  5KU3 A;  4ALG A;  3JVL A;  4Z6I A;  5FDZ A;  3TLP A;  5I29 A;  4MEP A;  4PKL A;  5LVR A;  4TT4 A;  1WUG A;  4KV1 A;  2DVV A;  4NYV A;  5DLX A;  4O7A A;  1F68 A;  4HBY A;  4QB3 A;  3K2J A;  5LJ1 A;  4WHW A;  5ETB A;  5DLZ A;  4CL9 A;  3LQJ A;  5CUA A;  4XY8 A;  2YEL A;  4C67 A;  5DKC A;  3MB3 A;  2FSA A;  5G4S A;  3O33 A;  4IOO A;  5A7C A;  4ALH A;  5A5Q A;  4NRA A;  3AQA A;  3SVG A;  5IGN A;  4QEW A;  4Z93 A;  1JM4 B;  3QZV A;  5KHM A;  4YH4 A;  4BW4 A;  2DVR A;  4WIV A;  5CUC A;  2N9G A;  3S92 A;  5LUU A;  4YYG A;  4Y03 A;  5CP5 A;  4LDF A;  5H85 A;  3SVH A;  5E3G A;  4Z1S A;  5A85 A;  5ACY A;  5FE8 A;  4OGJ A;  5HRV A;  5DYA A;  3U5J A;  4OGI A;  5A81 A;  5E74 A;  5L97 A;  5FH7 A;  4UIY A;  5LVQ A;  4LRG A;  2YEK A;  5ENB A;  5I80 A;  4CUR A;  2DAT A;  4QSP A;  5D3N A;  4HXO A;  3UV5 A;  5CQT A;  5FE0 A;  3O35 A;  5D3T A;  4CUS A;  5F61 A;  4O7B A;  5FE5 A;  5LJ2 A;  5LKT A;  2YW5 A;  5F60 A;  5AMF A;  5F62 A;  3SVF A;  4CLB A;  4F3I A;  3MB4 A;  3JVJ A;  5FE3 A;  5EPS A;  4QYD A;  3P1F A;  4O75 A;  4BW2 A;  4MEN A;  5FE2 A;  3FKM X;  5CQ8 A;  4UIZ A;  5CUE A;  2DKW A;  5HJC A;  4ZQL A;  2R10 A;  3O34 A;  4ZW1 A;  4DON A;  4IOQ A;  4UIU A;  4BW3 A;  4YYH A;  5EA1 A;  5CQ6 A;  5DBM A;  4YY6 A;  4QEU A;  5ENC A;  2RFJ A;  4QSX A;  5CQ4 A;  5L96 A;  4LZ2 A;  4O7F A;  4A9K A;  4A9I A;  4PS5 A;  3UV2 A;  5HFQ A;  2YEM A;  5C8G A;  4J0S A;  4NRC A;  3LQH A;  5C85 A;  2NXB A;  5KO4 A;  2DVQ A;  4O7C A;  4A9J A;  4QC1 A;  4KV4 A;  3AAD A;  5LJ0 A;  5AD2 A;  5IGM A;  3LXJ A;  5FH8 A;  3UVW A;  5F5Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...