4NR7A

Crystal structure of the bromodomain of human crebbp in complex with an isoxazolyl-benzimidazole ligand
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
116
structure length
116
Chain Sequence
KKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CREB-binding protein
publication title Crystal structure of the bromodomain of human CREBBP in complex with an isoxazolyl-benzimidazole ligand
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 41
structure length 116
sequence length 116
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2013-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4nr7A00
5IIDA 2DVVA 4YATA 5EPRA 4O72A 2RNWA 3UVDA 5FE0A 4LYSA 4FLPA 4UIUA 5DFCA 2E7OA 4LZ2A 4YH3A 5DYAA 5EPBA 2YQDA 5IG6A 5DBMA 5I89A 5DLXA 3AQAA 5C85A 4IR5A 5I40A 4TYLA 4PTBA 4Z93A 4CUTA 4IORA 5F25A 5A5NA 5FE4A 2N9GA 3TLPA 4LR6A 5HQ6A 4TQNA 2YDWA 2GRCA 4HBXA 5D3JA 5HFRA 4BJXA 4YYKA 4YY6A 5EWDA 4WHUA 4KV1A 2DATA 2D9EA 4QUTA 3MB3A 4OUFA 3O36A 5A82A 4QC1A 2R0VA 4F3IA 4LRGA 4TT4A 4BW2A 5I29A 4NYWA 5HM0A 3HMHA 4HXLA 4XUBA 5FH7A 5II2A 5DKDA 5A5PA 4QZSA 4IR3A 3LXJA 4O7BA 5KO4A 2L5EA 4QR4A 1X0JA 3MULA 4XYAA 4IOOA 5K29A 4O71A 2F6JA 3SVFA 5HRWA 3P1CA 4IOQA 2RO1A 4J1PA 4QB3A 4OGIA 4BW1A 5A5QA 4YYDA 5DKHA 5HELA 5A5RA 5LKUA 5FE7A 4LZRA 4NYXA 3RCWA 4QSSA 2FSAA 4PKLA 3U5PA 4UYDA 5D25A 5ENGA 5JWMA 4UIWA 2YELA 4MEOA 3S92A 5LVRA 3JVLA 4QSTA 5FE5A 5DKCA 4YBTA 4PY6A 5I1QA 4IR4A 5C8GA 3QZSA 5CUGA 3UV4A 5EU1A 4UITA 3U5JA 5EPSA 4YBMA 5KTXA 5E9VA 5F2PA 5CUCA 2WP1A 5LKXA 2R10A 4XY8A 5CTLA 5EISA 5CQTA 4QSPA 5DFDA 4GPJA 4CUSA 4QEWA 4YYMA 4YYIA 5EGUA 2RS9B 3QZTA 5LJ0A 5F36A 1EQFA 4NUCA 4UYEA 5FH6A 5D7XA 5HQ5A 2L85A 3MUKA 4NQMA 2YEMA 5FE2A 4Q0NA 3O37A 5H1UA 5FE1A 5FB1A 4TS8A 5LKZA 5CPEA 5A85A 5COIA 3Q2FA 5CUAA 4ALGA 4NUEA 2R0SA 5E7DA 5CY9A 5BT3A 4DONA 3SVGA 3O34A 5CQ4A 4O76A 4HXOA 5TCMA 5HEMA 3S91A 4C67A 1WUGA 5CU8A 4NS5A 3DWYA 3GG3A 4MR4A 5FH8A 4Z1QA 3UVXA 4WHWA 3JVJA 5C4QA 5A5SA 5CQ8A 4NXJA 5FG5A 4NRCA 3Q2EA 5DYXA 4YBSA 4MR5A 4N3WA 5D3PA 5ENIA 4QR3A 2R0YA 5F61A 5HFQA 3MQMA 4XUAA 4MEPA 3FKMX 4O7EA 4N4FA 5CZGA 3NXBA 5DX4A 4TT6A 4LZSA 4UYGA 4CUQA 3DAIA 5J0DA 2E7NA 5EWHA 4NQNA 4QSXA 3P1DA 5E3GA 5E74A 5E9MA 4MR3A 4QY4A 3U5KA 5A83A 4A9MA 5I80A 3UVYA 4HXRA 5I86A 2RI7A 4UIXA 2D82A 4YH4A 3I3JA 4NR6A 5EP7A 4CFKA 3MB4A 5FE9A 4CURA 4TU4A 5ENBA 5H1VA 5E9YA 3UVWA 4Z6IA 5H1TA 5HCLA 4TU6A 5DYUA 4O78A 2F6NA 4QYDA 5CUDA 3LJWA 5FE8A 3HMFA 5DY7A 5CQ5A 4RVRA 5LJ1A 5D3LA 5FG6A 4HXNA 4KV4A 3HMEA 5A81A 5D3HA 4CFLA 4O7AA 4QBMA 3LQHA 2YYNA 4MENA 2KTBB 5ENHA 4QEUA 5E3DA 1JSPB 5KTWA 5IGMA 5EI4A 2DWWA 5FBXA 2MJVB 4HXKA 1JM4B 5CS8A 5E73A 5E9IA 4HXPA 5IGKA 5I83A 5F5ZA 4J0SA 5CQ6A 4O75A 4NR7A 4NR9A 4XY9A 5FFYA 4PCIA 5FFVA 5KU3A 3P5OA 4A9NA 4A9FA 4LC2A 4ZW1A 4QEVA 4HBVA 4Z1SA 4O7FA 5CP5A 5EV9A 5JI8A 5LKTA 4CUPA 5ENJA 5CQ7A 5EA1A 4O7CA 4TZ2A 1E6IA 5FB0A 3G0JA 4BW4A 5ACYA 5LUUA 4UYHA 3JVMA 5F63A 2I8NA 5E0RA 4QR5A 5KHMA 3UV5A 5D3TA 3O35A 5ENCA 2RNXA 5D3SA 4QUUA 5CUEA 3IU6A 4QC3A 5L97A 5EM3A 3ZYUA 5EWWA 5L96A 5ETDA 3UV2A 4Q0OA 5DYCA 5C87A 5HJCA 4N4IA 3ONIA 5L8UA 4CUUA 4TTEA 4UYFA 3SVHA 4J0RA 5IGNA 5FE3A 2I7KA 3JVKA 3LQIA 5D3RA 4ALHA 5I7YA 2DVRA 4LYWA 5IBNA 5E9KA 5FG4A 2YW5A 3QZVA 1ZS5A 4AKNA 5EWVA 4N4HA 4UIZA 5CQAA 4YYJA 4NYVA 4NUDA 5F62A 4BW3A 5EWCA 1N72A 4NR4A 5FFWA 4ZQLA 5C89A 4NRAA 3AADA 4A9OA 4O77A 4UIYA 4Z6HA 4YADA 2RNYA 5ENFA 4QSVA 2DVSA 4QSRA 4UYFB 5BT4A 4YK0A 5C7NA 4HXSA 5II1A 5DW1A 4UIVA 5HRXA 4TT2A 5EQ1A 4C66A 5D0CA 5CQ3A 5LVQA 2LSPB 5AD2A 2L84A 3U5NA 4X2IA 5ETBA 4E96A 1F68A 5F60A 4YABA 4PCEA 5H85A 5CFWA 4TZ8A 4A9HA 2E3KA 5F1LA 4NR8A 5HRVA 3U5MA 2OO1A 5L99A 4HXMA 4IR6A 4NR5A 4MEQA 5CUBA 4QSUA 4CLBA 5CGPA 4O74A 4YYNA 2DKWA 5FDZA 5HLSA 4YAXA 4YC9A 4YYHA 3D7CA 5DW2A 4YY4A 4A9EA 2DVQA 5HENA 5CRMA 5HQ7A 4YYGA 2NXBA 3LQJA 2RFJA 4HBYA 4QNSA 3P1FA 3U5OA 5I7XA 3P1EA 5IGLA 3O33A 5F1HA 2OUOA 2G4AA 4QYLA 5D3NA 5D26A 5CRZA 4OGJA 5EK9A 5L98A 3UW9A 5E9LA 5I88A 4CL9A 4MR6A 4A9LA 5G4RA 5A7CA 3U5LA 5L8TA 5F3AA 4A9JA 4Y03A 2WP2A 4QSWA 5AMEA 5A5OA 4HBWA 5TB6A 5DFBA 4N4GA 5FE6A 5AD3A 3MXFA 3IU5A 4J3IA 4ZC9A 5EICA 4PS5A 2OSSA 4BHWA 4QSQA 4KCXA 2H60A 4LYIA 5ENEA 5EVAA 1WUMA 3K2JA 4WIVA 2YEKA 5LJ2A 5DLZA 4LDFA 5D24A 3G0LA 4A9IA 5AMFA 4NRBA 4A9KA 5G4SA 5BT5A 4O70A 5KTUA
chains in the Genus database with same CATH superfamily
5IIDA 2DVVA 4YATA 5EPRA 4O72A 2RNWA 3UVDA 5FE0A 4LYSA 4FLPA 4UIUA 5DFCA 2E7OA 4LZ2A 4YH3A 5DYAA 5EPBA 2YQDA 5IG6A 5DBMA 5I89A 5DLXA 3AQAA 5C85A 4IR5A 5I40A 4TYLA 4PTBA 4Z93A 4CUTA 4IORA 5F25A 5A5NA 5FE4A 2N9GA 3TLPA 4LR6A 5HQ6A 4TQNA 4AI6A 2YDWA 2GRCA 4HBXA 5D3JA 5HFRA 4BJXA 4YYKA 4YY6A 5EWDA 4WHUA 4KV1A 2DATA 2D9EA 4QUTA 3MB3A 4OUFA 3O36A 5A82A 4QC1A 2R0VA 4F3IA 4LRGA 4TT4A 4BW2A 5I29A 4NYWA 5HM0A 3HMHA 4HXLA 4XUBA 5FH7A 5II2A 5DKDA 5A5PA 4QZSA 4IR3A 3LXJA 4O7BA 5KO4A 2L5EA 4QR4A 1X0JA 3MULA 4XYAA 4IOOA 5K29A 4O71A 2F6JA 3SVFA 5HRWA 3P1CA 4IOQA 2RO1A 4J1PA 4QB3A 4OGIA 4BW1A 5A5QA 4YYDA 5DKHA 5HELA 5A5RA 5LKUA 5FE7A 4LZRA 4NYXA 3RCWA 4QSSA 2FSAA 4PKLA 3U5PA 4UYDA 5D25A 5ENGA 5JWMA 4UIWA 2YELA 4MEOA 3S92A 5LVRA 3JVLA 4QSTA 5FE5A 5DKCA 4YBTA 4PY6A 5I1QA 4IR4A 5C8GA 3QZSA 5CUGA 3UV4A 5EU1A 4UITA 3U5JA 5EPSA 4YBMA 5KTXA 5E9VA 5F2PA 5CUCA 2WP1A 5LKXA 2R10A 4XY8A 5CTLA 5EISA 5CQTA 4QSPA 5DFDA 4GPJA 4CUSA 4QEWA 4YYMA 4YYIA 5EGUA 2RS9B 3QZTA 5LJ0A 5F36A 1EQFA 4NUCA 4UYEA 5FH6A 5D7XA 5HQ5A 2L85A 3MUKA 4NQMA 2YEMA 5FE2A 4Q0NA 3O37A 5H1UA 5FE1A 5FB1A 4AKHA 4TS8A 5LKZA 5CPEA 5A85A 5COIA 3Q2FA 5CUAA 4ALGA 4NUEA 2R0SA 5E7DA 5CY9A 5BT3A 4DONA 3SVGA 3O34A 5CQ4A 4O76A 4HXOA 5TCMA 5HEMA 3S91A 4C67A 1WUGA 5CU8A 4NS5A 3DWYA 3GG3A 4MR4A 5FH8A 4Z1QA 3UVXA 4AKGA 4WHWA 3JVJA 5C4QA 5A5SA 5CQ8A 4NXJA 5FG5A 4NRCA 3Q2EA 5DYXA 4YBSA 4MR5A 4N3WA 5D3PA 5ENIA 4QR3A 2R0YA 5F61A 5HFQA 3MQMA 4XUAA 4MEPA 3FKMX 4O7EA 4N4FA 5CZGA 3NXBA 5DX4A 4TT6A 4LZSA 4UYGA 4CUQA 3DAIA 5J0DA 2E7NA 5EWHA 4NQNA 4QSXA 3P1DA 5E3GA 5E74A 5E9MA 4MR3A 4QY4A 3U5KA 5A83A 4A9MA 5I80A 3UVYA 4HXRA 5I86A 2RI7A 4UIXA 2D82A 4YH4A 3I3JA 4NR6A 5EP7A 4CFKA 3MB4A 5FE9A 4CURA 4TU4A 5ENBA 5H1VA 5E9YA 3UVWA 4Z6IA 5H1TA 5HCLA 4TU6A 5DYUA 4O78A 2F6NA 4QYDA 5CUDA 3LJWA 5FE8A 3HMFA 5DY7A 5CQ5A 4RVRA 5LJ1A 5D3LA 5FG6A 4HXNA 4KV4A 3HMEA 5A81A 5D3HA 4CFLA 4O7AA 4QBMA 3LQHA 2YYNA 4MENA 2KTBB 5ENHA 4QEUA 5E3DA 1JSPB 5KTWA 5IGMA 5EI4A 2DWWA 5FBXA 2MJVB 4HXKA 1JM4B 5CS8A 5E73A 5E9IA 4HXPA 5IGKA 5I83A 5F5ZA 3VKHA 4J0SA 5CQ6A 4O75A 4NR7A 4NR9A 4XY9A 5FFYA 4PCIA 5FFVA 5KU3A 3P5OA 4A9NA 4A9FA 4LC2A 4ZW1A 4QEVA 4HBVA 4Z1SA 4O7FA 5CP5A 5EV9A 5JI8A 5LKTA 4CUPA 3ERRA 5ENJA 5CQ7A 5EA1A 4O7CA 4TZ2A 1E6IA 5FB0A 3G0JA 4BW4A 5ACYA 5LUUA 4UYHA 3JVMA 5F63A 2I8NA 5E0RA 4QR5A 5KHMA 3UV5A 5D3TA 3O35A 5ENCA 2RNXA 5D3SA 4QUUA 5CUEA 3IU6A 4QC3A 5L97A 5EM3A 3ZYUA 5EWWA 5L96A 5ETDA 3UV2A 4Q0OA 5DYCA 5C87A 5HJCA 4N4IA 3ONIA 5L8UA 4CUUA 4TTEA 4UYFA 3SVHA 4J0RA 5IGNA 5FE3A 2I7KA 3JVKA 3LQIA 5D3RA 4ALHA 5I7YA 2DVRA 4LYWA 5IBNA 5E9KA 5FG4A 3VKGA 2YW5A 3QZVA 1ZS5A 4AKNA 5EWVA 4N4HA 4UIZA 5CQAA 4YYJA 4NYVA 4NUDA 5F62A 4BW3A 5EWCA 1N72A 4NR4A 5FFWA 4ZQLA 5C89A 4NRAA 3AADA 4A9OA 4O77A 4UIYA 4Z6HA 4YADA 2RNYA 5ENFA 4QSVA 2DVSA 4QSRA 4UYFB 5BT4A 4YK0A 5C7NA 4HXSA 5II1A 5DW1A 4UIVA 5HRXA 4TT2A 5EQ1A 4C66A 5D0CA 5CQ3A 5LVQA 2LSPB 5AD2A 1PUOA 3D1BA 2L84A 3U5NA 4X2IA 5ETBA 4E96A 1F68A 5F60A 4YABA 4PCEA 5H85A 5CFWA 4TZ8A 4A9HA 2E3KA 5F1LA 4NR8A 5HRVA 3U5MA 2OO1A 5L99A 4HXMA 4IR6A 4NR5A 4MEQA 5CUBA 4QSUA 4CLBA 5CGPA 4O74A 4YYNA 2DKWA 5FDZA 5HLSA 4YAXA 4YC9A 4YYHA 3D7CA 3D1DA 5DW2A 4YY4A 4A9EA 4AKIA 2DVQA 5HENA 5CRMA 5HQ7A 4YYGA 2NXBA 3LQJA 2RFJA 4HBYA 4QNSA 3P1FA 3U5OA 5I7XA 3P1EA 5IGLA 3O33A 5F1HA 2OUOA 2G4AA 4QYLA 5D3NA 5D26A 5CRZA 4OGJA 5EK9A 5L98A 3UW9A 5E9LA 5I88A 4CL9A 4MR6A 4A9LA 5G4RA 5A7CA 3U5LA 5L8TA 5F3AA 4A9JA 4Y03A 2WP2A 4QSWA 5AMEA 5A5OA 4HBWA 5TB6A 5DFBA 1ZKRA 4N4GA 5FE6A 5AD3A 3MXFA 3IU5A 4J3IA 4ZC9A 5EICA 4PS5A 2OSSA 4BHWA 4QSQA 2EJNA 4KCXA 2H60A 4LYIA 5ENEA 5EVAA 1WUMA 3K2JA 4WIVA 2YEKA 5LJ2A 5DLZA 4LDFA 5D24A 3G0LA 4A9IA 5AMFA 4NRBA 4A9KA 5G4SA 5BT5A 4O70A 5KTUA
chains in the Genus database with same CATH topology
5IIDA 2DVVA 4YATA 5EPRA 4O72A 2RNWA 3UVDA 5FE0A 4LYSA 4FLPA 4UIUA 5DFCA 2E7OA 4LZ2A 4YH3A 5DYAA 5EPBA 2YQDA 5IG6A 5DBMA 5I89A 5DLXA 3AQAA 5C85A 4IR5A 5I40A 4TYLA 4PTBA 4Z93A 4CUTA 4IORA 5F25A 5A5NA 5FE4A 2N9GA 3TLPA 4LR6A 5HQ6A 4TQNA 2YDWA 2GRCA 4HBXA 5D3JA 5HFRA 4BJXA 4YYKA 4YY6A 5EWDA 4WHUA 4KV1A 2DATA 2D9EA 4QUTA 3MB3A 4OUFA 3O36A 5A82A 4QC1A 2R0VA 4F3IA 4LRGA 4TT4A 4BW2A 5I29A 4NYWA 5HM0A 3HMHA 4HXLA 4XUBA 5FH7A 5II2A 5DKDA 5A5PA 4QZSA 4IR3A 3LXJA 4O7BA 5KO4A 2L5EA 4QR4A 1X0JA 3MULA 4XYAA 4IOOA 5K29A 4O71A 2F6JA 3SVFA 5HRWA 3P1CA 4IOQA 2RO1A 4J1PA 4QB3A 4OGIA 4BW1A 5A5QA 4YYDA 5DKHA 5HELA 5A5RA 5LKUA 5FE7A 4LZRA 4NYXA 3RCWA 4QSSA 2FSAA 4PKLA 3U5PA 4UYDA 5D25A 5ENGA 5JWMA 4UIWA 2YELA 4MEOA 3S92A 5LVRA 3JVLA 4QSTA 5FE5A 5DKCA 4YBTA 4PY6A 5I1QA 4IR4A 5C8GA 3QZSA 5CUGA 3UV4A 5EU1A 4UITA 3U5JA 5EPSA 4YBMA 5KTXA 5E9VA 5F2PA 5CUCA 2WP1A 5LKXA 2R10A 4XY8A 5CTLA 5EISA 5CQTA 4QSPA 5DFDA 4GPJA 4CUSA 4QEWA 4YYMA 4YYIA 5EGUA 2RS9B 3QZTA 5LJ0A 5F36A 1EQFA 4NUCA 4UYEA 5FH6A 5D7XA 5HQ5A 2L85A 3MUKA 4NQMA 2YEMA 5FE2A 4Q0NA 3O37A 5H1UA 5FE1A 5FB1A 4TS8A 5LKZA 5CPEA 5A85A 5COIA 3Q2FA 5CUAA 4ALGA 4NUEA 2R0SA 5E7DA 5CY9A 5BT3A 4DONA 3SVGA 3O34A 5CQ4A 4O76A 4HXOA 5TCMA 5HEMA 3S91A 4C67A 1WUGA 5CU8A 4NS5A 3DWYA 3GG3A 4MR4A 5FH8A 4Z1QA 3UVXA 4WHWA 3JVJA 5C4QA 5A5SA 5CQ8A 4NXJA 5FG5A 4NRCA 3Q2EA 5DYXA 4YBSA 4MR5A 4N3WA 5D3PA 5ENIA 4QR3A 2R0YA 5F61A 5HFQA 3MQMA 4XUAA 4MEPA 3FKMX 4O7EA 4N4FA 5CZGA 3NXBA 5DX4A 4TT6A 4LZSA 4UYGA 4CUQA 3DAIA 5J0DA 2E7NA 5EWHA 4NQNA 4QSXA 3P1DA 5E3GA 5E74A 5E9MA 4MR3A 4QY4A 3U5KA 5A83A 4A9MA 5I80A 3UVYA 4HXRA 5I86A 2RI7A 4UIXA 2D82A 4YH4A 3I3JA 4NR6A 5EP7A 4CFKA 3MB4A 5FE9A 4CURA 4TU4A 5ENBA 5H1VA 5E9YA 3UVWA 4Z6IA 5H1TA 5HCLA 4TU6A 5DYUA 4O78A 2F6NA 4QYDA 5CUDA 3LJWA 5FE8A 3HMFA 5DY7A 5CQ5A 4RVRA 5LJ1A 5D3LA 5FG6A 4HXNA 4KV4A 3HMEA 5A81A 5D3HA 4CFLA 4O7AA 4QBMA 3LQHA 2YYNA 4MENA 2KTBB 5ENHA 4QEUA 5E3DA 1JSPB 5KTWA 5IGMA 5EI4A 2DWWA 5FBXA 2MJVB 4HXKA 1JM4B 5CS8A 5E73A 5E9IA 4HXPA 5IGKA 5I83A 5F5ZA 4J0SA 5CQ6A 4O75A 4NR7A 4NR9A 4XY9A 5FFYA 4PCIA 5FFVA 5KU3A 3P5OA 4A9NA 4A9FA 4LC2A 4ZW1A 4QEVA 4HBVA 4Z1SA 4O7FA 5CP5A 5EV9A 5JI8A 5LKTA 4CUPA 5ENJA 5CQ7A 5EA1A 4O7CA 4TZ2A 1E6IA 5FB0A 3G0JA 4BW4A 5ACYA 5LUUA 4UYHA 3JVMA 5F63A 2I8NA 5E0RA 4QR5A 5KHMA 3UV5A 5D3TA 3O35A 5ENCA 2RNXA 5D3SA 4QUUA 5CUEA 3IU6A 4QC3A 5L97A 5EM3A 3ZYUA 5EWWA 5L96A 5ETDA 3UV2A 4Q0OA 5DYCA 5C87A 5HJCA 4N4IA 3ONIA 5L8UA 4CUUA 4TTEA 4UYFA 3SVHA 4J0RA 5IGNA 5FE3A 2I7KA 3JVKA 3LQIA 5D3RA 4ALHA 5I7YA 2DVRA 4LYWA 5IBNA 5E9KA 5FG4A 2YW5A 3QZVA 1ZS5A 4AKNA 5EWVA 4N4HA 4UIZA 5CQAA 4YYJA 4NYVA 4NUDA 5F62A 4BW3A 5EWCA 1N72A 4NR4A 5FFWA 4ZQLA 5C89A 4NRAA 3AADA 4A9OA 4O77A 4UIYA 4Z6HA 4YADA 2RNYA 5ENFA 4QSVA 2DVSA 4QSRA 4UYFB 5BT4A 4YK0A 5C7NA 4HXSA 5II1A 5DW1A 4UIVA 5HRXA 4TT2A 5EQ1A 4C66A 5D0CA 5CQ3A 5LVQA 2LSPB 5AD2A 2L84A 3U5NA 4X2IA 5ETBA 4E96A 1F68A 5F60A 4YABA 4PCEA 5H85A 5CFWA 4TZ8A 4A9HA 2E3KA 5F1LA 4NR8A 5HRVA 3U5MA 2OO1A 5L99A 4HXMA 4IR6A 4NR5A 4MEQA 5CUBA 4QSUA 4CLBA 5CGPA 4O74A 4YYNA 2DKWA 5FDZA 5HLSA 4YAXA 4YC9A 4YYHA 3D7CA 5DW2A 4YY4A 4A9EA 2DVQA 5HENA 5CRMA 5HQ7A 4YYGA 2NXBA 3LQJA 2RFJA 4HBYA 4QNSA 3P1FA 3U5OA 5I7XA 3P1EA 5IGLA 3O33A 5F1HA 2OUOA 2G4AA 4QYLA 5D3NA 5D26A 5CRZA 4OGJA 5EK9A 5L98A 3UW9A 5E9LA 5I88A 4CL9A 4MR6A 4A9LA 5G4RA 5A7CA 3U5LA 5L8TA 5F3AA 4A9JA 4Y03A 2WP2A 4QSWA 5AMEA 5A5OA 4HBWA 5TB6A 5DFBA 4N4GA 5FE6A 5AD3A 3MXFA 3IU5A 4J3IA 4ZC9A 5EICA 4PS5A 2OSSA 4BHWA 4QSQA 4KCXA 2H60A 4LYIA 5ENEA 5EVAA 1WUMA 3K2JA 4WIVA 2YEKA 5LJ2A 5DLZA 4LDFA 5D24A 3G0LA 4A9IA 5AMFA 4NRBA 4A9KA 5G4SA 5BT5A 4O70A 5KTUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IID A;  2DVV A;  4YAT A;  5EPR A;  4O72 A;  2RNW A;  3UVD A;  5FE0 A;  4LYS A;  4FLP A;  4UIU A;  5DFC A;  2E7O A;  4LZ2 A;  4YH3 A;  5DYA A;  5EPB A;  2YQD A;  5IG6 A;  5DBM A;  5I89 A;  5DLX A;  3AQA A;  5C85 A;  4IR5 A;  5I40 A;  4TYL A;  4PTB A;  4Z93 A;  4CUT A;  4IOR A;  5F25 A;  5A5N A;  5FE4 A;  2N9G A;  3TLP A;  4LR6 A;  5HQ6 A;  4TQN A;  2YDW A;  2GRC A;  4HBX A;  5D3J A;  5HFR A;  4BJX A;  4YYK A;  4YY6 A;  5EWD A;  4WHU A;  4KV1 A;  2DAT A;  2D9E A;  4QUT A;  3MB3 A;  4OUF A;  3O36 A;  5A82 A;  4QC1 A;  2R0V A;  4F3I A;  4LRG A;  4TT4 A;  4BW2 A;  5I29 A;  4NYW A;  5HM0 A;  3HMH A;  4HXL A;  4XUB A;  5FH7 A;  5II2 A;  5DKD A;  5A5P A;  4QZS A;  4IR3 A;  3LXJ A;  4O7B A;  5KO4 A;  2L5E A;  4QR4 A;  1X0J A;  3MUL A;  4XYA A;  4IOO A;  5K29 A;  4O71 A;  2F6J A;  3SVF A;  5HRW A;  3P1C A;  4IOQ A;  2RO1 A;  4J1P A;  4QB3 A;  4OGI A;  4BW1 A;  5A5Q A;  4YYD A;  5DKH A;  5HEL A;  5A5R A;  5LKU A;  5FE7 A;  4LZR A;  4NYX A;  3RCW A;  4QSS A;  2FSA A;  4PKL A;  3U5P A;  4UYD A;  5D25 A;  5ENG A;  5JWM A;  4UIW A;  2YEL A;  4MEO A;  3S92 A;  5LVR A;  3JVL A;  4QST A;  5FE5 A;  5DKC A;  4YBT A;  4PY6 A;  5I1Q A;  4IR4 A;  5C8G A;  3QZS A;  5CUG A;  3UV4 A;  5EU1 A;  4UIT A;  3U5J A;  5EPS A;  4YBM A;  5KTX A;  5E9V A;  5F2P A;  5CUC A;  2WP1 A;  5LKX A;  2R10 A;  4XY8 A;  5CTL A;  5EIS A;  5CQT A;  4QSP A;  5DFD A;  4GPJ A;  4CUS A;  4QEW A;  4YYM A;  4YYI A;  5EGU A;  2RS9 B;  3QZT A;  5LJ0 A;  5F36 A;  1EQF A;  4NUC A;  4UYE A;  5FH6 A;  5D7X A;  5HQ5 A;  2L85 A;  3MUK A;  4NQM A;  2YEM A;  5FE2 A;  4Q0N A;  3O37 A;  5H1U A;  5FE1 A;  5FB1 A;  4TS8 A;  5LKZ A;  5CPE A;  5A85 A;  5COI A;  3Q2F A;  5CUA A;  4ALG A;  4NUE A;  2R0S A;  5E7D A;  5CY9 A;  5BT3 A;  4DON A;  3SVG A;  3O34 A;  5CQ4 A;  4O76 A;  4HXO A;  5TCM A;  5HEM A;  3S91 A;  4C67 A;  1WUG A;  5CU8 A;  4NS5 A;  3DWY A;  3GG3 A;  4MR4 A;  5FH8 A;  4Z1Q A;  3UVX A;  4WHW A;  3JVJ A;  5C4Q A;  5A5S A;  5CQ8 A;  4NXJ A;  5FG5 A;  4NRC A;  3Q2E A;  5DYX A;  4YBS A;  4MR5 A;  4N3W A;  5D3P A;  5ENI A;  4QR3 A;  2R0Y A;  5F61 A;  5HFQ A;  3MQM A;  4XUA A;  4MEP A;  3FKM X;  4O7E A;  4N4F A;  5CZG A;  3NXB A;  5DX4 A;  4TT6 A;  4LZS A;  4UYG A;  4CUQ A;  3DAI A;  5J0D A;  2E7N A;  5EWH A;  4NQN A;  4QSX A;  3P1D A;  5E3G A;  5E74 A;  5E9M A;  4MR3 A;  4QY4 A;  3U5K A;  5A83 A;  4A9M A;  5I80 A;  3UVY A;  4HXR A;  5I86 A;  2RI7 A;  4UIX A;  2D82 A;  4YH4 A;  3I3J A;  4NR6 A;  5EP7 A;  4CFK A;  3MB4 A;  5FE9 A;  4CUR A;  4TU4 A;  5ENB A;  5H1V A;  5E9Y A;  3UVW A;  4Z6I A;  5H1T A;  5HCL A;  4TU6 A;  5DYU A;  4O78 A;  2F6N A;  4QYD A;  5CUD A;  3LJW A;  5FE8 A;  3HMF A;  5DY7 A;  5CQ5 A;  4RVR A;  5LJ1 A;  5D3L A;  5FG6 A;  4HXN A;  4KV4 A;  3HME A;  5A81 A;  5D3H A;  4CFL A;  4O7A A;  4QBM A;  3LQH A;  2YYN A;  4MEN A;  2KTB B;  5ENH A;  4QEU A;  5E3D A;  1JSP B;  5KTW A;  5IGM A;  5EI4 A;  2DWW A;  5FBX A;  2MJV B;  4HXK A;  1JM4 B;  5CS8 A;  5E73 A;  5E9I A;  4HXP A;  5IGK A;  5I83 A;  5F5Z A;  4J0S A;  5CQ6 A;  4O75 A;  4NR7 A;  4NR9 A;  4XY9 A;  5FFY A;  4PCI A;  5FFV A;  5KU3 A;  3P5O A;  4A9N A;  4A9F A;  4LC2 A;  4ZW1 A;  4QEV A;  4HBV A;  4Z1S A;  4O7F A;  5CP5 A;  5EV9 A;  5JI8 A;  5LKT A;  4CUP A;  5ENJ A;  5CQ7 A;  5EA1 A;  4O7C A;  4TZ2 A;  1E6I A;  5FB0 A;  3G0J A;  4BW4 A;  5ACY A;  5LUU A;  4UYH A;  3JVM A;  5F63 A;  2I8N A;  5E0R A;  4QR5 A;  5KHM A;  3UV5 A;  5D3T A;  3O35 A;  5ENC A;  2RNX A;  5D3S A;  4QUU A;  5CUE A;  3IU6 A;  4QC3 A;  5L97 A;  5EM3 A;  3ZYU A;  5EWW A;  5L96 A;  5ETD A;  3UV2 A;  4Q0O A;  5DYC A;  5C87 A;  5HJC A;  4N4I A;  3ONI A;  5L8U A;  4CUU A;  4TTE A;  4UYF A;  3SVH A;  4J0R A;  5IGN A;  5FE3 A;  2I7K A;  3JVK A;  3LQI A;  5D3R A;  4ALH A;  5I7Y A;  2DVR A;  4LYW A;  5IBN A;  5E9K A;  5FG4 A;  2YW5 A;  3QZV A;  1ZS5 A;  4AKN A;  5EWV A;  4N4H A;  4UIZ A;  5CQA A;  4YYJ A;  4NYV A;  4NUD A;  5F62 A;  4BW3 A;  5EWC A;  1N72 A;  4NR4 A;  5FFW A;  4ZQL A;  5C89 A;  4NRA A;  3AAD A;  4A9O A;  4O77 A;  4UIY A;  4Z6H A;  4YAD A;  2RNY A;  5ENF A;  4QSV A;  2DVS A;  4QSR A;  4UYF B;  5BT4 A;  4YK0 A;  5C7N A;  4HXS A;  5II1 A;  5DW1 A;  4UIV A;  5HRX A;  4TT2 A;  5EQ1 A;  4C66 A;  5D0C A;  5CQ3 A;  5LVQ A;  2LSP B;  5AD2 A;  2L84 A;  3U5N A;  4X2I A;  5ETB A;  4E96 A;  1F68 A;  5F60 A;  4YAB A;  4PCE A;  5H85 A;  5CFW A;  4TZ8 A;  4A9H A;  2E3K A;  5F1L A;  4NR8 A;  5HRV A;  3U5M A;  2OO1 A;  5L99 A;  4HXM A;  4IR6 A;  4NR5 A;  4MEQ A;  5CUB A;  4QSU A;  4CLB A;  5CGP A;  4O74 A;  4YYN A;  2DKW A;  5FDZ A;  5HLS A;  4YAX A;  4YC9 A;  4YYH A;  3D7C A;  5DW2 A;  4YY4 A;  4A9E A;  2DVQ A;  5HEN A;  5CRM A;  5HQ7 A;  4YYG A;  2NXB A;  3LQJ A;  2RFJ A;  4HBY A;  4QNS A;  3P1F A;  3U5O A;  5I7X A;  3P1E A;  5IGL A;  3O33 A;  5F1H A;  2OUO A;  2G4A A;  4QYL A;  5D3N A;  5D26 A;  5CRZ A;  4OGJ A;  5EK9 A;  5L98 A;  3UW9 A;  5E9L A;  5I88 A;  4CL9 A;  4MR6 A;  4A9L A;  5G4R A;  5A7C A;  3U5L A;  5L8T A;  5F3A A;  4A9J A;  4Y03 A;  2WP2 A;  4QSW A;  5AME A;  5A5O A;  4HBW A;  5TB6 A;  5DFB A;  4N4G A;  5FE6 A;  5AD3 A;  3MXF A;  3IU5 A;  4J3I A;  4ZC9 A;  5EIC A;  4PS5 A;  2OSS A;  4BHW A;  4QSQ A;  4KCX A;  2H60 A;  4LYI A;  5ENE A;  5EVA A;  1WUM A;  3K2J A;  4WIV A;  2YEK A;  5LJ2 A;  5DLZ A;  4LDF A;  5D24 A;  3G0L A;  4A9I A;  5AMF A;  4NRB A;  4A9K A;  5G4S A;  5BT5 A;  4O70 A;  5KTU A; 
#chains in the Genus database with same CATH topology
 5IID A;  2DVV A;  4YAT A;  5EPR A;  4O72 A;  2RNW A;  3UVD A;  5FE0 A;  4LYS A;  4FLP A;  4UIU A;  5DFC A;  2E7O A;  4LZ2 A;  4YH3 A;  5DYA A;  5EPB A;  2YQD A;  5IG6 A;  5DBM A;  5I89 A;  5DLX A;  3AQA A;  5C85 A;  4IR5 A;  5I40 A;  4TYL A;  4PTB A;  4Z93 A;  4CUT A;  4IOR A;  5F25 A;  5A5N A;  5FE4 A;  2N9G A;  3TLP A;  4LR6 A;  5HQ6 A;  4TQN A;  4AI6 A;  2YDW A;  2GRC A;  4HBX A;  5D3J A;  5HFR A;  4BJX A;  4YYK A;  4YY6 A;  5EWD A;  4WHU A;  4KV1 A;  2DAT A;  2D9E A;  4QUT A;  3MB3 A;  4OUF A;  3O36 A;  5A82 A;  4QC1 A;  2R0V A;  4F3I A;  4LRG A;  4TT4 A;  4BW2 A;  5I29 A;  4NYW A;  5HM0 A;  3HMH A;  4HXL A;  4XUB A;  5FH7 A;  5II2 A;  5DKD A;  5A5P A;  4QZS A;  4IR3 A;  3LXJ A;  4O7B A;  5KO4 A;  2L5E A;  4QR4 A;  1X0J A;  3MUL A;  4XYA A;  4IOO A;  5K29 A;  4O71 A;  2F6J A;  3SVF A;  5HRW A;  3P1C A;  4IOQ A;  2RO1 A;  4J1P A;  4QB3 A;  4OGI A;  4BW1 A;  5A5Q A;  4YYD A;  5DKH A;  5HEL A;  5A5R A;  5LKU A;  5FE7 A;  4LZR A;  4NYX A;  3RCW A;  4QSS A;  2FSA A;  4PKL A;  3U5P A;  4UYD A;  5D25 A;  5ENG A;  5JWM A;  4UIW A;  2YEL A;  4MEO A;  3S92 A;  5LVR A;  3JVL A;  4QST A;  5FE5 A;  5DKC A;  4YBT A;  4PY6 A;  5I1Q A;  4IR4 A;  5C8G A;  3QZS A;  5CUG A;  3UV4 A;  5EU1 A;  4UIT A;  3U5J A;  5EPS A;  4YBM A;  5KTX A;  5E9V A;  5F2P A;  5CUC A;  2WP1 A;  5LKX A;  2R10 A;  4XY8 A;  5CTL A;  5EIS A;  5CQT A;  4QSP A;  5DFD A;  4GPJ A;  4CUS A;  4QEW A;  4YYM A;  4YYI A;  5EGU A;  2RS9 B;  3QZT A;  5LJ0 A;  5F36 A;  1EQF A;  4NUC A;  4UYE A;  5FH6 A;  5D7X A;  5HQ5 A;  2L85 A;  3MUK A;  4NQM A;  2YEM A;  5FE2 A;  4Q0N A;  3O37 A;  5H1U A;  5FE1 A;  5FB1 A;  4AKH A;  4TS8 A;  5LKZ A;  5CPE A;  5A85 A;  5COI A;  3Q2F A;  5CUA A;  4ALG A;  4NUE A;  2R0S A;  5E7D A;  5CY9 A;  5BT3 A;  4DON A;  3SVG A;  3O34 A;  5CQ4 A;  4O76 A;  4HXO A;  5TCM A;  5HEM A;  3S91 A;  4C67 A;  1WUG A;  5CU8 A;  4NS5 A;  3DWY A;  3GG3 A;  4MR4 A;  5FH8 A;  4Z1Q A;  3UVX A;  4AKG A;  4WHW A;  3JVJ A;  5C4Q A;  5A5S A;  5CQ8 A;  4NXJ A;  5FG5 A;  4NRC A;  3Q2E A;  5DYX A;  4YBS A;  4MR5 A;  4N3W A;  5D3P A;  5ENI A;  4QR3 A;  2R0Y A;  5F61 A;  5HFQ A;  3MQM A;  4XUA A;  4MEP A;  3FKM X;  4O7E A;  4N4F A;  5CZG A;  3NXB A;  5DX4 A;  4TT6 A;  4LZS A;  4UYG A;  4CUQ A;  3DAI A;  5J0D A;  2E7N A;  5EWH A;  4NQN A;  4QSX A;  3P1D A;  5E3G A;  5E74 A;  5E9M A;  4MR3 A;  4QY4 A;  3U5K A;  5A83 A;  4A9M A;  5I80 A;  3UVY A;  4HXR A;  5I86 A;  2RI7 A;  4UIX A;  2D82 A;  4YH4 A;  3I3J A;  4NR6 A;  5EP7 A;  4CFK A;  3MB4 A;  5FE9 A;  4CUR A;  4TU4 A;  5ENB A;  5H1V A;  5E9Y A;  3UVW A;  4Z6I A;  5H1T A;  5HCL A;  4TU6 A;  5DYU A;  4O78 A;  2F6N A;  4QYD A;  5CUD A;  3LJW A;  5FE8 A;  3HMF A;  5DY7 A;  5CQ5 A;  4RVR A;  5LJ1 A;  5D3L A;  5FG6 A;  4HXN A;  4KV4 A;  3HME A;  5A81 A;  5D3H A;  4CFL A;  4O7A A;  4QBM A;  3LQH A;  2YYN A;  4MEN A;  2KTB B;  5ENH A;  4QEU A;  5E3D A;  1JSP B;  5KTW A;  5IGM A;  5EI4 A;  2DWW A;  5FBX A;  2MJV B;  4HXK A;  1JM4 B;  5CS8 A;  5E73 A;  5E9I A;  4HXP A;  5IGK A;  5I83 A;  5F5Z A;  3VKH A;  4J0S A;  5CQ6 A;  4O75 A;  4NR7 A;  4NR9 A;  4XY9 A;  5FFY A;  4PCI A;  5FFV A;  5KU3 A;  3P5O A;  4A9N A;  4A9F A;  4LC2 A;  4ZW1 A;  4QEV A;  4HBV A;  4Z1S A;  4O7F A;  5CP5 A;  5EV9 A;  5JI8 A;  5LKT A;  4CUP A;  3ERR A;  5ENJ A;  5CQ7 A;  5EA1 A;  4O7C A;  4TZ2 A;  1E6I A;  5FB0 A;  3G0J A;  4BW4 A;  5ACY A;  5LUU A;  4UYH A;  3JVM A;  5F63 A;  2I8N A;  5E0R A;  4QR5 A;  5KHM A;  3UV5 A;  5D3T A;  3O35 A;  5ENC A;  2RNX A;  5D3S A;  4QUU A;  5CUE A;  3IU6 A;  4QC3 A;  5L97 A;  5EM3 A;  3ZYU A;  5EWW A;  5L96 A;  5ETD A;  3UV2 A;  4Q0O A;  5DYC A;  5C87 A;  5HJC A;  4N4I A;  3ONI A;  5L8U A;  4CUU A;  4TTE A;  4UYF A;  3SVH A;  4J0R A;  5IGN A;  5FE3 A;  2I7K A;  3JVK A;  3LQI A;  5D3R A;  4ALH A;  5I7Y A;  2DVR A;  4LYW A;  5IBN A;  5E9K A;  5FG4 A;  3VKG A;  2YW5 A;  3QZV A;  1ZS5 A;  4AKN A;  5EWV A;  4N4H A;  4UIZ A;  5CQA A;  4YYJ A;  4NYV A;  4NUD A;  5F62 A;  4BW3 A;  5EWC A;  1N72 A;  4NR4 A;  5FFW A;  4ZQL A;  5C89 A;  4NRA A;  3AAD A;  4A9O A;  4O77 A;  4UIY A;  4Z6H A;  4YAD A;  2RNY A;  5ENF A;  4QSV A;  2DVS A;  4QSR A;  4UYF B;  5BT4 A;  4YK0 A;  5C7N A;  4HXS A;  5II1 A;  5DW1 A;  4UIV A;  5HRX A;  4TT2 A;  5EQ1 A;  4C66 A;  5D0C A;  5CQ3 A;  5LVQ A;  2LSP B;  5AD2 A;  1PUO A;  3D1B A;  2L84 A;  3U5N A;  4X2I A;  5ETB A;  4E96 A;  1F68 A;  5F60 A;  4YAB A;  4PCE A;  5H85 A;  5CFW A;  4TZ8 A;  4A9H A;  2E3K A;  5F1L A;  4NR8 A;  5HRV A;  3U5M A;  2OO1 A;  5L99 A;  4HXM A;  4IR6 A;  4NR5 A;  4MEQ A;  5CUB A;  4QSU A;  4CLB A;  5CGP A;  4O74 A;  4YYN A;  2DKW A;  5FDZ A;  5HLS A;  4YAX A;  4YC9 A;  4YYH A;  3D7C A;  3D1D A;  5DW2 A;  4YY4 A;  4A9E A;  4AKI A;  2DVQ A;  5HEN A;  5CRM A;  5HQ7 A;  4YYG A;  2NXB A;  3LQJ A;  2RFJ A;  4HBY A;  4QNS A;  3P1F A;  3U5O A;  5I7X A;  3P1E A;  5IGL A;  3O33 A;  5F1H A;  2OUO A;  2G4A A;  4QYL A;  5D3N A;  5D26 A;  5CRZ A;  4OGJ A;  5EK9 A;  5L98 A;  3UW9 A;  5E9L A;  5I88 A;  4CL9 A;  4MR6 A;  4A9L A;  5G4R A;  5A7C A;  3U5L A;  5L8T A;  5F3A A;  4A9J A;  4Y03 A;  2WP2 A;  4QSW A;  5AME A;  5A5O A;  4HBW A;  5TB6 A;  5DFB A;  1ZKR A;  4N4G A;  5FE6 A;  5AD3 A;  3MXF A;  3IU5 A;  4J3I A;  4ZC9 A;  5EIC A;  4PS5 A;  2OSS A;  4BHW A;  4QSQ A;  2EJN A;  4KCX A;  2H60 A;  4LYI A;  5ENE A;  5EVA A;  1WUM A;  3K2J A;  4WIV A;  2YEK A;  5LJ2 A;  5DLZ A;  4LDF A;  5D24 A;  3G0L A;  4A9I A;  5AMF A;  4NRB A;  4A9K A;  5G4S A;  5BT5 A;  4O70 A;  5KTU A; 
#chains in the Genus database with same CATH homology
 5IID A;  2DVV A;  4YAT A;  5EPR A;  4O72 A;  2RNW A;  3UVD A;  5FE0 A;  4LYS A;  4FLP A;  4UIU A;  5DFC A;  2E7O A;  4LZ2 A;  4YH3 A;  5DYA A;  5EPB A;  2YQD A;  5IG6 A;  5DBM A;  5I89 A;  5DLX A;  3AQA A;  5C85 A;  4IR5 A;  5I40 A;  4TYL A;  4PTB A;  4Z93 A;  4CUT A;  4IOR A;  5F25 A;  5A5N A;  5FE4 A;  2N9G A;  3TLP A;  4LR6 A;  5HQ6 A;  4TQN A;  2YDW A;  2GRC A;  4HBX A;  5D3J A;  5HFR A;  4BJX A;  4YYK A;  4YY6 A;  5EWD A;  4WHU A;  4KV1 A;  2DAT A;  2D9E A;  4QUT A;  3MB3 A;  4OUF A;  3O36 A;  5A82 A;  4QC1 A;  2R0V A;  4F3I A;  4LRG A;  4TT4 A;  4BW2 A;  5I29 A;  4NYW A;  5HM0 A;  3HMH A;  4HXL A;  4XUB A;  5FH7 A;  5II2 A;  5DKD A;  5A5P A;  4QZS A;  4IR3 A;  3LXJ A;  4O7B A;  5KO4 A;  2L5E A;  4QR4 A;  1X0J A;  3MUL A;  4XYA A;  4IOO A;  5K29 A;  4O71 A;  2F6J A;  3SVF A;  5HRW A;  3P1C A;  4IOQ A;  2RO1 A;  4J1P A;  4QB3 A;  4OGI A;  4BW1 A;  5A5Q A;  4YYD A;  5DKH A;  5HEL A;  5A5R A;  5LKU A;  5FE7 A;  4LZR A;  4NYX A;  3RCW A;  4QSS A;  2FSA A;  4PKL A;  3U5P A;  4UYD A;  5D25 A;  5ENG A;  5JWM A;  4UIW A;  2YEL A;  4MEO A;  3S92 A;  5LVR A;  3JVL A;  4QST A;  5FE5 A;  5DKC A;  4YBT A;  4PY6 A;  5I1Q A;  4IR4 A;  5C8G A;  3QZS A;  5CUG A;  3UV4 A;  5EU1 A;  4UIT A;  3U5J A;  5EPS A;  4YBM A;  5KTX A;  5E9V A;  5F2P A;  5CUC A;  2WP1 A;  5LKX A;  2R10 A;  4XY8 A;  5CTL A;  5EIS A;  5CQT A;  4QSP A;  5DFD A;  4GPJ A;  4CUS A;  4QEW A;  4YYM A;  4YYI A;  5EGU A;  2RS9 B;  3QZT A;  5LJ0 A;  5F36 A;  1EQF A;  4NUC A;  4UYE A;  5FH6 A;  5D7X A;  5HQ5 A;  2L85 A;  3MUK A;  4NQM A;  2YEM A;  5FE2 A;  4Q0N A;  3O37 A;  5H1U A;  5FE1 A;  5FB1 A;  4TS8 A;  5LKZ A;  5CPE A;  5A85 A;  5COI A;  3Q2F A;  5CUA A;  4ALG A;  4NUE A;  2R0S A;  5E7D A;  5CY9 A;  5BT3 A;  4DON A;  3SVG A;  3O34 A;  5CQ4 A;  4O76 A;  4HXO A;  5TCM A;  5HEM A;  3S91 A;  4C67 A;  1WUG A;  5CU8 A;  4NS5 A;  3DWY A;  3GG3 A;  4MR4 A;  5FH8 A;  4Z1Q A;  3UVX A;  4WHW A;  3JVJ A;  5C4Q A;  5A5S A;  5CQ8 A;  4NXJ A;  5FG5 A;  4NRC A;  3Q2E A;  5DYX A;  4YBS A;  4MR5 A;  4N3W A;  5D3P A;  5ENI A;  4QR3 A;  2R0Y A;  5F61 A;  5HFQ A;  3MQM A;  4XUA A;  4MEP A;  3FKM X;  4O7E A;  4N4F A;  5CZG A;  3NXB A;  5DX4 A;  4TT6 A;  4LZS A;  4UYG A;  4CUQ A;  3DAI A;  5J0D A;  2E7N A;  5EWH A;  4NQN A;  4QSX A;  3P1D A;  5E3G A;  5E74 A;  5E9M A;  4MR3 A;  4QY4 A;  3U5K A;  5A83 A;  4A9M A;  5I80 A;  3UVY A;  4HXR A;  5I86 A;  2RI7 A;  4UIX A;  2D82 A;  4YH4 A;  3I3J A;  4NR6 A;  5EP7 A;  4CFK A;  3MB4 A;  5FE9 A;  4CUR A;  4TU4 A;  5ENB A;  5H1V A;  5E9Y A;  3UVW A;  4Z6I A;  5H1T A;  5HCL A;  4TU6 A;  5DYU A;  4O78 A;  2F6N A;  4QYD A;  5CUD A;  3LJW A;  5FE8 A;  3HMF A;  5DY7 A;  5CQ5 A;  4RVR A;  5LJ1 A;  5D3L A;  5FG6 A;  4HXN A;  4KV4 A;  3HME A;  5A81 A;  5D3H A;  4CFL A;  4O7A A;  4QBM A;  3LQH A;  2YYN A;  4MEN A;  2KTB B;  5ENH A;  4QEU A;  5E3D A;  1JSP B;  5KTW A;  5IGM A;  5EI4 A;  2DWW A;  5FBX A;  2MJV B;  4HXK A;  1JM4 B;  5CS8 A;  5E73 A;  5E9I A;  4HXP A;  5IGK A;  5I83 A;  5F5Z A;  4J0S A;  5CQ6 A;  4O75 A;  4NR7 A;  4NR9 A;  4XY9 A;  5FFY A;  4PCI A;  5FFV A;  5KU3 A;  3P5O A;  4A9N A;  4A9F A;  4LC2 A;  4ZW1 A;  4QEV A;  4HBV A;  4Z1S A;  4O7F A;  5CP5 A;  5EV9 A;  5JI8 A;  5LKT A;  4CUP A;  5ENJ A;  5CQ7 A;  5EA1 A;  4O7C A;  4TZ2 A;  1E6I A;  5FB0 A;  3G0J A;  4BW4 A;  5ACY A;  5LUU A;  4UYH A;  3JVM A;  5F63 A;  2I8N A;  5E0R A;  4QR5 A;  5KHM A;  3UV5 A;  5D3T A;  3O35 A;  5ENC A;  2RNX A;  5D3S A;  4QUU A;  5CUE A;  3IU6 A;  4QC3 A;  5L97 A;  5EM3 A;  3ZYU A;  5EWW A;  5L96 A;  5ETD A;  3UV2 A;  4Q0O A;  5DYC A;  5C87 A;  5HJC A;  4N4I A;  3ONI A;  5L8U A;  4CUU A;  4TTE A;  4UYF A;  3SVH A;  4J0R A;  5IGN A;  5FE3 A;  2I7K A;  3JVK A;  3LQI A;  5D3R A;  4ALH A;  5I7Y A;  2DVR A;  4LYW A;  5IBN A;  5E9K A;  5FG4 A;  2YW5 A;  3QZV A;  1ZS5 A;  4AKN A;  5EWV A;  4N4H A;  4UIZ A;  5CQA A;  4YYJ A;  4NYV A;  4NUD A;  5F62 A;  4BW3 A;  5EWC A;  1N72 A;  4NR4 A;  5FFW A;  4ZQL A;  5C89 A;  4NRA A;  3AAD A;  4A9O A;  4O77 A;  4UIY A;  4Z6H A;  4YAD A;  2RNY A;  5ENF A;  4QSV A;  2DVS A;  4QSR A;  4UYF B;  5BT4 A;  4YK0 A;  5C7N A;  4HXS A;  5II1 A;  5DW1 A;  4UIV A;  5HRX A;  4TT2 A;  5EQ1 A;  4C66 A;  5D0C A;  5CQ3 A;  5LVQ A;  2LSP B;  5AD2 A;  2L84 A;  3U5N A;  4X2I A;  5ETB A;  4E96 A;  1F68 A;  5F60 A;  4YAB A;  4PCE A;  5H85 A;  5CFW A;  4TZ8 A;  4A9H A;  2E3K A;  5F1L A;  4NR8 A;  5HRV A;  3U5M A;  2OO1 A;  5L99 A;  4HXM A;  4IR6 A;  4NR5 A;  4MEQ A;  5CUB A;  4QSU A;  4CLB A;  5CGP A;  4O74 A;  4YYN A;  2DKW A;  5FDZ A;  5HLS A;  4YAX A;  4YC9 A;  4YYH A;  3D7C A;  5DW2 A;  4YY4 A;  4A9E A;  2DVQ A;  5HEN A;  5CRM A;  5HQ7 A;  4YYG A;  2NXB A;  3LQJ A;  2RFJ A;  4HBY A;  4QNS A;  3P1F A;  3U5O A;  5I7X A;  3P1E A;  5IGL A;  3O33 A;  5F1H A;  2OUO A;  2G4A A;  4QYL A;  5D3N A;  5D26 A;  5CRZ A;  4OGJ A;  5EK9 A;  5L98 A;  3UW9 A;  5E9L A;  5I88 A;  4CL9 A;  4MR6 A;  4A9L A;  5G4R A;  5A7C A;  3U5L A;  5L8T A;  5F3A A;  4A9J A;  4Y03 A;  2WP2 A;  4QSW A;  5AME A;  5A5O A;  4HBW A;  5TB6 A;  5DFB A;  4N4G A;  5FE6 A;  5AD3 A;  3MXF A;  3IU5 A;  4J3I A;  4ZC9 A;  5EIC A;  4PS5 A;  2OSS A;  4BHW A;  4QSQ A;  4KCX A;  2H60 A;  4LYI A;  5ENE A;  5EVA A;  1WUM A;  3K2J A;  4WIV A;  2YEK A;  5LJ2 A;  5DLZ A;  4LDF A;  5D24 A;  3G0L A;  4A9I A;  5AMF A;  4NRB A;  4A9K A;  5G4S A;  5BT5 A;  4O70 A;  5KTU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...