5JI8A

Crystal structure of the brd9 bromodomain and hit 1
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
100
structure length
100
Chain Sequence
TPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDFGTMKDKIVANEYKSVTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bromodomain-containing protein 9
publication title NMR Fragment Screening Hit Induces Plasticity of BRD7/9 Bromodomains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 35
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2016-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5ji8A00
5EV9A 3I3JA 5FE8A 5ETDA 4PS5A 4ZQLA 3LQIA 3O35A 4CL9A 3LQJA 3MULA 5L96A 4A9JA 4YBSA 4YYGA 4A9NA 3UV4A 5G4SA 4QY4A 4A9KA 4UYHA 4DONA 5C85A 4QSRA 5G4RA 4OUFA 3U5NA 2L85A 3D7CA 3HMFA 5EPBA 5EWDA 5A7CA 5FE2A 4UYFB 5F63A 4PTBA 5D24A 5E0RA 5FH7A 4ALHA 2E7NA 5E73A 5A5PA 3DWYA 5E3DA 2RFJA 4LDFA 4XYAA 3O36A 5EWVA 3P1EA 4IR4A 4O77A 3JVKA 4UIXA 5DYUA 5EM3A 5D0CA 4A9EA 5D3PA 5E9IA 5CY9A 2G4AA 4UIYA 5LKUA 3MUKA 2OO1A 3UW9A 4HXKA 5EPSA 4Z93A 5ENEA 5FE0A 5A85A 5C87A 2RS9B 5BT5A 4NYXA 5CGPA 4TU4A 4BW4A 4IR5A 4TT2A 3UVWA 5HM0A 3JVLA 5EWHA 5CQTA 3JVJA 5ENFA 2YYNA 3Q2EA 5E9LA 2D9EA 5L97A 2FSAA 4TT6A 5ETBA 2L5EA 4LR6A 5FB0A 4KV4A 4YYDA 4QNSA 5DBMA 5I89A 5I86A 5CRMA 4MEQA 4AKNA 5EPRA 4CUQA 4Z6HA 5CUDA 4CFKA 4OGIA 5C4QA 5HRVA 5EWCA 4MR3A 4QB3A 2YEKA 4QUTA 5TB6A 4HBYA 4NS5A 5CUAA 5ENBA 4PCEA 4QSPA 4A9HA 4BW3A 4LYSA 1EQFA 4UIZA 5HQ7A 4ZC9A 4X2IA 2D82A 5LVRA 4QR5A 3MXFA 4YC9A 5A5QA 3UVXA 4O76A 4RVRA 5A81A 4NXJA 5E9YA 2I7KA 4LYIA 5DLXA 3LXJA 4YYKA 5L8TA 4XUBA 5LVQA 3RCWA 5FB1A 4O74A 4N3WA 5CS8A 4A9FA 3TLPA 2F6NA 2DVQA 5ENGA 5H85A 5FE1A 5II1A 1WUMA 4O7FA 4UIWA 4YK0A 4QUUA 5EQ1A 4N4FA 3JVMA 4HXPA 5A82A 4MEPA 5DKHA 5CTLA 5F1HA 4PY6A 4YYMA 5F36A 5DW1A 4NQNA 3QZVA 5KTXA 4NRCA 4HBVA 5I40A 3UVDA 2DVRA 4NUDA 5HEMA 5ACYA 5C7NA 5A5NA 4O7AA 5F3AA 2YQDA 5DFDA 5FE3A 1JM4B 1JSPB 2RNYA 5I7YA 4QEWA 5DYCA 5BT4A 4NR9A 4C67A 5L99A 4A9MA 4QBMA 5CQ3A 3HMHA 5LUUA 4LZRA 2GRCA 5CFWA 5AMFA 4QSUA 5DY7A 5LJ2A 5IBNA 4IR3A 4UIUA 4WHUA 3P5OA 4XY8A 5LKTA 4HXRA 2E3KA 3G0JA 5FFYA 5FDZA 3DAIA 4NR6A 4YH4A 5D3JA 2I8NA 4TZ2A 5DFBA 5DKCA 3UV5A 5FE9A 4YBTA 5I29A 5FBXA 3O37A 4LZ2A 4QSSA 4FLPA 2NXBA 4NRBA 5H1TA 4TYLA 5FG4A 5EWWA 3HMEA 4O71A 4O70A 4O7EA 4YY6A 4NR7A 4N4IA 4O7BA 2RNXA 5TCMA 2DKWA 5C89A 5II2A 5I88A 5F5ZA 3QZTA 5CP5A 5HENA 4F3IA 5IGNA 3LQHA 5CPEA 5DLZA 5AD2A 4O72A 5BT3A 2R0VA 5I7XA 2YEMA 5FG6A 4TQNA 5D3SA 5A5RA 4J0RA 4QR4A 5F2PA 1E6IA 2DWWA 5JWMA 4LZSA 4YATA 5HFQA 5J0DA 3FKMX 4ALGA 4NR8A 5HELA 2DATA 3SVGA 4MR5A 1WUGA 3U5OA 4YYIA 4YADA 5EK9A 4QC3A 4MR4A 5IGKA 5KU3A 2RI7A 4BW2A 3AADA 5FG5A 3SVFA 5A83A 5LKZA 5E9VA 5FH6A 4HXNA 5DW2A 4HXMA 5CUBA 5HFRA 4A9IA 4UYFA 5EU1A 5D3HA 4OGJA 5CQ8A 5H1UA 5IG6A 5CQ7A 2LSPB 5L8UA 4ZW1A 4J0SA 4QSQA 2N9GA 1ZS5A 2L84A 3Q2FA 5EVAA 4NR5A 4BHWA 5EI4A 2E7OA 3ZYUA 2R0YA 4YH3A 3U5LA 4UYGA 2YW5A 5HQ5A 5K29A 5HJCA 3U5PA 3ONIA 5HLSA 5EA1A 5IGLA 4TU6A 2H60A 2OUOA 5DKDA 2R10A 5KTUA 4TZ8A 4YYNA 5D3LA 5HCLA 5FFVA 4CFLA 5FFWA 4YY4A 5COIA 3LJWA 4XUAA 4PCIA 4UIVA 3MQMA 2F6JA 2RO1A 5EP7A 4Z1QA 5FE7A 5KHMA 4QSWA 5C8GA 4YYJA 4QYDA 5F25A 5F60A 3O33A 3IU5A 4HBWA 5E3GA 4CUUA 4TS8A 5EGUA 4J1PA 4KCXA 5IGMA 5KTWA 5DYXA 1X0JA 5D7XA 4LC2A 4A9OA 4WIVA 4Q0OA 5AMEA 4IORA 4E96A 4YAXA 4UITA 5CRZA 5CQ4A 5KO4A 4NYVA 5FE6A 4NR4A 5D25A 5E7DA 4CUTA 5FE5A 4NUCA 4QSXA 4UYEA 4TTEA 4NYWA 3U5JA 4QR3A 4QEVA 5D3NA 3P1DA 3S91A 4PKLA 3U5MA 2YELA 2MJVB 5H1VA 5ENIA 4LYWA 4UYDA 5CUEA 4N4HA 3SVHA 2DVSA 4MENA 4WHWA 3QZSA 4Z6IA 5CUGA 3O34A 4KV1A 5CQ5A 4IOQA 5DX4A 5DFCA 3GG3A 5A5OA 3P1FA 5DYAA 3MB4A 4J3IA 4NRAA 4NUEA 5F62A 5JI8A 4QSTA 4QZSA 2OSSA 5D3TA 5D3RA 5LKXA 5F1LA 4TT4A 2R0SA 5FE4A 4O75A 3G0LA 4XY9A 3S92A 4YBMA 5AD3A 3K2JA 5CU8A 4BJXA 5E9MA 5ENHA 5FH8A 5EICA 4HXOA 5HQ6A 5E74A 4CUSA 5LJ0A 4GPJA 3U5KA 4BW1A 5CUCA 4YYHA 3MB3A 4IR6A 4O78A 5E9KA 2WP2A 2YDWA 4MEOA 4QC1A 4MR6A 5IIDA 5D26A 5ENJA 4Z1SA 5A5SA 5CQ6A 4QEUA 5I80A 5LJ1A 4Q0NA 4C66A 4HBXA 3AQAA 5HRXA 3P1CA 5CZGA 4N4GA 5CQAA 4CURA 2KTBB 4HXLA 3NXBA 4A9LA 4QSVA 3UV2A 5EISA 3IU6A 5I1QA 2DVVA 4HXSA 5L98A 4CLBA 4NQMA 5ENCA 3UVYA 4Y03A 4CUPA 5F61A 4QYLA 1F68A 4LRGA 4YABA 5I83A 5HRWA 4O7CA 4IOOA 1N72A 2RNWA 2WP1A
chains in the Genus database with same CATH superfamily
5EV9A 3I3JA 5FE8A 5ETDA 4PS5A 4ZQLA 3LQIA 3O35A 4CL9A 3LQJA 3MULA 5L96A 4A9JA 4YBSA 4YYGA 4A9NA 3UV4A 5G4SA 4QY4A 4A9KA 4UYHA 4DONA 5C85A 4QSRA 5G4RA 4OUFA 3U5NA 2L85A 3D7CA 3HMFA 5EPBA 5EWDA 5A7CA 5FE2A 4UYFB 5F63A 4PTBA 5D24A 5E0RA 5FH7A 4ALHA 2E7NA 5E73A 5A5PA 3DWYA 5E3DA 2RFJA 4LDFA 4XYAA 3O36A 5EWVA 3P1EA 4IR4A 4O77A 3JVKA 4UIXA 5DYUA 5EM3A 5D0CA 4A9EA 5D3PA 5E9IA 5CY9A 2G4AA 4UIYA 5LKUA 3MUKA 2OO1A 3UW9A 4HXKA 5EPSA 4Z93A 5ENEA 5FE0A 5A85A 5C87A 2RS9B 5BT5A 4NYXA 5CGPA 4TU4A 4BW4A 4IR5A 4TT2A 3UVWA 5HM0A 3JVLA 5EWHA 5CQTA 3JVJA 5ENFA 2YYNA 3Q2EA 5E9LA 2D9EA 5L97A 2FSAA 4TT6A 5ETBA 2L5EA 4LR6A 5FB0A 4KV4A 4YYDA 4QNSA 5DBMA 5I89A 5I86A 5CRMA 4MEQA 4AKNA 5EPRA 4CUQA 4Z6HA 5CUDA 4CFKA 4OGIA 5C4QA 5HRVA 5EWCA 4MR3A 4QB3A 2YEKA 4QUTA 5TB6A 4HBYA 4NS5A 5CUAA 5ENBA 4PCEA 4QSPA 4A9HA 4BW3A 4LYSA 1EQFA 4UIZA 5HQ7A 4ZC9A 4X2IA 2D82A 5LVRA 4QR5A 3MXFA 4YC9A 5A5QA 3UVXA 4O76A 4RVRA 5A81A 4NXJA 5E9YA 2I7KA 4LYIA 5DLXA 3LXJA 4YYKA 5L8TA 4XUBA 5LVQA 3RCWA 5FB1A 4O74A 4N3WA 5CS8A 4A9FA 3TLPA 2F6NA 2DVQA 5ENGA 5H85A 5FE1A 5II1A 1WUMA 4O7FA 4UIWA 4YK0A 4QUUA 5EQ1A 4N4FA 3JVMA 4HXPA 5A82A 4MEPA 5DKHA 5CTLA 5F1HA 4PY6A 4YYMA 5F36A 5DW1A 4NQNA 3QZVA 5KTXA 4NRCA 4HBVA 5I40A 3UVDA 2DVRA 4NUDA 5HEMA 5ACYA 5C7NA 5A5NA 4O7AA 5F3AA 2YQDA 5DFDA 5FE3A 1JM4B 1JSPB 2RNYA 5I7YA 4QEWA 5DYCA 5BT4A 4NR9A 4C67A 5L99A 4A9MA 4QBMA 5CQ3A 3HMHA 5LUUA 4LZRA 2GRCA 5CFWA 5AMFA 4QSUA 5DY7A 5LJ2A 5IBNA 4IR3A 4UIUA 4WHUA 3P5OA 4XY8A 5LKTA 4HXRA 2E3KA 3G0JA 5FFYA 5FDZA 1ZKRA 3DAIA 4NR6A 4YH4A 5D3JA 2I8NA 4TZ2A 5DFBA 5DKCA 3UV5A 5FE9A 4YBTA 5I29A 5FBXA 3O37A 4LZ2A 4QSSA 4FLPA 2NXBA 4NRBA 3VKHA 5H1TA 4TYLA 5FG4A 5EWWA 3HMEA 4O71A 4O70A 4O7EA 4YY6A 4NR7A 4N4IA 4O7BA 3VKGA 2RNXA 5TCMA 2DKWA 5C89A 5II2A 5I88A 5F5ZA 3QZTA 5CP5A 5HENA 4F3IA 5IGNA 3LQHA 5CPEA 5DLZA 5AD2A 4O72A 5BT3A 2R0VA 5I7XA 2YEMA 5FG6A 4TQNA 5D3SA 5A5RA 4J0RA 4QR4A 5F2PA 1E6IA 2DWWA 5JWMA 4LZSA 4YATA 5HFQA 5J0DA 3FKMX 4ALGA 4NR8A 5HELA 2DATA 3SVGA 4MR5A 1WUGA 3U5OA 4YYIA 4YADA 5EK9A 4QC3A 4MR4A 5IGKA 5KU3A 3ERRA 2RI7A 4BW2A 3AADA 5FG5A 3SVFA 5A83A 5LKZA 5E9VA 5FH6A 4HXNA 5DW2A 4HXMA 5CUBA 5HFRA 4A9IA 4UYFA 5EU1A 5D3HA 4OGJA 5CQ8A 5H1UA 5IG6A 5CQ7A 2LSPB 5L8UA 4ZW1A 4J0SA 4QSQA 4AKGA 3D1BA 2N9GA 1ZS5A 2L84A 3Q2FA 5EVAA 4NR5A 4BHWA 5EI4A 2E7OA 3ZYUA 2R0YA 4YH3A 3U5LA 4UYGA 2YW5A 5HQ5A 5K29A 5HJCA 3U5PA 3ONIA 5HLSA 5EA1A 5IGLA 4TU6A 2H60A 2OUOA 5DKDA 2R10A 5KTUA 4TZ8A 4YYNA 5D3LA 5HCLA 5FFVA 4CFLA 5FFWA 4YY4A 5COIA 3LJWA 4XUAA 4PCIA 4UIVA 3MQMA 2F6JA 2RO1A 5EP7A 4Z1QA 4AKHA 5FE7A 5KHMA 4QSWA 5C8GA 4YYJA 4QYDA 5F25A 5F60A 3O33A 3IU5A 4HBWA 5E3GA 4CUUA 4TS8A 5EGUA 4J1PA 4KCXA 5IGMA 5KTWA 5DYXA 1X0JA 4LC2A 5D7XA 4A9OA 4AKIA 4WIVA 4Q0OA 5AMEA 4IORA 4E96A 4YAXA 4UITA 5CRZA 5CQ4A 5KO4A 4NYVA 5FE6A 4NR4A 5D25A 5E7DA 4CUTA 5FE5A 4NUCA 4QSXA 4UYEA 4TTEA 4NYWA 3U5JA 4QR3A 4QEVA 5D3NA 3P1DA 3S91A 4PKLA 3U5MA 2YELA 2MJVB 5H1VA 5ENIA 4LYWA 4UYDA 5CUEA 4N4HA 3SVHA 2DVSA 4MENA 4WHWA 3QZSA 4Z6IA 5CUGA 3O34A 4KV1A 5CQ5A 4IOQA 5DX4A 5DFCA 3GG3A 5A5OA 3P1FA 5DYAA 3MB4A 4J3IA 4NRAA 4NUEA 5F62A 5JI8A 4QSTA 4QZSA 2OSSA 5D3TA 5D3RA 5LKXA 5F1LA 4TT4A 1PUOA 2R0SA 3D1DA 5FE4A 4O75A 3G0LA 4XY9A 3S92A 4YBMA 5AD3A 3K2JA 5CU8A 4BJXA 5E9MA 5ENHA 5FH8A 5EICA 4HXOA 5HQ6A 4AI6A 5E74A 4CUSA 5LJ0A 4GPJA 3U5KA 4BW1A 2EJNA 5CUCA 4YYHA 3MB3A 4IR6A 4O78A 5E9KA 2WP2A 2YDWA 4MEOA 4QC1A 4MR6A 5IIDA 5D26A 5ENJA 4Z1SA 5A5SA 5CQ6A 4QEUA 5I80A 5LJ1A 4Q0NA 4C66A 4HBXA 3AQAA 5HRXA 3P1CA 5CZGA 4N4GA 5CQAA 4CURA 2KTBB 4HXLA 3NXBA 4A9LA 4QSVA 3UV2A 5EISA 3IU6A 5I1QA 2DVVA 4HXSA 5L98A 4CLBA 4NQMA 5ENCA 3UVYA 4Y03A 4CUPA 5F61A 4QYLA 1F68A 4LRGA 4YABA 5I83A 5HRWA 4O7CA 4IOOA 1N72A 2RNWA 2WP1A
chains in the Genus database with same CATH topology
5EV9A 3I3JA 5FE8A 5ETDA 4PS5A 4ZQLA 3LQIA 3O35A 4CL9A 3LQJA 3MULA 5L96A 4A9JA 4YBSA 4YYGA 4A9NA 3UV4A 5G4SA 4QY4A 4A9KA 4UYHA 4DONA 5C85A 4QSRA 5G4RA 4OUFA 3U5NA 2L85A 3D7CA 3HMFA 5EPBA 5EWDA 5A7CA 5FE2A 4UYFB 5F63A 4PTBA 5D24A 5E0RA 5FH7A 4ALHA 2E7NA 5E73A 5A5PA 3DWYA 5E3DA 2RFJA 4LDFA 4XYAA 3O36A 5EWVA 3P1EA 4IR4A 4O77A 3JVKA 4UIXA 5DYUA 5EM3A 5D0CA 4A9EA 5D3PA 5E9IA 5CY9A 2G4AA 4UIYA 5LKUA 3MUKA 2OO1A 3UW9A 4HXKA 5EPSA 4Z93A 5ENEA 5FE0A 5A85A 5C87A 2RS9B 5BT5A 4NYXA 5CGPA 4TU4A 4BW4A 4IR5A 4TT2A 3UVWA 5HM0A 3JVLA 5EWHA 5CQTA 3JVJA 5ENFA 2YYNA 3Q2EA 5E9LA 2D9EA 5L97A 2FSAA 4TT6A 5ETBA 2L5EA 4LR6A 5FB0A 4KV4A 4YYDA 4QNSA 5DBMA 5I89A 5I86A 5CRMA 4MEQA 4AKNA 5EPRA 4CUQA 4Z6HA 5CUDA 4CFKA 4OGIA 5C4QA 5HRVA 5EWCA 4MR3A 4QB3A 2YEKA 4QUTA 5TB6A 4HBYA 4NS5A 5CUAA 5ENBA 4PCEA 4QSPA 4A9HA 4BW3A 4LYSA 1EQFA 4UIZA 5HQ7A 4ZC9A 4X2IA 2D82A 5LVRA 4QR5A 3MXFA 4YC9A 5A5QA 3UVXA 4O76A 4RVRA 5A81A 4NXJA 5E9YA 2I7KA 4LYIA 5DLXA 3LXJA 4YYKA 5L8TA 4XUBA 5LVQA 3RCWA 5FB1A 4O74A 4N3WA 5CS8A 4A9FA 3TLPA 2F6NA 2DVQA 5ENGA 5H85A 5FE1A 5II1A 1WUMA 4O7FA 4UIWA 4YK0A 4QUUA 5EQ1A 4N4FA 3JVMA 4HXPA 5A82A 4MEPA 5DKHA 5CTLA 5F1HA 4PY6A 4YYMA 5F36A 5DW1A 4NQNA 3QZVA 5KTXA 4NRCA 4HBVA 5I40A 3UVDA 2DVRA 4NUDA 5HEMA 5ACYA 5C7NA 5A5NA 4O7AA 5F3AA 2YQDA 5DFDA 5FE3A 1JM4B 1JSPB 2RNYA 5I7YA 4QEWA 5DYCA 5BT4A 4NR9A 4C67A 5L99A 4A9MA 4QBMA 5CQ3A 3HMHA 5LUUA 4LZRA 2GRCA 5CFWA 5AMFA 4QSUA 5DY7A 5LJ2A 5IBNA 4IR3A 4UIUA 4WHUA 3P5OA 4XY8A 5LKTA 4HXRA 2E3KA 3G0JA 5FFYA 5FDZA 3DAIA 4NR6A 4YH4A 5D3JA 2I8NA 4TZ2A 5DFBA 5DKCA 3UV5A 5FE9A 4YBTA 5I29A 5FBXA 3O37A 4LZ2A 4QSSA 4FLPA 2NXBA 4NRBA 5H1TA 4TYLA 5FG4A 5EWWA 3HMEA 4O71A 4O70A 4O7EA 4YY6A 4NR7A 4N4IA 4O7BA 2RNXA 5TCMA 2DKWA 5C89A 5II2A 5I88A 5F5ZA 3QZTA 5CP5A 5HENA 4F3IA 5IGNA 3LQHA 5CPEA 5DLZA 5AD2A 4O72A 5BT3A 2R0VA 5I7XA 2YEMA 5FG6A 4TQNA 5D3SA 5A5RA 4J0RA 4QR4A 5F2PA 1E6IA 2DWWA 5JWMA 4LZSA 4YATA 5HFQA 5J0DA 3FKMX 4ALGA 4NR8A 5HELA 2DATA 3SVGA 4MR5A 1WUGA 3U5OA 4YYIA 4YADA 5EK9A 4QC3A 4MR4A 5IGKA 5KU3A 2RI7A 4BW2A 3AADA 5FG5A 3SVFA 5A83A 5LKZA 5E9VA 5FH6A 4HXNA 5DW2A 4HXMA 5CUBA 5HFRA 4A9IA 4UYFA 5EU1A 5D3HA 4OGJA 5CQ8A 5H1UA 5IG6A 5CQ7A 2LSPB 5L8UA 4ZW1A 4J0SA 4QSQA 2N9GA 1ZS5A 2L84A 3Q2FA 5EVAA 4NR5A 4BHWA 5EI4A 2E7OA 3ZYUA 2R0YA 4YH3A 3U5LA 4UYGA 2YW5A 5HQ5A 5K29A 5HJCA 3U5PA 3ONIA 5HLSA 5EA1A 5IGLA 4TU6A 2H60A 2OUOA 5DKDA 2R10A 5KTUA 4TZ8A 4YYNA 5D3LA 5HCLA 5FFVA 4CFLA 5FFWA 4YY4A 5COIA 3LJWA 4XUAA 4PCIA 4UIVA 3MQMA 2F6JA 2RO1A 5EP7A 4Z1QA 5FE7A 5KHMA 4QSWA 5C8GA 4YYJA 4QYDA 5F25A 5F60A 3O33A 3IU5A 4HBWA 5E3GA 4CUUA 4TS8A 5EGUA 4J1PA 4KCXA 5IGMA 5KTWA 5DYXA 1X0JA 5D7XA 4LC2A 4A9OA 4WIVA 4Q0OA 5AMEA 4IORA 4E96A 4YAXA 4UITA 5CRZA 5CQ4A 5KO4A 4NYVA 5FE6A 4NR4A 5D25A 5E7DA 4CUTA 5FE5A 4NUCA 4QSXA 4UYEA 4TTEA 4NYWA 3U5JA 4QR3A 4QEVA 5D3NA 3P1DA 3S91A 4PKLA 3U5MA 2YELA 2MJVB 5H1VA 5ENIA 4LYWA 4UYDA 5CUEA 4N4HA 3SVHA 2DVSA 4MENA 4WHWA 3QZSA 4Z6IA 5CUGA 3O34A 4KV1A 5CQ5A 4IOQA 5DX4A 5DFCA 3GG3A 5A5OA 3P1FA 5DYAA 3MB4A 4J3IA 4NRAA 4NUEA 5F62A 5JI8A 4QSTA 4QZSA 2OSSA 5D3TA 5D3RA 5LKXA 5F1LA 4TT4A 2R0SA 5FE4A 4O75A 3G0LA 4XY9A 3S92A 4YBMA 5AD3A 3K2JA 5CU8A 4BJXA 5E9MA 5ENHA 5FH8A 5EICA 4HXOA 5HQ6A 5E74A 4CUSA 5LJ0A 4GPJA 3U5KA 4BW1A 5CUCA 4YYHA 3MB3A 4IR6A 4O78A 5E9KA 2WP2A 2YDWA 4MEOA 4QC1A 4MR6A 5IIDA 5D26A 5ENJA 4Z1SA 5A5SA 5CQ6A 4QEUA 5I80A 5LJ1A 4Q0NA 4C66A 4HBXA 3AQAA 5HRXA 3P1CA 5CZGA 4N4GA 5CQAA 4CURA 2KTBB 4HXLA 3NXBA 4A9LA 4QSVA 3UV2A 5EISA 3IU6A 5I1QA 2DVVA 4HXSA 5L98A 4CLBA 4NQMA 5ENCA 3UVYA 4Y03A 4CUPA 5F61A 4QYLA 1F68A 4LRGA 4YABA 5I83A 5HRWA 4O7CA 4IOOA 1N72A 2RNWA 2WP1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EV9 A;  3I3J A;  5FE8 A;  5ETD A;  4PS5 A;  4ZQL A;  3LQI A;  3O35 A;  4CL9 A;  3LQJ A;  3MUL A;  5L96 A;  4A9J A;  4YBS A;  4YYG A;  4A9N A;  3UV4 A;  5G4S A;  4QY4 A;  4A9K A;  4UYH A;  4DON A;  5C85 A;  4QSR A;  5G4R A;  4OUF A;  3U5N A;  2L85 A;  3D7C A;  3HMF A;  5EPB A;  5EWD A;  5A7C A;  5FE2 A;  4UYF B;  5F63 A;  4PTB A;  5D24 A;  5E0R A;  5FH7 A;  4ALH A;  2E7N A;  5E73 A;  5A5P A;  3DWY A;  5E3D A;  2RFJ A;  4LDF A;  4XYA A;  3O36 A;  5EWV A;  3P1E A;  4IR4 A;  4O77 A;  3JVK A;  4UIX A;  5DYU A;  5EM3 A;  5D0C A;  4A9E A;  5D3P A;  5E9I A;  5CY9 A;  2G4A A;  4UIY A;  5LKU A;  3MUK A;  2OO1 A;  3UW9 A;  4HXK A;  5EPS A;  4Z93 A;  5ENE A;  5FE0 A;  5A85 A;  5C87 A;  2RS9 B;  5BT5 A;  4NYX A;  5CGP A;  4TU4 A;  4BW4 A;  4IR5 A;  4TT2 A;  3UVW A;  5HM0 A;  3JVL A;  5EWH A;  5CQT A;  3JVJ A;  5ENF A;  2YYN A;  3Q2E A;  5E9L A;  2D9E A;  5L97 A;  2FSA A;  4TT6 A;  5ETB A;  2L5E A;  4LR6 A;  5FB0 A;  4KV4 A;  4YYD A;  4QNS A;  5DBM A;  5I89 A;  5I86 A;  5CRM A;  4MEQ A;  4AKN A;  5EPR A;  4CUQ A;  4Z6H A;  5CUD A;  4CFK A;  4OGI A;  5C4Q A;  5HRV A;  5EWC A;  4MR3 A;  4QB3 A;  2YEK A;  4QUT A;  5TB6 A;  4HBY A;  4NS5 A;  5CUA A;  5ENB A;  4PCE A;  4QSP A;  4A9H A;  4BW3 A;  4LYS A;  1EQF A;  4UIZ A;  5HQ7 A;  4ZC9 A;  4X2I A;  2D82 A;  5LVR A;  4QR5 A;  3MXF A;  4YC9 A;  5A5Q A;  3UVX A;  4O76 A;  4RVR A;  5A81 A;  4NXJ A;  5E9Y A;  2I7K A;  4LYI A;  5DLX A;  3LXJ A;  4YYK A;  5L8T A;  4XUB A;  5LVQ A;  3RCW A;  5FB1 A;  4O74 A;  4N3W A;  5CS8 A;  4A9F A;  3TLP A;  2F6N A;  2DVQ A;  5ENG A;  5H85 A;  5FE1 A;  5II1 A;  1WUM A;  4O7F A;  4UIW A;  4YK0 A;  4QUU A;  5EQ1 A;  4N4F A;  3JVM A;  4HXP A;  5A82 A;  4MEP A;  5DKH A;  5CTL A;  5F1H A;  4PY6 A;  4YYM A;  5F36 A;  5DW1 A;  4NQN A;  3QZV A;  5KTX A;  4NRC A;  4HBV A;  5I40 A;  3UVD A;  2DVR A;  4NUD A;  5HEM A;  5ACY A;  5C7N A;  5A5N A;  4O7A A;  5F3A A;  2YQD A;  5DFD A;  5FE3 A;  1JM4 B;  1JSP B;  2RNY A;  5I7Y A;  4QEW A;  5DYC A;  5BT4 A;  4NR9 A;  4C67 A;  5L99 A;  4A9M A;  4QBM A;  5CQ3 A;  3HMH A;  5LUU A;  4LZR A;  2GRC A;  5CFW A;  5AMF A;  4QSU A;  5DY7 A;  5LJ2 A;  5IBN A;  4IR3 A;  4UIU A;  4WHU A;  3P5O A;  4XY8 A;  5LKT A;  4HXR A;  2E3K A;  3G0J A;  5FFY A;  5FDZ A;  3DAI A;  4NR6 A;  4YH4 A;  5D3J A;  2I8N A;  4TZ2 A;  5DFB A;  5DKC A;  3UV5 A;  5FE9 A;  4YBT A;  5I29 A;  5FBX A;  3O37 A;  4LZ2 A;  4QSS A;  4FLP A;  2NXB A;  4NRB A;  5H1T A;  4TYL A;  5FG4 A;  5EWW A;  3HME A;  4O71 A;  4O70 A;  4O7E A;  4YY6 A;  4NR7 A;  4N4I A;  4O7B A;  2RNX A;  5TCM A;  2DKW A;  5C89 A;  5II2 A;  5I88 A;  5F5Z A;  3QZT A;  5CP5 A;  5HEN A;  4F3I A;  5IGN A;  3LQH A;  5CPE A;  5DLZ A;  5AD2 A;  4O72 A;  5BT3 A;  2R0V A;  5I7X A;  2YEM A;  5FG6 A;  4TQN A;  5D3S A;  5A5R A;  4J0R A;  4QR4 A;  5F2P A;  1E6I A;  2DWW A;  5JWM A;  4LZS A;  4YAT A;  5HFQ A;  5J0D A;  3FKM X;  4ALG A;  4NR8 A;  5HEL A;  2DAT A;  3SVG A;  4MR5 A;  1WUG A;  3U5O A;  4YYI A;  4YAD A;  5EK9 A;  4QC3 A;  4MR4 A;  5IGK A;  5KU3 A;  2RI7 A;  4BW2 A;  3AAD A;  5FG5 A;  3SVF A;  5A83 A;  5LKZ A;  5E9V A;  5FH6 A;  4HXN A;  5DW2 A;  4HXM A;  5CUB A;  5HFR A;  4A9I A;  4UYF A;  5EU1 A;  5D3H A;  4OGJ A;  5CQ8 A;  5H1U A;  5IG6 A;  5CQ7 A;  2LSP B;  5L8U A;  4ZW1 A;  4J0S A;  4QSQ A;  2N9G A;  1ZS5 A;  2L84 A;  3Q2F A;  5EVA A;  4NR5 A;  4BHW A;  5EI4 A;  2E7O A;  3ZYU A;  2R0Y A;  4YH3 A;  3U5L A;  4UYG A;  2YW5 A;  5HQ5 A;  5K29 A;  5HJC A;  3U5P A;  3ONI A;  5HLS A;  5EA1 A;  5IGL A;  4TU6 A;  2H60 A;  2OUO A;  5DKD A;  2R10 A;  5KTU A;  4TZ8 A;  4YYN A;  5D3L A;  5HCL A;  5FFV A;  4CFL A;  5FFW A;  4YY4 A;  5COI A;  3LJW A;  4XUA A;  4PCI A;  4UIV A;  3MQM A;  2F6J A;  2RO1 A;  5EP7 A;  4Z1Q A;  5FE7 A;  5KHM A;  4QSW A;  5C8G A;  4YYJ A;  4QYD A;  5F25 A;  5F60 A;  3O33 A;  3IU5 A;  4HBW A;  5E3G A;  4CUU A;  4TS8 A;  5EGU A;  4J1P A;  4KCX A;  5IGM A;  5KTW A;  5DYX A;  1X0J A;  5D7X A;  4LC2 A;  4A9O A;  4WIV A;  4Q0O A;  5AME A;  4IOR A;  4E96 A;  4YAX A;  4UIT A;  5CRZ A;  5CQ4 A;  5KO4 A;  4NYV A;  5FE6 A;  4NR4 A;  5D25 A;  5E7D A;  4CUT A;  5FE5 A;  4NUC A;  4QSX A;  4UYE A;  4TTE A;  4NYW A;  3U5J A;  4QR3 A;  4QEV A;  5D3N A;  3P1D A;  3S91 A;  4PKL A;  3U5M A;  2YEL A;  2MJV B;  5H1V A;  5ENI A;  4LYW A;  4UYD A;  5CUE A;  4N4H A;  3SVH A;  2DVS A;  4MEN A;  4WHW A;  3QZS A;  4Z6I A;  5CUG A;  3O34 A;  4KV1 A;  5CQ5 A;  4IOQ A;  5DX4 A;  5DFC A;  3GG3 A;  5A5O A;  3P1F A;  5DYA A;  3MB4 A;  4J3I A;  4NRA A;  4NUE A;  5F62 A;  5JI8 A;  4QST A;  4QZS A;  2OSS A;  5D3T A;  5D3R A;  5LKX A;  5F1L A;  4TT4 A;  2R0S A;  5FE4 A;  4O75 A;  3G0L A;  4XY9 A;  3S92 A;  4YBM A;  5AD3 A;  3K2J A;  5CU8 A;  4BJX A;  5E9M A;  5ENH A;  5FH8 A;  5EIC A;  4HXO A;  5HQ6 A;  5E74 A;  4CUS A;  5LJ0 A;  4GPJ A;  3U5K A;  4BW1 A;  5CUC A;  4YYH A;  3MB3 A;  4IR6 A;  4O78 A;  5E9K A;  2WP2 A;  2YDW A;  4MEO A;  4QC1 A;  4MR6 A;  5IID A;  5D26 A;  5ENJ A;  4Z1S A;  5A5S A;  5CQ6 A;  4QEU A;  5I80 A;  5LJ1 A;  4Q0N A;  4C66 A;  4HBX A;  3AQA A;  5HRX A;  3P1C A;  5CZG A;  4N4G A;  5CQA A;  4CUR A;  2KTB B;  4HXL A;  3NXB A;  4A9L A;  4QSV A;  3UV2 A;  5EIS A;  3IU6 A;  5I1Q A;  2DVV A;  4HXS A;  5L98 A;  4CLB A;  4NQM A;  5ENC A;  3UVY A;  4Y03 A;  4CUP A;  5F61 A;  4QYL A;  1F68 A;  4LRG A;  4YAB A;  5I83 A;  5HRW A;  4O7C A;  4IOO A;  1N72 A;  2RNW A;  2WP1 A; 
#chains in the Genus database with same CATH topology
 5EV9 A;  3I3J A;  5FE8 A;  5ETD A;  4PS5 A;  4ZQL A;  3LQI A;  3O35 A;  4CL9 A;  3LQJ A;  3MUL A;  5L96 A;  4A9J A;  4YBS A;  4YYG A;  4A9N A;  3UV4 A;  5G4S A;  4QY4 A;  4A9K A;  4UYH A;  4DON A;  5C85 A;  4QSR A;  5G4R A;  4OUF A;  3U5N A;  2L85 A;  3D7C A;  3HMF A;  5EPB A;  5EWD A;  5A7C A;  5FE2 A;  4UYF B;  5F63 A;  4PTB A;  5D24 A;  5E0R A;  5FH7 A;  4ALH A;  2E7N A;  5E73 A;  5A5P A;  3DWY A;  5E3D A;  2RFJ A;  4LDF A;  4XYA A;  3O36 A;  5EWV A;  3P1E A;  4IR4 A;  4O77 A;  3JVK A;  4UIX A;  5DYU A;  5EM3 A;  5D0C A;  4A9E A;  5D3P A;  5E9I A;  5CY9 A;  2G4A A;  4UIY A;  5LKU A;  3MUK A;  2OO1 A;  3UW9 A;  4HXK A;  5EPS A;  4Z93 A;  5ENE A;  5FE0 A;  5A85 A;  5C87 A;  2RS9 B;  5BT5 A;  4NYX A;  5CGP A;  4TU4 A;  4BW4 A;  4IR5 A;  4TT2 A;  3UVW A;  5HM0 A;  3JVL A;  5EWH A;  5CQT A;  3JVJ A;  5ENF A;  2YYN A;  3Q2E A;  5E9L A;  2D9E A;  5L97 A;  2FSA A;  4TT6 A;  5ETB A;  2L5E A;  4LR6 A;  5FB0 A;  4KV4 A;  4YYD A;  4QNS A;  5DBM A;  5I89 A;  5I86 A;  5CRM A;  4MEQ A;  4AKN A;  5EPR A;  4CUQ A;  4Z6H A;  5CUD A;  4CFK A;  4OGI A;  5C4Q A;  5HRV A;  5EWC A;  4MR3 A;  4QB3 A;  2YEK A;  4QUT A;  5TB6 A;  4HBY A;  4NS5 A;  5CUA A;  5ENB A;  4PCE A;  4QSP A;  4A9H A;  4BW3 A;  4LYS A;  1EQF A;  4UIZ A;  5HQ7 A;  4ZC9 A;  4X2I A;  2D82 A;  5LVR A;  4QR5 A;  3MXF A;  4YC9 A;  5A5Q A;  3UVX A;  4O76 A;  4RVR A;  5A81 A;  4NXJ A;  5E9Y A;  2I7K A;  4LYI A;  5DLX A;  3LXJ A;  4YYK A;  5L8T A;  4XUB A;  5LVQ A;  3RCW A;  5FB1 A;  4O74 A;  4N3W A;  5CS8 A;  4A9F A;  3TLP A;  2F6N A;  2DVQ A;  5ENG A;  5H85 A;  5FE1 A;  5II1 A;  1WUM A;  4O7F A;  4UIW A;  4YK0 A;  4QUU A;  5EQ1 A;  4N4F A;  3JVM A;  4HXP A;  5A82 A;  4MEP A;  5DKH A;  5CTL A;  5F1H A;  4PY6 A;  4YYM A;  5F36 A;  5DW1 A;  4NQN A;  3QZV A;  5KTX A;  4NRC A;  4HBV A;  5I40 A;  3UVD A;  2DVR A;  4NUD A;  5HEM A;  5ACY A;  5C7N A;  5A5N A;  4O7A A;  5F3A A;  2YQD A;  5DFD A;  5FE3 A;  1JM4 B;  1JSP B;  2RNY A;  5I7Y A;  4QEW A;  5DYC A;  5BT4 A;  4NR9 A;  4C67 A;  5L99 A;  4A9M A;  4QBM A;  5CQ3 A;  3HMH A;  5LUU A;  4LZR A;  2GRC A;  5CFW A;  5AMF A;  4QSU A;  5DY7 A;  5LJ2 A;  5IBN A;  4IR3 A;  4UIU A;  4WHU A;  3P5O A;  4XY8 A;  5LKT A;  4HXR A;  2E3K A;  3G0J A;  5FFY A;  5FDZ A;  1ZKR A;  3DAI A;  4NR6 A;  4YH4 A;  5D3J A;  2I8N A;  4TZ2 A;  5DFB A;  5DKC A;  3UV5 A;  5FE9 A;  4YBT A;  5I29 A;  5FBX A;  3O37 A;  4LZ2 A;  4QSS A;  4FLP A;  2NXB A;  4NRB A;  3VKH A;  5H1T A;  4TYL A;  5FG4 A;  5EWW A;  3HME A;  4O71 A;  4O70 A;  4O7E A;  4YY6 A;  4NR7 A;  4N4I A;  4O7B A;  3VKG A;  2RNX A;  5TCM A;  2DKW A;  5C89 A;  5II2 A;  5I88 A;  5F5Z A;  3QZT A;  5CP5 A;  5HEN A;  4F3I A;  5IGN A;  3LQH A;  5CPE A;  5DLZ A;  5AD2 A;  4O72 A;  5BT3 A;  2R0V A;  5I7X A;  2YEM A;  5FG6 A;  4TQN A;  5D3S A;  5A5R A;  4J0R A;  4QR4 A;  5F2P A;  1E6I A;  2DWW A;  5JWM A;  4LZS A;  4YAT A;  5HFQ A;  5J0D A;  3FKM X;  4ALG A;  4NR8 A;  5HEL A;  2DAT A;  3SVG A;  4MR5 A;  1WUG A;  3U5O A;  4YYI A;  4YAD A;  5EK9 A;  4QC3 A;  4MR4 A;  5IGK A;  5KU3 A;  3ERR A;  2RI7 A;  4BW2 A;  3AAD A;  5FG5 A;  3SVF A;  5A83 A;  5LKZ A;  5E9V A;  5FH6 A;  4HXN A;  5DW2 A;  4HXM A;  5CUB A;  5HFR A;  4A9I A;  4UYF A;  5EU1 A;  5D3H A;  4OGJ A;  5CQ8 A;  5H1U A;  5IG6 A;  5CQ7 A;  2LSP B;  5L8U A;  4ZW1 A;  4J0S A;  4QSQ A;  4AKG A;  3D1B A;  2N9G A;  1ZS5 A;  2L84 A;  3Q2F A;  5EVA A;  4NR5 A;  4BHW A;  5EI4 A;  2E7O A;  3ZYU A;  2R0Y A;  4YH3 A;  3U5L A;  4UYG A;  2YW5 A;  5HQ5 A;  5K29 A;  5HJC A;  3U5P A;  3ONI A;  5HLS A;  5EA1 A;  5IGL A;  4TU6 A;  2H60 A;  2OUO A;  5DKD A;  2R10 A;  5KTU A;  4TZ8 A;  4YYN A;  5D3L A;  5HCL A;  5FFV A;  4CFL A;  5FFW A;  4YY4 A;  5COI A;  3LJW A;  4XUA A;  4PCI A;  4UIV A;  3MQM A;  2F6J A;  2RO1 A;  5EP7 A;  4Z1Q A;  4AKH A;  5FE7 A;  5KHM A;  4QSW A;  5C8G A;  4YYJ A;  4QYD A;  5F25 A;  5F60 A;  3O33 A;  3IU5 A;  4HBW A;  5E3G A;  4CUU A;  4TS8 A;  5EGU A;  4J1P A;  4KCX A;  5IGM A;  5KTW A;  5DYX A;  1X0J A;  4LC2 A;  5D7X A;  4A9O A;  4AKI A;  4WIV A;  4Q0O A;  5AME A;  4IOR A;  4E96 A;  4YAX A;  4UIT A;  5CRZ A;  5CQ4 A;  5KO4 A;  4NYV A;  5FE6 A;  4NR4 A;  5D25 A;  5E7D A;  4CUT A;  5FE5 A;  4NUC A;  4QSX A;  4UYE A;  4TTE A;  4NYW A;  3U5J A;  4QR3 A;  4QEV A;  5D3N A;  3P1D A;  3S91 A;  4PKL A;  3U5M A;  2YEL A;  2MJV B;  5H1V A;  5ENI A;  4LYW A;  4UYD A;  5CUE A;  4N4H A;  3SVH A;  2DVS A;  4MEN A;  4WHW A;  3QZS A;  4Z6I A;  5CUG A;  3O34 A;  4KV1 A;  5CQ5 A;  4IOQ A;  5DX4 A;  5DFC A;  3GG3 A;  5A5O A;  3P1F A;  5DYA A;  3MB4 A;  4J3I A;  4NRA A;  4NUE A;  5F62 A;  5JI8 A;  4QST A;  4QZS A;  2OSS A;  5D3T A;  5D3R A;  5LKX A;  5F1L A;  4TT4 A;  1PUO A;  2R0S A;  3D1D A;  5FE4 A;  4O75 A;  3G0L A;  4XY9 A;  3S92 A;  4YBM A;  5AD3 A;  3K2J A;  5CU8 A;  4BJX A;  5E9M A;  5ENH A;  5FH8 A;  5EIC A;  4HXO A;  5HQ6 A;  4AI6 A;  5E74 A;  4CUS A;  5LJ0 A;  4GPJ A;  3U5K A;  4BW1 A;  2EJN A;  5CUC A;  4YYH A;  3MB3 A;  4IR6 A;  4O78 A;  5E9K A;  2WP2 A;  2YDW A;  4MEO A;  4QC1 A;  4MR6 A;  5IID A;  5D26 A;  5ENJ A;  4Z1S A;  5A5S A;  5CQ6 A;  4QEU A;  5I80 A;  5LJ1 A;  4Q0N A;  4C66 A;  4HBX A;  3AQA A;  5HRX A;  3P1C A;  5CZG A;  4N4G A;  5CQA A;  4CUR A;  2KTB B;  4HXL A;  3NXB A;  4A9L A;  4QSV A;  3UV2 A;  5EIS A;  3IU6 A;  5I1Q A;  2DVV A;  4HXS A;  5L98 A;  4CLB A;  4NQM A;  5ENC A;  3UVY A;  4Y03 A;  4CUP A;  5F61 A;  4QYL A;  1F68 A;  4LRG A;  4YAB A;  5I83 A;  5HRW A;  4O7C A;  4IOO A;  1N72 A;  2RNW A;  2WP1 A; 
#chains in the Genus database with same CATH homology
 5EV9 A;  3I3J A;  5FE8 A;  5ETD A;  4PS5 A;  4ZQL A;  3LQI A;  3O35 A;  4CL9 A;  3LQJ A;  3MUL A;  5L96 A;  4A9J A;  4YBS A;  4YYG A;  4A9N A;  3UV4 A;  5G4S A;  4QY4 A;  4A9K A;  4UYH A;  4DON A;  5C85 A;  4QSR A;  5G4R A;  4OUF A;  3U5N A;  2L85 A;  3D7C A;  3HMF A;  5EPB A;  5EWD A;  5A7C A;  5FE2 A;  4UYF B;  5F63 A;  4PTB A;  5D24 A;  5E0R A;  5FH7 A;  4ALH A;  2E7N A;  5E73 A;  5A5P A;  3DWY A;  5E3D A;  2RFJ A;  4LDF A;  4XYA A;  3O36 A;  5EWV A;  3P1E A;  4IR4 A;  4O77 A;  3JVK A;  4UIX A;  5DYU A;  5EM3 A;  5D0C A;  4A9E A;  5D3P A;  5E9I A;  5CY9 A;  2G4A A;  4UIY A;  5LKU A;  3MUK A;  2OO1 A;  3UW9 A;  4HXK A;  5EPS A;  4Z93 A;  5ENE A;  5FE0 A;  5A85 A;  5C87 A;  2RS9 B;  5BT5 A;  4NYX A;  5CGP A;  4TU4 A;  4BW4 A;  4IR5 A;  4TT2 A;  3UVW A;  5HM0 A;  3JVL A;  5EWH A;  5CQT A;  3JVJ A;  5ENF A;  2YYN A;  3Q2E A;  5E9L A;  2D9E A;  5L97 A;  2FSA A;  4TT6 A;  5ETB A;  2L5E A;  4LR6 A;  5FB0 A;  4KV4 A;  4YYD A;  4QNS A;  5DBM A;  5I89 A;  5I86 A;  5CRM A;  4MEQ A;  4AKN A;  5EPR A;  4CUQ A;  4Z6H A;  5CUD A;  4CFK A;  4OGI A;  5C4Q A;  5HRV A;  5EWC A;  4MR3 A;  4QB3 A;  2YEK A;  4QUT A;  5TB6 A;  4HBY A;  4NS5 A;  5CUA A;  5ENB A;  4PCE A;  4QSP A;  4A9H A;  4BW3 A;  4LYS A;  1EQF A;  4UIZ A;  5HQ7 A;  4ZC9 A;  4X2I A;  2D82 A;  5LVR A;  4QR5 A;  3MXF A;  4YC9 A;  5A5Q A;  3UVX A;  4O76 A;  4RVR A;  5A81 A;  4NXJ A;  5E9Y A;  2I7K A;  4LYI A;  5DLX A;  3LXJ A;  4YYK A;  5L8T A;  4XUB A;  5LVQ A;  3RCW A;  5FB1 A;  4O74 A;  4N3W A;  5CS8 A;  4A9F A;  3TLP A;  2F6N A;  2DVQ A;  5ENG A;  5H85 A;  5FE1 A;  5II1 A;  1WUM A;  4O7F A;  4UIW A;  4YK0 A;  4QUU A;  5EQ1 A;  4N4F A;  3JVM A;  4HXP A;  5A82 A;  4MEP A;  5DKH A;  5CTL A;  5F1H A;  4PY6 A;  4YYM A;  5F36 A;  5DW1 A;  4NQN A;  3QZV A;  5KTX A;  4NRC A;  4HBV A;  5I40 A;  3UVD A;  2DVR A;  4NUD A;  5HEM A;  5ACY A;  5C7N A;  5A5N A;  4O7A A;  5F3A A;  2YQD A;  5DFD A;  5FE3 A;  1JM4 B;  1JSP B;  2RNY A;  5I7Y A;  4QEW A;  5DYC A;  5BT4 A;  4NR9 A;  4C67 A;  5L99 A;  4A9M A;  4QBM A;  5CQ3 A;  3HMH A;  5LUU A;  4LZR A;  2GRC A;  5CFW A;  5AMF A;  4QSU A;  5DY7 A;  5LJ2 A;  5IBN A;  4IR3 A;  4UIU A;  4WHU A;  3P5O A;  4XY8 A;  5LKT A;  4HXR A;  2E3K A;  3G0J A;  5FFY A;  5FDZ A;  3DAI A;  4NR6 A;  4YH4 A;  5D3J A;  2I8N A;  4TZ2 A;  5DFB A;  5DKC A;  3UV5 A;  5FE9 A;  4YBT A;  5I29 A;  5FBX A;  3O37 A;  4LZ2 A;  4QSS A;  4FLP A;  2NXB A;  4NRB A;  5H1T A;  4TYL A;  5FG4 A;  5EWW A;  3HME A;  4O71 A;  4O70 A;  4O7E A;  4YY6 A;  4NR7 A;  4N4I A;  4O7B A;  2RNX A;  5TCM A;  2DKW A;  5C89 A;  5II2 A;  5I88 A;  5F5Z A;  3QZT A;  5CP5 A;  5HEN A;  4F3I A;  5IGN A;  3LQH A;  5CPE A;  5DLZ A;  5AD2 A;  4O72 A;  5BT3 A;  2R0V A;  5I7X A;  2YEM A;  5FG6 A;  4TQN A;  5D3S A;  5A5R A;  4J0R A;  4QR4 A;  5F2P A;  1E6I A;  2DWW A;  5JWM A;  4LZS A;  4YAT A;  5HFQ A;  5J0D A;  3FKM X;  4ALG A;  4NR8 A;  5HEL A;  2DAT A;  3SVG A;  4MR5 A;  1WUG A;  3U5O A;  4YYI A;  4YAD A;  5EK9 A;  4QC3 A;  4MR4 A;  5IGK A;  5KU3 A;  2RI7 A;  4BW2 A;  3AAD A;  5FG5 A;  3SVF A;  5A83 A;  5LKZ A;  5E9V A;  5FH6 A;  4HXN A;  5DW2 A;  4HXM A;  5CUB A;  5HFR A;  4A9I A;  4UYF A;  5EU1 A;  5D3H A;  4OGJ A;  5CQ8 A;  5H1U A;  5IG6 A;  5CQ7 A;  2LSP B;  5L8U A;  4ZW1 A;  4J0S A;  4QSQ A;  2N9G A;  1ZS5 A;  2L84 A;  3Q2F A;  5EVA A;  4NR5 A;  4BHW A;  5EI4 A;  2E7O A;  3ZYU A;  2R0Y A;  4YH3 A;  3U5L A;  4UYG A;  2YW5 A;  5HQ5 A;  5K29 A;  5HJC A;  3U5P A;  3ONI A;  5HLS A;  5EA1 A;  5IGL A;  4TU6 A;  2H60 A;  2OUO A;  5DKD A;  2R10 A;  5KTU A;  4TZ8 A;  4YYN A;  5D3L A;  5HCL A;  5FFV A;  4CFL A;  5FFW A;  4YY4 A;  5COI A;  3LJW A;  4XUA A;  4PCI A;  4UIV A;  3MQM A;  2F6J A;  2RO1 A;  5EP7 A;  4Z1Q A;  5FE7 A;  5KHM A;  4QSW A;  5C8G A;  4YYJ A;  4QYD A;  5F25 A;  5F60 A;  3O33 A;  3IU5 A;  4HBW A;  5E3G A;  4CUU A;  4TS8 A;  5EGU A;  4J1P A;  4KCX A;  5IGM A;  5KTW A;  5DYX A;  1X0J A;  5D7X A;  4LC2 A;  4A9O A;  4WIV A;  4Q0O A;  5AME A;  4IOR A;  4E96 A;  4YAX A;  4UIT A;  5CRZ A;  5CQ4 A;  5KO4 A;  4NYV A;  5FE6 A;  4NR4 A;  5D25 A;  5E7D A;  4CUT A;  5FE5 A;  4NUC A;  4QSX A;  4UYE A;  4TTE A;  4NYW A;  3U5J A;  4QR3 A;  4QEV A;  5D3N A;  3P1D A;  3S91 A;  4PKL A;  3U5M A;  2YEL A;  2MJV B;  5H1V A;  5ENI A;  4LYW A;  4UYD A;  5CUE A;  4N4H A;  3SVH A;  2DVS A;  4MEN A;  4WHW A;  3QZS A;  4Z6I A;  5CUG A;  3O34 A;  4KV1 A;  5CQ5 A;  4IOQ A;  5DX4 A;  5DFC A;  3GG3 A;  5A5O A;  3P1F A;  5DYA A;  3MB4 A;  4J3I A;  4NRA A;  4NUE A;  5F62 A;  5JI8 A;  4QST A;  4QZS A;  2OSS A;  5D3T A;  5D3R A;  5LKX A;  5F1L A;  4TT4 A;  2R0S A;  5FE4 A;  4O75 A;  3G0L A;  4XY9 A;  3S92 A;  4YBM A;  5AD3 A;  3K2J A;  5CU8 A;  4BJX A;  5E9M A;  5ENH A;  5FH8 A;  5EIC A;  4HXO A;  5HQ6 A;  5E74 A;  4CUS A;  5LJ0 A;  4GPJ A;  3U5K A;  4BW1 A;  5CUC A;  4YYH A;  3MB3 A;  4IR6 A;  4O78 A;  5E9K A;  2WP2 A;  2YDW A;  4MEO A;  4QC1 A;  4MR6 A;  5IID A;  5D26 A;  5ENJ A;  4Z1S A;  5A5S A;  5CQ6 A;  4QEU A;  5I80 A;  5LJ1 A;  4Q0N A;  4C66 A;  4HBX A;  3AQA A;  5HRX A;  3P1C A;  5CZG A;  4N4G A;  5CQA A;  4CUR A;  2KTB B;  4HXL A;  3NXB A;  4A9L A;  4QSV A;  3UV2 A;  5EIS A;  3IU6 A;  5I1Q A;  2DVV A;  4HXS A;  5L98 A;  4CLB A;  4NQM A;  5ENC A;  3UVY A;  4Y03 A;  4CUP A;  5F61 A;  4QYL A;  1F68 A;  4LRG A;  4YAB A;  5I83 A;  5HRW A;  4O7C A;  4IOO A;  1N72 A;  2RNW A;  2WP1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...