5EWWA

Crystal structure of the human brpf1 bromodomain in complex with seed21
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
113
structure length
113
Chain Sequence
EMQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Peregrin
publication title Crystal structure of the human BRPF1 bromodomain in complex with SEED21
rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 41
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2015-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5ewwA00
3DAIA 2KTBB 4ZW1A 2F6NA 4C67A 4IOOA 4MR6A 4Q0OA 4N4HA 3HMFA 4YYDA 5AD3A 5BT5A 5HCLA 3G0LA 3U5PA 3D7CA 4YBTA 5FFYA 5E9KA 5EGUA 2OUOA 4HBXA 4HXNA 4NUEA 5G4RA 5I7XA 4CFKA 5CUAA 4HXSA 5IGKA 4C66A 4HXRA 4QSSA 4MEPA 5A5NA 4NXJA 3I3JA 4UYDA 4UYFA 5F5ZA 4QSVA 3O37A 2YYNA 4O7BA 5I83A 2RFJA 5L8UA 4PY6A 5DFDA 5I80A 5DYUA 3SVFA 5A5OA 4YYKA 4LRGA 5E3DA 3P1EA 3QZVA 4KV1A 5CUCA 5EPRA 4BW3A 4YY4A 3AADA 4MENA 5F25A 5F63A 5EWCA 3UVDA 3U5JA 3MB4A 3HMHA 5HRXA 3K2JA 5F1HA 5FB0A 3UV4A 5D3SA 5E9IA 4CUSA 5LKXA 5KTUA 4O71A 5DKCA 4NR8A 4QSTA 4A9KA 4A9LA 4RVRA 4O72A 5E3GA 4HXLA 3U5MA 5I7YA 4LYSA 4NQNA 4UIYA 1ZS5A 2E3KA 5F2PA 5D3PA 5I89A 4BHWA 4PKLA 4PS5A 5DYCA 4CFLA 5HFQA 5A5SA 1E6IA 2G4AA 5CQ8A 4WHUA 4OGIA 4O77A 4O7CA 5EICA 5TB6A 3LQJA 2YQDA 5F61A 5D0CA 3G0JA 4HXOA 4AKNA 5ENCA 4Z6IA 5CRZA 4J0RA 4NR5A 5A5QA 2F6JA 4LZSA 4N4IA 5CZGA 5E9YA 5DW1A 4QEVA 4QR5A 1X0JA 4HXKA 5CUBA 5FE6A 5LUUA 4YATA 5EWVA 5L99A 2D82A 4QR4A 3LQHA 5L97A 5E0RA 2L5EA 2YEKA 5LJ1A 4UYHA 5EU1A 4YYJA 5DFCA 5F3AA 4TT4A 1EQFA 4LC2A 4YK0A 5FB1A 2DWWA 5CY9A 5A5RA 2RI7A 4O70A 5LJ0A 4NQMA 5AD2A 5FE7A 4YY6A 4BW4A 2DVSA 5L96A 5JI8A 4YYGA 4UIUA 4QR3A 4OGJA 4O76A 2R10A 2N9GA 5II1A 3S92A 5IBNA 5C4QA 5H1VA 5ENJA 4LR6A 5F36A 5HENA 3UW9A 4XUAA 5CP5A 5ETDA 4TT2A 5FE3A 5DW2A 4NRBA 5EVAA 5EPBA 4PCEA 5CUEA 4NS5A 5CU8A 3SVGA 4TYLA 5E9VA 4XY9A 5F60A 5BT3A 5FE4A 4O7FA 5CPEA 4LZRA 5H1UA 5L8TA 1F68A 1WUGA 2WP1A 5D24A 5CFWA 2E7OA 5TCMA 5A82A 5ENIA 5C87A 5EQ1A 5FG6A 4WIVA 5EWWA 4YABA 2WP2A 3O36A 3P1CA 4GPJA 2OSSA 3U5LA 4CUQA 5EPSA 5FH8A 5K29A 3UVXA 5HLSA 4NR7A 5D25A 4A9OA 4IR3A 4MEQA 3O34A 4FLPA 2YELA 4YBSA 4KCXA 4NRCA 4YYIA 4LZ2A 4YH3A 4DONA 5LKTA 2LSPB 4YH4A 1JM4B 4TZ8A 3SVHA 5FG4A 5DKDA 5CQ4A 5I29A 5D3TA 4YADA 3MULA 2YDWA 4UYEA 5AMEA 5C85A 3UV5A 4IR6A 4O74A 5EWDA 4QSRA 5DLZA 5FE5A 2E7NA 5HQ5A 4YC9A 3P5OA 4QZSA 5CTLA 5A85A 4TU4A 2R0VA 5HFRA 4NRAA 2D9EA 3TLPA 4QUTA 5LKZA 5ENEA 4BW1A 5J0DA 5C7NA 5HRWA 5EISA 4UIWA 5D7XA 5II2A 4YYMA 4F3IA 2DVVA 5FFVA 5ENHA 3NXBA 2RNWA 2RNYA 2YW5A 4UIXA 5EI4A 4QBMA 4XY8A 4NYWA 5AMFA 5FE9A 4N4GA 5ACYA 4IORA 3UVYA 4PCIA 5FE2A 5KO4A 3LJWA 5FDZA 5CQ7A 2RO1A 3DWYA 4LYWA 4A9IA 4A9FA 4E96A 5I1QA 4QNSA 4NUCA 5EA1A 5EM3A 5KTWA 4MEOA 5DYXA 3QZSA 5JWMA 3JVLA 4MR4A 4MR5A 4YYHA 3RCWA 5C8GA 4TS8A 4UYGA 5F62A 3MUKA 5CQ3A 4ALHA 3MXFA 2R0YA 4XUBA 4A9HA 2RNXA 5CUDA 5D3NA 5D3HA 5KU3A 5LVRA 3IU6A 3MB3A 5E73A 4HXMA 2R0SA 5FE0A 5IGMA 3U5OA 4NR4A 5DFBA 2DATA 4HBYA 5F1LA 3AQAA 3U5KA 5CUGA 5E9MA 4N4FA 4X2IA 4HXPA 4QC3A 3P1FA 4J3IA 4QSUA 4QSXA 5D26A 4ALGA 5E9LA 4QEWA 5D3JA 5LJ2A 4NYVA 2FSAA 5HELA 2MJVB 4YAXA 4IR5A 4XYAA 4ZC9A 5KTXA 3ZYUA 4QEUA 4IOQA 4O7AA 4J1PA 4QYLA 4Y03A 4LDFA 4BJXA 3P1DA 2DKWA 1WUMA 5CGPA 3ONIA 2I8NA 5I86A 3IU5A 5EV9A 5ENFA 4QYDA 4UIVA 3Q2FA 5CQ6A 5EWHA 5A5PA 4UITA 4BW2A 4CUUA 4HBWA 4NR9A 4QB3A 5DBMA 3S91A 5HQ7A 4PTBA 3MQMA 1JSPB 3LXJA 4QSWA 5CRMA 3JVKA 5EP7A 4Z93A 1N72A 4TTEA 4WHWA 2L85A 3O35A 4NUDA 4QSQA 4TQNA 4OUFA 5CQ5A 5CQTA 5CQAA 5FE8A 5H1TA 2DVRA 3GG3A 5DKHA 5DY7A 4QSPA 5CS8A 4CUTA 5FH7A 4QC1A 4O75A 5I40A 5FFWA 5FG5A 4TZ2A 5A83A 3HMEA 5IGLA 4TT6A 5HRVA 5I88A 5G4SA 3QZTA 4CUPA 5LKUA 3UVWA 4A9MA 4A9EA 5HM0A 3U5NA 4J0SA 5COIA 5HJCA 5DX4A 5E74A 5FBXA 5KHMA 3JVJA 5HEMA 4CLBA 4YYNA 5A7CA 2GRCA 4CL9A 4NYXA 5BT4A 2DVQA 4QUUA 5HQ6A 5FE1A 5L98A 5D3RA 3LQIA 4MR3A 4YBMA 3FKMX 5LVQA 2I7KA 2YEMA 2L84A 4O7EA 4TU6A 5DYAA 4Z1QA 2H60A 4UYFB 5E7DA 2NXBA 4A9NA 4HBVA 5FH6A 5IG6A 4LYIA 2RS9B 4ZQLA 5D3LA 5A81A 5EK9A 5IIDA 2OO1A 4UIZA 4A9JA 5ENGA 5C89A 3JVMA 3UV2A 4KV4A 5DLXA 4O78A 5ETBA 4Z6HA 5ENBA 4Z1SA 3Q2EA 4N3WA 4NR6A 4QY4A 3O33A 4Q0NA 5H85A 4CURA 4IR4A 5IGNA
chains in the Genus database with same CATH superfamily
3DAIA 2KTBB 4ZW1A 2F6NA 4C67A 4IOOA 4MR6A 4Q0OA 3VKGA 4N4HA 3HMFA 4YYDA 5AD3A 5BT5A 5HCLA 3G0LA 3U5PA 3D7CA 4YBTA 5FFYA 5E9KA 5EGUA 2OUOA 4HBXA 4HXNA 4NUEA 5G4RA 5I7XA 4CFKA 5CUAA 4HXSA 5IGKA 4C66A 4HXRA 4QSSA 4AKGA 4MEPA 5A5NA 4NXJA 3I3JA 4UYDA 4UYFA 5F5ZA 4QSVA 3O37A 2YYNA 4O7BA 5I83A 2RFJA 5L8UA 4PY6A 5DFDA 5I80A 5DYUA 3SVFA 5A5OA 4YYKA 4LRGA 5E3DA 3P1EA 3QZVA 4KV1A 5CUCA 5EPRA 4BW3A 4YY4A 3AADA 4MENA 5F25A 5F63A 5EWCA 3UVDA 3U5JA 3MB4A 3HMHA 5HRXA 3K2JA 5F1HA 5FB0A 3UV4A 5D3SA 5E9IA 4CUSA 5LKXA 5KTUA 4O71A 5DKCA 4NR8A 4QSTA 4A9KA 4A9LA 4RVRA 4O72A 5E3GA 4HXLA 3U5MA 5I7YA 4LYSA 4NQNA 4UIYA 1ZS5A 2E3KA 5F2PA 5D3PA 5I89A 4BHWA 4PKLA 4PS5A 5DYCA 4CFLA 5HFQA 5A5SA 1E6IA 2G4AA 5CQ8A 4WHUA 4OGIA 4O77A 4O7CA 5EICA 5TB6A 3LQJA 2YQDA 5F61A 5D0CA 3G0JA 4HXOA 4AKNA 5ENCA 4Z6IA 5CRZA 4J0RA 4NR5A 5A5QA 2F6JA 4LZSA 4N4IA 5CZGA 5E9YA 5DW1A 4QEVA 4QR5A 1X0JA 4HXKA 5CUBA 5FE6A 5LUUA 4YATA 5EWVA 5L99A 2D82A 4QR4A 3LQHA 5L97A 5E0RA 2L5EA 2YEKA 5LJ1A 4UYHA 5EU1A 4YYJA 5DFCA 5F3AA 4TT4A 1EQFA 4LC2A 4YK0A 5FB1A 2DWWA 5CY9A 5A5RA 2RI7A 4O70A 5LJ0A 4NQMA 5AD2A 5FE7A 4YY6A 4BW4A 2DVSA 5L96A 5JI8A 4YYGA 4UIUA 4QR3A 4OGJA 4O76A 2R10A 2N9GA 5II1A 3S92A 5IBNA 3ERRA 5C4QA 3VKHA 5H1VA 5ENJA 4LR6A 5F36A 5HENA 3UW9A 4XUAA 5CP5A 5ETDA 4TT2A 5FE3A 5DW2A 4NRBA 5EVAA 5EPBA 4PCEA 5CUEA 4NS5A 5CU8A 3SVGA 4TYLA 5E9VA 4XY9A 5F60A 5BT3A 5FE4A 4O7FA 5CPEA 4LZRA 5H1UA 5L8TA 1F68A 1WUGA 2WP1A 5D24A 5CFWA 2E7OA 5TCMA 5A82A 5ENIA 5C87A 5EQ1A 5FG6A 4WIVA 5EWWA 4YABA 2WP2A 3O36A 3P1CA 4GPJA 2OSSA 3U5LA 4CUQA 5EPSA 5FH8A 5K29A 3UVXA 5HLSA 4NR7A 5D25A 4A9OA 4IR3A 4MEQA 3O34A 4FLPA 2YELA 4YBSA 4KCXA 4NRCA 4YYIA 4LZ2A 4YH3A 4DONA 5LKTA 2LSPB 4YH4A 1JM4B 4TZ8A 3SVHA 5FG4A 5DKDA 5CQ4A 5I29A 5D3TA 4YADA 3MULA 2YDWA 4UYEA 5AMEA 5C85A 3UV5A 4IR6A 4O74A 5EWDA 4QSRA 5DLZA 5FE5A 2E7NA 5HQ5A 4YC9A 3P5OA 4QZSA 5CTLA 5A85A 4TU4A 2R0VA 5HFRA 4NRAA 2D9EA 3TLPA 4QUTA 5LKZA 5ENEA 4BW1A 5J0DA 3D1DA 5C7NA 5HRWA 5EISA 4UIWA 5D7XA 5II2A 4YYMA 4F3IA 2DVVA 5FFVA 5ENHA 3NXBA 2RNWA 2RNYA 2YW5A 4UIXA 5EI4A 4QBMA 4XY8A 4NYWA 5AMFA 5FE9A 4N4GA 5ACYA 4IORA 3UVYA 4PCIA 5FE2A 5KO4A 3LJWA 5FDZA 5CQ7A 2RO1A 3DWYA 1ZKRA 4LYWA 4A9IA 4A9FA 4E96A 5I1QA 4QNSA 4NUCA 5EA1A 5EM3A 5KTWA 4MEOA 5DYXA 3QZSA 5JWMA 3JVLA 4MR4A 4MR5A 4YYHA 3RCWA 5C8GA 4TS8A 4UYGA 5F62A 3MUKA 5CQ3A 4ALHA 3MXFA 2R0YA 4XUBA 4A9HA 2RNXA 5CUDA 5D3NA 5D3HA 5KU3A 5LVRA 3IU6A 3MB3A 5E73A 4HXMA 2R0SA 5FE0A 5IGMA 3U5OA 4NR4A 5DFBA 2DATA 4HBYA 5F1LA 3AQAA 3U5KA 5CUGA 5E9MA 4N4FA 4X2IA 4HXPA 4QC3A 3P1FA 4J3IA 4QSUA 4QSXA 5D26A 4ALGA 5E9LA 4QEWA 5D3JA 5LJ2A 4NYVA 4AKIA 2FSAA 5HELA 2MJVB 4YAXA 4IR5A 4XYAA 4ZC9A 5KTXA 3ZYUA 4QEUA 4IOQA 4O7AA 4J1PA 4QYLA 4Y03A 2EJNA 4LDFA 4BJXA 3P1DA 2DKWA 1WUMA 5CGPA 3ONIA 2I8NA 5I86A 3IU5A 5EV9A 5ENFA 4QYDA 4UIVA 3Q2FA 5CQ6A 5EWHA 5A5PA 4UITA 4BW2A 4CUUA 4HBWA 4NR9A 4QB3A 5DBMA 3S91A 5HQ7A 4PTBA 3MQMA 1JSPB 3LXJA 4QSWA 5CRMA 3JVKA 5EP7A 4Z93A 1N72A 4TTEA 4WHWA 2L85A 3O35A 4NUDA 4QSQA 4TQNA 4OUFA 5CQ5A 5CQTA 5CQAA 5FE8A 5H1TA 2DVRA 3GG3A 5DKHA 5DY7A 4QSPA 5CS8A 4CUTA 5FH7A 4QC1A 4O75A 5I40A 5FFWA 5FG5A 4TZ2A 5A83A 3HMEA 4AKHA 5IGLA 4TT6A 5HRVA 5I88A 5G4SA 3QZTA 4CUPA 5LKUA 4AI6A 3UVWA 4A9MA 4A9EA 5HM0A 3U5NA 4J0SA 5COIA 5HJCA 5DX4A 5E74A 5FBXA 5KHMA 3JVJA 5HEMA 4CLBA 4YYNA 5A7CA 2GRCA 4CL9A 4NYXA 5BT4A 2DVQA 4QUUA 5HQ6A 5FE1A 5L98A 5D3RA 3LQIA 4MR3A 4YBMA 3FKMX 5LVQA 2I7KA 2YEMA 2L84A 4O7EA 4TU6A 5DYAA 4Z1QA 2H60A 4UYFB 3D1BA 5E7DA 2NXBA 4A9NA 4HBVA 5FH6A 5IG6A 4LYIA 2RS9B 4ZQLA 5D3LA 5A81A 5EK9A 5IIDA 2OO1A 1PUOA 4UIZA 4A9JA 5ENGA 5C89A 3JVMA 3UV2A 4KV4A 5DLXA 4O78A 5ETBA 4Z6HA 5ENBA 4Z1SA 3Q2EA 4N3WA 4NR6A 4QY4A 3O33A 4Q0NA 5H85A 4CURA 4IR4A 5IGNA
chains in the Genus database with same CATH topology
3DAIA 2KTBB 4ZW1A 2F6NA 4C67A 4IOOA 4MR6A 4Q0OA 4N4HA 3HMFA 4YYDA 5AD3A 5BT5A 5HCLA 3G0LA 3U5PA 3D7CA 4YBTA 5FFYA 5E9KA 5EGUA 2OUOA 4HBXA 4HXNA 4NUEA 5G4RA 5I7XA 4CFKA 5CUAA 4HXSA 5IGKA 4C66A 4HXRA 4QSSA 4MEPA 5A5NA 4NXJA 3I3JA 4UYDA 4UYFA 5F5ZA 4QSVA 3O37A 2YYNA 4O7BA 5I83A 2RFJA 5L8UA 4PY6A 5DFDA 5I80A 5DYUA 3SVFA 5A5OA 4YYKA 4LRGA 5E3DA 3P1EA 3QZVA 4KV1A 5CUCA 5EPRA 4BW3A 4YY4A 3AADA 4MENA 5F25A 5F63A 5EWCA 3UVDA 3U5JA 3MB4A 3HMHA 5HRXA 3K2JA 5F1HA 5FB0A 3UV4A 5D3SA 5E9IA 4CUSA 5LKXA 5KTUA 4O71A 5DKCA 4NR8A 4QSTA 4A9KA 4A9LA 4RVRA 4O72A 5E3GA 4HXLA 3U5MA 5I7YA 4LYSA 4NQNA 4UIYA 1ZS5A 2E3KA 5F2PA 5D3PA 5I89A 4BHWA 4PKLA 4PS5A 5DYCA 4CFLA 5HFQA 5A5SA 1E6IA 2G4AA 5CQ8A 4WHUA 4OGIA 4O77A 4O7CA 5EICA 5TB6A 3LQJA 2YQDA 5F61A 5D0CA 3G0JA 4HXOA 4AKNA 5ENCA 4Z6IA 5CRZA 4J0RA 4NR5A 5A5QA 2F6JA 4LZSA 4N4IA 5CZGA 5E9YA 5DW1A 4QEVA 4QR5A 1X0JA 4HXKA 5CUBA 5FE6A 5LUUA 4YATA 5EWVA 5L99A 2D82A 4QR4A 3LQHA 5L97A 5E0RA 2L5EA 2YEKA 5LJ1A 4UYHA 5EU1A 4YYJA 5DFCA 5F3AA 4TT4A 1EQFA 4LC2A 4YK0A 5FB1A 2DWWA 5CY9A 5A5RA 2RI7A 4O70A 5LJ0A 4NQMA 5AD2A 5FE7A 4YY6A 4BW4A 2DVSA 5L96A 5JI8A 4YYGA 4UIUA 4QR3A 4OGJA 4O76A 2R10A 2N9GA 5II1A 3S92A 5IBNA 5C4QA 5H1VA 5ENJA 4LR6A 5F36A 5HENA 3UW9A 4XUAA 5CP5A 5ETDA 4TT2A 5FE3A 5DW2A 4NRBA 5EVAA 5EPBA 4PCEA 5CUEA 4NS5A 5CU8A 3SVGA 4TYLA 5E9VA 4XY9A 5F60A 5BT3A 5FE4A 4O7FA 5CPEA 4LZRA 5H1UA 5L8TA 1F68A 1WUGA 2WP1A 5D24A 5CFWA 2E7OA 5TCMA 5A82A 5ENIA 5C87A 5EQ1A 5FG6A 4WIVA 5EWWA 4YABA 2WP2A 3O36A 3P1CA 4GPJA 2OSSA 3U5LA 4CUQA 5EPSA 5FH8A 5K29A 3UVXA 5HLSA 4NR7A 5D25A 4A9OA 4IR3A 4MEQA 3O34A 4FLPA 2YELA 4YBSA 4KCXA 4NRCA 4YYIA 4LZ2A 4YH3A 4DONA 5LKTA 2LSPB 4YH4A 1JM4B 4TZ8A 3SVHA 5FG4A 5DKDA 5CQ4A 5I29A 5D3TA 4YADA 3MULA 2YDWA 4UYEA 5AMEA 5C85A 3UV5A 4IR6A 4O74A 5EWDA 4QSRA 5DLZA 5FE5A 2E7NA 5HQ5A 4YC9A 3P5OA 4QZSA 5CTLA 5A85A 4TU4A 2R0VA 5HFRA 4NRAA 2D9EA 3TLPA 4QUTA 5LKZA 5ENEA 4BW1A 5J0DA 5C7NA 5HRWA 5EISA 4UIWA 5D7XA 5II2A 4YYMA 4F3IA 2DVVA 5FFVA 5ENHA 3NXBA 2RNWA 2RNYA 2YW5A 4UIXA 5EI4A 4QBMA 4XY8A 4NYWA 5AMFA 5FE9A 4N4GA 5ACYA 4IORA 3UVYA 4PCIA 5FE2A 5KO4A 3LJWA 5FDZA 5CQ7A 2RO1A 3DWYA 4LYWA 4A9IA 4A9FA 4E96A 5I1QA 4QNSA 4NUCA 5EA1A 5EM3A 5KTWA 4MEOA 5DYXA 3QZSA 5JWMA 3JVLA 4MR4A 4MR5A 4YYHA 3RCWA 5C8GA 4TS8A 4UYGA 5F62A 3MUKA 5CQ3A 4ALHA 3MXFA 2R0YA 4XUBA 4A9HA 2RNXA 5CUDA 5D3NA 5D3HA 5KU3A 5LVRA 3IU6A 3MB3A 5E73A 4HXMA 2R0SA 5FE0A 5IGMA 3U5OA 4NR4A 5DFBA 2DATA 4HBYA 5F1LA 3AQAA 3U5KA 5CUGA 5E9MA 4N4FA 4X2IA 4HXPA 4QC3A 3P1FA 4J3IA 4QSUA 4QSXA 5D26A 4ALGA 5E9LA 4QEWA 5D3JA 5LJ2A 4NYVA 2FSAA 5HELA 2MJVB 4YAXA 4IR5A 4XYAA 4ZC9A 5KTXA 3ZYUA 4QEUA 4IOQA 4O7AA 4J1PA 4QYLA 4Y03A 4LDFA 4BJXA 3P1DA 2DKWA 1WUMA 5CGPA 3ONIA 2I8NA 5I86A 3IU5A 5EV9A 5ENFA 4QYDA 4UIVA 3Q2FA 5CQ6A 5EWHA 5A5PA 4UITA 4BW2A 4CUUA 4HBWA 4NR9A 4QB3A 5DBMA 3S91A 5HQ7A 4PTBA 3MQMA 1JSPB 3LXJA 4QSWA 5CRMA 3JVKA 5EP7A 4Z93A 1N72A 4TTEA 4WHWA 2L85A 3O35A 4NUDA 4QSQA 4TQNA 4OUFA 5CQ5A 5CQTA 5CQAA 5FE8A 5H1TA 2DVRA 3GG3A 5DKHA 5DY7A 4QSPA 5CS8A 4CUTA 5FH7A 4QC1A 4O75A 5I40A 5FFWA 5FG5A 4TZ2A 5A83A 3HMEA 5IGLA 4TT6A 5HRVA 5I88A 5G4SA 3QZTA 4CUPA 5LKUA 3UVWA 4A9MA 4A9EA 5HM0A 3U5NA 4J0SA 5COIA 5HJCA 5DX4A 5E74A 5FBXA 5KHMA 3JVJA 5HEMA 4CLBA 4YYNA 5A7CA 2GRCA 4CL9A 4NYXA 5BT4A 2DVQA 4QUUA 5HQ6A 5FE1A 5L98A 5D3RA 3LQIA 4MR3A 4YBMA 3FKMX 5LVQA 2I7KA 2YEMA 2L84A 4O7EA 4TU6A 5DYAA 4Z1QA 2H60A 4UYFB 5E7DA 2NXBA 4A9NA 4HBVA 5FH6A 5IG6A 4LYIA 2RS9B 4ZQLA 5D3LA 5A81A 5EK9A 5IIDA 2OO1A 4UIZA 4A9JA 5ENGA 5C89A 3JVMA 3UV2A 4KV4A 5DLXA 4O78A 5ETBA 4Z6HA 5ENBA 4Z1SA 3Q2EA 4N3WA 4NR6A 4QY4A 3O33A 4Q0NA 5H85A 4CURA 4IR4A 5IGNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DAI A;  2KTB B;  4ZW1 A;  2F6N A;  4C67 A;  4IOO A;  4MR6 A;  4Q0O A;  4N4H A;  3HMF A;  4YYD A;  5AD3 A;  5BT5 A;  5HCL A;  3G0L A;  3U5P A;  3D7C A;  4YBT A;  5FFY A;  5E9K A;  5EGU A;  2OUO A;  4HBX A;  4HXN A;  4NUE A;  5G4R A;  5I7X A;  4CFK A;  5CUA A;  4HXS A;  5IGK A;  4C66 A;  4HXR A;  4QSS A;  4MEP A;  5A5N A;  4NXJ A;  3I3J A;  4UYD A;  4UYF A;  5F5Z A;  4QSV A;  3O37 A;  2YYN A;  4O7B A;  5I83 A;  2RFJ A;  5L8U A;  4PY6 A;  5DFD A;  5I80 A;  5DYU A;  3SVF A;  5A5O A;  4YYK A;  4LRG A;  5E3D A;  3P1E A;  3QZV A;  4KV1 A;  5CUC A;  5EPR A;  4BW3 A;  4YY4 A;  3AAD A;  4MEN A;  5F25 A;  5F63 A;  5EWC A;  3UVD A;  3U5J A;  3MB4 A;  3HMH A;  5HRX A;  3K2J A;  5F1H A;  5FB0 A;  3UV4 A;  5D3S A;  5E9I A;  4CUS A;  5LKX A;  5KTU A;  4O71 A;  5DKC A;  4NR8 A;  4QST A;  4A9K A;  4A9L A;  4RVR A;  4O72 A;  5E3G A;  4HXL A;  3U5M A;  5I7Y A;  4LYS A;  4NQN A;  4UIY A;  1ZS5 A;  2E3K A;  5F2P A;  5D3P A;  5I89 A;  4BHW A;  4PKL A;  4PS5 A;  5DYC A;  4CFL A;  5HFQ A;  5A5S A;  1E6I A;  2G4A A;  5CQ8 A;  4WHU A;  4OGI A;  4O77 A;  4O7C A;  5EIC A;  5TB6 A;  3LQJ A;  2YQD A;  5F61 A;  5D0C A;  3G0J A;  4HXO A;  4AKN A;  5ENC A;  4Z6I A;  5CRZ A;  4J0R A;  4NR5 A;  5A5Q A;  2F6J A;  4LZS A;  4N4I A;  5CZG A;  5E9Y A;  5DW1 A;  4QEV A;  4QR5 A;  1X0J A;  4HXK A;  5CUB A;  5FE6 A;  5LUU A;  4YAT A;  5EWV A;  5L99 A;  2D82 A;  4QR4 A;  3LQH A;  5L97 A;  5E0R A;  2L5E A;  2YEK A;  5LJ1 A;  4UYH A;  5EU1 A;  4YYJ A;  5DFC A;  5F3A A;  4TT4 A;  1EQF A;  4LC2 A;  4YK0 A;  5FB1 A;  2DWW A;  5CY9 A;  5A5R A;  2RI7 A;  4O70 A;  5LJ0 A;  4NQM A;  5AD2 A;  5FE7 A;  4YY6 A;  4BW4 A;  2DVS A;  5L96 A;  5JI8 A;  4YYG A;  4UIU A;  4QR3 A;  4OGJ A;  4O76 A;  2R10 A;  2N9G A;  5II1 A;  3S92 A;  5IBN A;  5C4Q A;  5H1V A;  5ENJ A;  4LR6 A;  5F36 A;  5HEN A;  3UW9 A;  4XUA A;  5CP5 A;  5ETD A;  4TT2 A;  5FE3 A;  5DW2 A;  4NRB A;  5EVA A;  5EPB A;  4PCE A;  5CUE A;  4NS5 A;  5CU8 A;  3SVG A;  4TYL A;  5E9V A;  4XY9 A;  5F60 A;  5BT3 A;  5FE4 A;  4O7F A;  5CPE A;  4LZR A;  5H1U A;  5L8T A;  1F68 A;  1WUG A;  2WP1 A;  5D24 A;  5CFW A;  2E7O A;  5TCM A;  5A82 A;  5ENI A;  5C87 A;  5EQ1 A;  5FG6 A;  4WIV A;  5EWW A;  4YAB A;  2WP2 A;  3O36 A;  3P1C A;  4GPJ A;  2OSS A;  3U5L A;  4CUQ A;  5EPS A;  5FH8 A;  5K29 A;  3UVX A;  5HLS A;  4NR7 A;  5D25 A;  4A9O A;  4IR3 A;  4MEQ A;  3O34 A;  4FLP A;  2YEL A;  4YBS A;  4KCX A;  4NRC A;  4YYI A;  4LZ2 A;  4YH3 A;  4DON A;  5LKT A;  2LSP B;  4YH4 A;  1JM4 B;  4TZ8 A;  3SVH A;  5FG4 A;  5DKD A;  5CQ4 A;  5I29 A;  5D3T A;  4YAD A;  3MUL A;  2YDW A;  4UYE A;  5AME A;  5C85 A;  3UV5 A;  4IR6 A;  4O74 A;  5EWD A;  4QSR A;  5DLZ A;  5FE5 A;  2E7N A;  5HQ5 A;  4YC9 A;  3P5O A;  4QZS A;  5CTL A;  5A85 A;  4TU4 A;  2R0V A;  5HFR A;  4NRA A;  2D9E A;  3TLP A;  4QUT A;  5LKZ A;  5ENE A;  4BW1 A;  5J0D A;  5C7N A;  5HRW A;  5EIS A;  4UIW A;  5D7X A;  5II2 A;  4YYM A;  4F3I A;  2DVV A;  5FFV A;  5ENH A;  3NXB A;  2RNW A;  2RNY A;  2YW5 A;  4UIX A;  5EI4 A;  4QBM A;  4XY8 A;  4NYW A;  5AMF A;  5FE9 A;  4N4G A;  5ACY A;  4IOR A;  3UVY A;  4PCI A;  5FE2 A;  5KO4 A;  3LJW A;  5FDZ A;  5CQ7 A;  2RO1 A;  3DWY A;  4LYW A;  4A9I A;  4A9F A;  4E96 A;  5I1Q A;  4QNS A;  4NUC A;  5EA1 A;  5EM3 A;  5KTW A;  4MEO A;  5DYX A;  3QZS A;  5JWM A;  3JVL A;  4MR4 A;  4MR5 A;  4YYH A;  3RCW A;  5C8G A;  4TS8 A;  4UYG A;  5F62 A;  3MUK A;  5CQ3 A;  4ALH A;  3MXF A;  2R0Y A;  4XUB A;  4A9H A;  2RNX A;  5CUD A;  5D3N A;  5D3H A;  5KU3 A;  5LVR A;  3IU6 A;  3MB3 A;  5E73 A;  4HXM A;  2R0S A;  5FE0 A;  5IGM A;  3U5O A;  4NR4 A;  5DFB A;  2DAT A;  4HBY A;  5F1L A;  3AQA A;  3U5K A;  5CUG A;  5E9M A;  4N4F A;  4X2I A;  4HXP A;  4QC3 A;  3P1F A;  4J3I A;  4QSU A;  4QSX A;  5D26 A;  4ALG A;  5E9L A;  4QEW A;  5D3J A;  5LJ2 A;  4NYV A;  2FSA A;  5HEL A;  2MJV B;  4YAX A;  4IR5 A;  4XYA A;  4ZC9 A;  5KTX A;  3ZYU A;  4QEU A;  4IOQ A;  4O7A A;  4J1P A;  4QYL A;  4Y03 A;  4LDF A;  4BJX A;  3P1D A;  2DKW A;  1WUM A;  5CGP A;  3ONI A;  2I8N A;  5I86 A;  3IU5 A;  5EV9 A;  5ENF A;  4QYD A;  4UIV A;  3Q2F A;  5CQ6 A;  5EWH A;  5A5P A;  4UIT A;  4BW2 A;  4CUU A;  4HBW A;  4NR9 A;  4QB3 A;  5DBM A;  3S91 A;  5HQ7 A;  4PTB A;  3MQM A;  1JSP B;  3LXJ A;  4QSW A;  5CRM A;  3JVK A;  5EP7 A;  4Z93 A;  1N72 A;  4TTE A;  4WHW A;  2L85 A;  3O35 A;  4NUD A;  4QSQ A;  4TQN A;  4OUF A;  5CQ5 A;  5CQT A;  5CQA A;  5FE8 A;  5H1T A;  2DVR A;  3GG3 A;  5DKH A;  5DY7 A;  4QSP A;  5CS8 A;  4CUT A;  5FH7 A;  4QC1 A;  4O75 A;  5I40 A;  5FFW A;  5FG5 A;  4TZ2 A;  5A83 A;  3HME A;  5IGL A;  4TT6 A;  5HRV A;  5I88 A;  5G4S A;  3QZT A;  4CUP A;  5LKU A;  3UVW A;  4A9M A;  4A9E A;  5HM0 A;  3U5N A;  4J0S A;  5COI A;  5HJC A;  5DX4 A;  5E74 A;  5FBX A;  5KHM A;  3JVJ A;  5HEM A;  4CLB A;  4YYN A;  5A7C A;  2GRC A;  4CL9 A;  4NYX A;  5BT4 A;  2DVQ A;  4QUU A;  5HQ6 A;  5FE1 A;  5L98 A;  5D3R A;  3LQI A;  4MR3 A;  4YBM A;  3FKM X;  5LVQ A;  2I7K A;  2YEM A;  2L84 A;  4O7E A;  4TU6 A;  5DYA A;  4Z1Q A;  2H60 A;  4UYF B;  5E7D A;  2NXB A;  4A9N A;  4HBV A;  5FH6 A;  5IG6 A;  4LYI A;  2RS9 B;  4ZQL A;  5D3L A;  5A81 A;  5EK9 A;  5IID A;  2OO1 A;  4UIZ A;  4A9J A;  5ENG A;  5C89 A;  3JVM A;  3UV2 A;  4KV4 A;  5DLX A;  4O78 A;  5ETB A;  4Z6H A;  5ENB A;  4Z1S A;  3Q2E A;  4N3W A;  4NR6 A;  4QY4 A;  3O33 A;  4Q0N A;  5H85 A;  4CUR A;  4IR4 A;  5IGN A; 
#chains in the Genus database with same CATH topology
 3DAI A;  2KTB B;  4ZW1 A;  2F6N A;  4C67 A;  4IOO A;  4MR6 A;  4Q0O A;  3VKG A;  4N4H A;  3HMF A;  4YYD A;  5AD3 A;  5BT5 A;  5HCL A;  3G0L A;  3U5P A;  3D7C A;  4YBT A;  5FFY A;  5E9K A;  5EGU A;  2OUO A;  4HBX A;  4HXN A;  4NUE A;  5G4R A;  5I7X A;  4CFK A;  5CUA A;  4HXS A;  5IGK A;  4C66 A;  4HXR A;  4QSS A;  4AKG A;  4MEP A;  5A5N A;  4NXJ A;  3I3J A;  4UYD A;  4UYF A;  5F5Z A;  4QSV A;  3O37 A;  2YYN A;  4O7B A;  5I83 A;  2RFJ A;  5L8U A;  4PY6 A;  5DFD A;  5I80 A;  5DYU A;  3SVF A;  5A5O A;  4YYK A;  4LRG A;  5E3D A;  3P1E A;  3QZV A;  4KV1 A;  5CUC A;  5EPR A;  4BW3 A;  4YY4 A;  3AAD A;  4MEN A;  5F25 A;  5F63 A;  5EWC A;  3UVD A;  3U5J A;  3MB4 A;  3HMH A;  5HRX A;  3K2J A;  5F1H A;  5FB0 A;  3UV4 A;  5D3S A;  5E9I A;  4CUS A;  5LKX A;  5KTU A;  4O71 A;  5DKC A;  4NR8 A;  4QST A;  4A9K A;  4A9L A;  4RVR A;  4O72 A;  5E3G A;  4HXL A;  3U5M A;  5I7Y A;  4LYS A;  4NQN A;  4UIY A;  1ZS5 A;  2E3K A;  5F2P A;  5D3P A;  5I89 A;  4BHW A;  4PKL A;  4PS5 A;  5DYC A;  4CFL A;  5HFQ A;  5A5S A;  1E6I A;  2G4A A;  5CQ8 A;  4WHU A;  4OGI A;  4O77 A;  4O7C A;  5EIC A;  5TB6 A;  3LQJ A;  2YQD A;  5F61 A;  5D0C A;  3G0J A;  4HXO A;  4AKN A;  5ENC A;  4Z6I A;  5CRZ A;  4J0R A;  4NR5 A;  5A5Q A;  2F6J A;  4LZS A;  4N4I A;  5CZG A;  5E9Y A;  5DW1 A;  4QEV A;  4QR5 A;  1X0J A;  4HXK A;  5CUB A;  5FE6 A;  5LUU A;  4YAT A;  5EWV A;  5L99 A;  2D82 A;  4QR4 A;  3LQH A;  5L97 A;  5E0R A;  2L5E A;  2YEK A;  5LJ1 A;  4UYH A;  5EU1 A;  4YYJ A;  5DFC A;  5F3A A;  4TT4 A;  1EQF A;  4LC2 A;  4YK0 A;  5FB1 A;  2DWW A;  5CY9 A;  5A5R A;  2RI7 A;  4O70 A;  5LJ0 A;  4NQM A;  5AD2 A;  5FE7 A;  4YY6 A;  4BW4 A;  2DVS A;  5L96 A;  5JI8 A;  4YYG A;  4UIU A;  4QR3 A;  4OGJ A;  4O76 A;  2R10 A;  2N9G A;  5II1 A;  3S92 A;  5IBN A;  3ERR A;  5C4Q A;  3VKH A;  5H1V A;  5ENJ A;  4LR6 A;  5F36 A;  5HEN A;  3UW9 A;  4XUA A;  5CP5 A;  5ETD A;  4TT2 A;  5FE3 A;  5DW2 A;  4NRB A;  5EVA A;  5EPB A;  4PCE A;  5CUE A;  4NS5 A;  5CU8 A;  3SVG A;  4TYL A;  5E9V A;  4XY9 A;  5F60 A;  5BT3 A;  5FE4 A;  4O7F A;  5CPE A;  4LZR A;  5H1U A;  5L8T A;  1F68 A;  1WUG A;  2WP1 A;  5D24 A;  5CFW A;  2E7O A;  5TCM A;  5A82 A;  5ENI A;  5C87 A;  5EQ1 A;  5FG6 A;  4WIV A;  5EWW A;  4YAB A;  2WP2 A;  3O36 A;  3P1C A;  4GPJ A;  2OSS A;  3U5L A;  4CUQ A;  5EPS A;  5FH8 A;  5K29 A;  3UVX A;  5HLS A;  4NR7 A;  5D25 A;  4A9O A;  4IR3 A;  4MEQ A;  3O34 A;  4FLP A;  2YEL A;  4YBS A;  4KCX A;  4NRC A;  4YYI A;  4LZ2 A;  4YH3 A;  4DON A;  5LKT A;  2LSP B;  4YH4 A;  1JM4 B;  4TZ8 A;  3SVH A;  5FG4 A;  5DKD A;  5CQ4 A;  5I29 A;  5D3T A;  4YAD A;  3MUL A;  2YDW A;  4UYE A;  5AME A;  5C85 A;  3UV5 A;  4IR6 A;  4O74 A;  5EWD A;  4QSR A;  5DLZ A;  5FE5 A;  2E7N A;  5HQ5 A;  4YC9 A;  3P5O A;  4QZS A;  5CTL A;  5A85 A;  4TU4 A;  2R0V A;  5HFR A;  4NRA A;  2D9E A;  3TLP A;  4QUT A;  5LKZ A;  5ENE A;  4BW1 A;  5J0D A;  3D1D A;  5C7N A;  5HRW A;  5EIS A;  4UIW A;  5D7X A;  5II2 A;  4YYM A;  4F3I A;  2DVV A;  5FFV A;  5ENH A;  3NXB A;  2RNW A;  2RNY A;  2YW5 A;  4UIX A;  5EI4 A;  4QBM A;  4XY8 A;  4NYW A;  5AMF A;  5FE9 A;  4N4G A;  5ACY A;  4IOR A;  3UVY A;  4PCI A;  5FE2 A;  5KO4 A;  3LJW A;  5FDZ A;  5CQ7 A;  2RO1 A;  3DWY A;  1ZKR A;  4LYW A;  4A9I A;  4A9F A;  4E96 A;  5I1Q A;  4QNS A;  4NUC A;  5EA1 A;  5EM3 A;  5KTW A;  4MEO A;  5DYX A;  3QZS A;  5JWM A;  3JVL A;  4MR4 A;  4MR5 A;  4YYH A;  3RCW A;  5C8G A;  4TS8 A;  4UYG A;  5F62 A;  3MUK A;  5CQ3 A;  4ALH A;  3MXF A;  2R0Y A;  4XUB A;  4A9H A;  2RNX A;  5CUD A;  5D3N A;  5D3H A;  5KU3 A;  5LVR A;  3IU6 A;  3MB3 A;  5E73 A;  4HXM A;  2R0S A;  5FE0 A;  5IGM A;  3U5O A;  4NR4 A;  5DFB A;  2DAT A;  4HBY A;  5F1L A;  3AQA A;  3U5K A;  5CUG A;  5E9M A;  4N4F A;  4X2I A;  4HXP A;  4QC3 A;  3P1F A;  4J3I A;  4QSU A;  4QSX A;  5D26 A;  4ALG A;  5E9L A;  4QEW A;  5D3J A;  5LJ2 A;  4NYV A;  4AKI A;  2FSA A;  5HEL A;  2MJV B;  4YAX A;  4IR5 A;  4XYA A;  4ZC9 A;  5KTX A;  3ZYU A;  4QEU A;  4IOQ A;  4O7A A;  4J1P A;  4QYL A;  4Y03 A;  2EJN A;  4LDF A;  4BJX A;  3P1D A;  2DKW A;  1WUM A;  5CGP A;  3ONI A;  2I8N A;  5I86 A;  3IU5 A;  5EV9 A;  5ENF A;  4QYD A;  4UIV A;  3Q2F A;  5CQ6 A;  5EWH A;  5A5P A;  4UIT A;  4BW2 A;  4CUU A;  4HBW A;  4NR9 A;  4QB3 A;  5DBM A;  3S91 A;  5HQ7 A;  4PTB A;  3MQM A;  1JSP B;  3LXJ A;  4QSW A;  5CRM A;  3JVK A;  5EP7 A;  4Z93 A;  1N72 A;  4TTE A;  4WHW A;  2L85 A;  3O35 A;  4NUD A;  4QSQ A;  4TQN A;  4OUF A;  5CQ5 A;  5CQT A;  5CQA A;  5FE8 A;  5H1T A;  2DVR A;  3GG3 A;  5DKH A;  5DY7 A;  4QSP A;  5CS8 A;  4CUT A;  5FH7 A;  4QC1 A;  4O75 A;  5I40 A;  5FFW A;  5FG5 A;  4TZ2 A;  5A83 A;  3HME A;  4AKH A;  5IGL A;  4TT6 A;  5HRV A;  5I88 A;  5G4S A;  3QZT A;  4CUP A;  5LKU A;  4AI6 A;  3UVW A;  4A9M A;  4A9E A;  5HM0 A;  3U5N A;  4J0S A;  5COI A;  5HJC A;  5DX4 A;  5E74 A;  5FBX A;  5KHM A;  3JVJ A;  5HEM A;  4CLB A;  4YYN A;  5A7C A;  2GRC A;  4CL9 A;  4NYX A;  5BT4 A;  2DVQ A;  4QUU A;  5HQ6 A;  5FE1 A;  5L98 A;  5D3R A;  3LQI A;  4MR3 A;  4YBM A;  3FKM X;  5LVQ A;  2I7K A;  2YEM A;  2L84 A;  4O7E A;  4TU6 A;  5DYA A;  4Z1Q A;  2H60 A;  4UYF B;  3D1B A;  5E7D A;  2NXB A;  4A9N A;  4HBV A;  5FH6 A;  5IG6 A;  4LYI A;  2RS9 B;  4ZQL A;  5D3L A;  5A81 A;  5EK9 A;  5IID A;  2OO1 A;  1PUO A;  4UIZ A;  4A9J A;  5ENG A;  5C89 A;  3JVM A;  3UV2 A;  4KV4 A;  5DLX A;  4O78 A;  5ETB A;  4Z6H A;  5ENB A;  4Z1S A;  3Q2E A;  4N3W A;  4NR6 A;  4QY4 A;  3O33 A;  4Q0N A;  5H85 A;  4CUR A;  4IR4 A;  5IGN A; 
#chains in the Genus database with same CATH homology
 3DAI A;  2KTB B;  4ZW1 A;  2F6N A;  4C67 A;  4IOO A;  4MR6 A;  4Q0O A;  4N4H A;  3HMF A;  4YYD A;  5AD3 A;  5BT5 A;  5HCL A;  3G0L A;  3U5P A;  3D7C A;  4YBT A;  5FFY A;  5E9K A;  5EGU A;  2OUO A;  4HBX A;  4HXN A;  4NUE A;  5G4R A;  5I7X A;  4CFK A;  5CUA A;  4HXS A;  5IGK A;  4C66 A;  4HXR A;  4QSS A;  4MEP A;  5A5N A;  4NXJ A;  3I3J A;  4UYD A;  4UYF A;  5F5Z A;  4QSV A;  3O37 A;  2YYN A;  4O7B A;  5I83 A;  2RFJ A;  5L8U A;  4PY6 A;  5DFD A;  5I80 A;  5DYU A;  3SVF A;  5A5O A;  4YYK A;  4LRG A;  5E3D A;  3P1E A;  3QZV A;  4KV1 A;  5CUC A;  5EPR A;  4BW3 A;  4YY4 A;  3AAD A;  4MEN A;  5F25 A;  5F63 A;  5EWC A;  3UVD A;  3U5J A;  3MB4 A;  3HMH A;  5HRX A;  3K2J A;  5F1H A;  5FB0 A;  3UV4 A;  5D3S A;  5E9I A;  4CUS A;  5LKX A;  5KTU A;  4O71 A;  5DKC A;  4NR8 A;  4QST A;  4A9K A;  4A9L A;  4RVR A;  4O72 A;  5E3G A;  4HXL A;  3U5M A;  5I7Y A;  4LYS A;  4NQN A;  4UIY A;  1ZS5 A;  2E3K A;  5F2P A;  5D3P A;  5I89 A;  4BHW A;  4PKL A;  4PS5 A;  5DYC A;  4CFL A;  5HFQ A;  5A5S A;  1E6I A;  2G4A A;  5CQ8 A;  4WHU A;  4OGI A;  4O77 A;  4O7C A;  5EIC A;  5TB6 A;  3LQJ A;  2YQD A;  5F61 A;  5D0C A;  3G0J A;  4HXO A;  4AKN A;  5ENC A;  4Z6I A;  5CRZ A;  4J0R A;  4NR5 A;  5A5Q A;  2F6J A;  4LZS A;  4N4I A;  5CZG A;  5E9Y A;  5DW1 A;  4QEV A;  4QR5 A;  1X0J A;  4HXK A;  5CUB A;  5FE6 A;  5LUU A;  4YAT A;  5EWV A;  5L99 A;  2D82 A;  4QR4 A;  3LQH A;  5L97 A;  5E0R A;  2L5E A;  2YEK A;  5LJ1 A;  4UYH A;  5EU1 A;  4YYJ A;  5DFC A;  5F3A A;  4TT4 A;  1EQF A;  4LC2 A;  4YK0 A;  5FB1 A;  2DWW A;  5CY9 A;  5A5R A;  2RI7 A;  4O70 A;  5LJ0 A;  4NQM A;  5AD2 A;  5FE7 A;  4YY6 A;  4BW4 A;  2DVS A;  5L96 A;  5JI8 A;  4YYG A;  4UIU A;  4QR3 A;  4OGJ A;  4O76 A;  2R10 A;  2N9G A;  5II1 A;  3S92 A;  5IBN A;  5C4Q A;  5H1V A;  5ENJ A;  4LR6 A;  5F36 A;  5HEN A;  3UW9 A;  4XUA A;  5CP5 A;  5ETD A;  4TT2 A;  5FE3 A;  5DW2 A;  4NRB A;  5EVA A;  5EPB A;  4PCE A;  5CUE A;  4NS5 A;  5CU8 A;  3SVG A;  4TYL A;  5E9V A;  4XY9 A;  5F60 A;  5BT3 A;  5FE4 A;  4O7F A;  5CPE A;  4LZR A;  5H1U A;  5L8T A;  1F68 A;  1WUG A;  2WP1 A;  5D24 A;  5CFW A;  2E7O A;  5TCM A;  5A82 A;  5ENI A;  5C87 A;  5EQ1 A;  5FG6 A;  4WIV A;  5EWW A;  4YAB A;  2WP2 A;  3O36 A;  3P1C A;  4GPJ A;  2OSS A;  3U5L A;  4CUQ A;  5EPS A;  5FH8 A;  5K29 A;  3UVX A;  5HLS A;  4NR7 A;  5D25 A;  4A9O A;  4IR3 A;  4MEQ A;  3O34 A;  4FLP A;  2YEL A;  4YBS A;  4KCX A;  4NRC A;  4YYI A;  4LZ2 A;  4YH3 A;  4DON A;  5LKT A;  2LSP B;  4YH4 A;  1JM4 B;  4TZ8 A;  3SVH A;  5FG4 A;  5DKD A;  5CQ4 A;  5I29 A;  5D3T A;  4YAD A;  3MUL A;  2YDW A;  4UYE A;  5AME A;  5C85 A;  3UV5 A;  4IR6 A;  4O74 A;  5EWD A;  4QSR A;  5DLZ A;  5FE5 A;  2E7N A;  5HQ5 A;  4YC9 A;  3P5O A;  4QZS A;  5CTL A;  5A85 A;  4TU4 A;  2R0V A;  5HFR A;  4NRA A;  2D9E A;  3TLP A;  4QUT A;  5LKZ A;  5ENE A;  4BW1 A;  5J0D A;  5C7N A;  5HRW A;  5EIS A;  4UIW A;  5D7X A;  5II2 A;  4YYM A;  4F3I A;  2DVV A;  5FFV A;  5ENH A;  3NXB A;  2RNW A;  2RNY A;  2YW5 A;  4UIX A;  5EI4 A;  4QBM A;  4XY8 A;  4NYW A;  5AMF A;  5FE9 A;  4N4G A;  5ACY A;  4IOR A;  3UVY A;  4PCI A;  5FE2 A;  5KO4 A;  3LJW A;  5FDZ A;  5CQ7 A;  2RO1 A;  3DWY A;  4LYW A;  4A9I A;  4A9F A;  4E96 A;  5I1Q A;  4QNS A;  4NUC A;  5EA1 A;  5EM3 A;  5KTW A;  4MEO A;  5DYX A;  3QZS A;  5JWM A;  3JVL A;  4MR4 A;  4MR5 A;  4YYH A;  3RCW A;  5C8G A;  4TS8 A;  4UYG A;  5F62 A;  3MUK A;  5CQ3 A;  4ALH A;  3MXF A;  2R0Y A;  4XUB A;  4A9H A;  2RNX A;  5CUD A;  5D3N A;  5D3H A;  5KU3 A;  5LVR A;  3IU6 A;  3MB3 A;  5E73 A;  4HXM A;  2R0S A;  5FE0 A;  5IGM A;  3U5O A;  4NR4 A;  5DFB A;  2DAT A;  4HBY A;  5F1L A;  3AQA A;  3U5K A;  5CUG A;  5E9M A;  4N4F A;  4X2I A;  4HXP A;  4QC3 A;  3P1F A;  4J3I A;  4QSU A;  4QSX A;  5D26 A;  4ALG A;  5E9L A;  4QEW A;  5D3J A;  5LJ2 A;  4NYV A;  2FSA A;  5HEL A;  2MJV B;  4YAX A;  4IR5 A;  4XYA A;  4ZC9 A;  5KTX A;  3ZYU A;  4QEU A;  4IOQ A;  4O7A A;  4J1P A;  4QYL A;  4Y03 A;  4LDF A;  4BJX A;  3P1D A;  2DKW A;  1WUM A;  5CGP A;  3ONI A;  2I8N A;  5I86 A;  3IU5 A;  5EV9 A;  5ENF A;  4QYD A;  4UIV A;  3Q2F A;  5CQ6 A;  5EWH A;  5A5P A;  4UIT A;  4BW2 A;  4CUU A;  4HBW A;  4NR9 A;  4QB3 A;  5DBM A;  3S91 A;  5HQ7 A;  4PTB A;  3MQM A;  1JSP B;  3LXJ A;  4QSW A;  5CRM A;  3JVK A;  5EP7 A;  4Z93 A;  1N72 A;  4TTE A;  4WHW A;  2L85 A;  3O35 A;  4NUD A;  4QSQ A;  4TQN A;  4OUF A;  5CQ5 A;  5CQT A;  5CQA A;  5FE8 A;  5H1T A;  2DVR A;  3GG3 A;  5DKH A;  5DY7 A;  4QSP A;  5CS8 A;  4CUT A;  5FH7 A;  4QC1 A;  4O75 A;  5I40 A;  5FFW A;  5FG5 A;  4TZ2 A;  5A83 A;  3HME A;  5IGL A;  4TT6 A;  5HRV A;  5I88 A;  5G4S A;  3QZT A;  4CUP A;  5LKU A;  3UVW A;  4A9M A;  4A9E A;  5HM0 A;  3U5N A;  4J0S A;  5COI A;  5HJC A;  5DX4 A;  5E74 A;  5FBX A;  5KHM A;  3JVJ A;  5HEM A;  4CLB A;  4YYN A;  5A7C A;  2GRC A;  4CL9 A;  4NYX A;  5BT4 A;  2DVQ A;  4QUU A;  5HQ6 A;  5FE1 A;  5L98 A;  5D3R A;  3LQI A;  4MR3 A;  4YBM A;  3FKM X;  5LVQ A;  2I7K A;  2YEM A;  2L84 A;  4O7E A;  4TU6 A;  5DYA A;  4Z1Q A;  2H60 A;  4UYF B;  5E7D A;  2NXB A;  4A9N A;  4HBV A;  5FH6 A;  5IG6 A;  4LYI A;  2RS9 B;  4ZQL A;  5D3L A;  5A81 A;  5EK9 A;  5IID A;  2OO1 A;  4UIZ A;  4A9J A;  5ENG A;  5C89 A;  3JVM A;  3UV2 A;  4KV4 A;  5DLX A;  4O78 A;  5ETB A;  4Z6H A;  5ENB A;  4Z1S A;  3Q2E A;  4N3W A;  4NR6 A;  4QY4 A;  3O33 A;  4Q0N A;  5H85 A;  4CUR A;  4IR4 A;  5IGN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...