4YK0A

Crystal structure of the cbp bromodomain in complex with cpi098
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
113
structure length
113
Chain Sequence
b'IFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CREB-binding protein
publication title Regulatory T Cell Modulation by CBP/EP300 Bromodomain Inhibition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 38
structure length 113
sequence length 113
chains with identical sequence B, C, D
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2015-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4yk0A00
5FG6A 4NRBA 2FSAA 4UIUA 4YYHA 4Y03A 4NR8A 5E9IA 3U5PA 2I8NA 5A5QA 5HELA 4NYWA 4QSUA 5TB6A 4BW4A 5CZGA 4O7AA 3NXBA 2YDWA 5E9VA 5IGMA 5DYAA 3U5MA 5CRZA 5FE8A 4YH4A 4CURA 5CQTA 5C85A 4WHUA 5A82A 5LKTA 1WUGA 4IR5A 5EWVA 5FG5A 4X2IA 5EQ1A 5HQ6A 2RI7A 5D26A 4YYNA 3P5OA 3D7CA 5L97A 4Q0OA 2OO1A 5I1QA 5CQ7A 3MUKA 5A81A 4WIVA 5DY7A 5LKUA 4QEVA 5KHMA 5F5ZA 5A5OA 5E9YA 3SVGA 5HENA 5K29A 5HRWA 4O74A 5F1LA 5CQAA 4HXSA 3UVWA 4MEPA 4QUUA 5C7NA 2RNWA 3UVDA 5HLSA 4UYDA 1JM4B 5D3HA 5D3NA 2R10A 5LKXA 5J0DA 5E9KA 3GG3A 5D3LA 5F60A 4TS8A 3UVXA 4QY4A 5E3GA 2E7OA 3O37A 2E7NA 5FB0A 2R0YA 5II1A 4Z93A 5ETBA 2E3KA 4UYFA 4A9KA 3HMFA 5ENJA 4N4GA 4UIYA 4YYKA 4A9JA 4O7FA 3SVFA 4NS5A 3P1DA 4MEQA 4PS5A 5ENBA 5TCMA 4UYFB 3MQMA 5L99A 3Q2EA 5HRVA 3O36A 2RNXA 5DKHA 5DX4A 5I40A 5IGLA 2DVQA 5ENHA 5LJ1A 5EISA 2YYNA 2WP2A 5E9LA 5CY9A 4QEWA 5DYUA 3DAIA 5A85A 5A83A 5HM0A 4YYMA 3UVYA 4A9IA 2YEMA 5DW2A 5FE7A 5FH6A 5CQ8A 4ALGA 5CRMA 5CUCA 4O7CA 4E96A 4HXRA 4LZ2A 4QC1A 4YYIA 4PY6A 5H1VA 4N4FA 5ENEA 5BT3A 4HXKA 5G4RA 5ENFA 3UV4A 4MEOA 5L8UA 3IU5A 3U5LA 2DWWA 4NYXA 5EI4A 5D25A 4NR5A 4C67A 4YYGA 5CQ5A 4A9FA 4BHWA 4N4HA 4NR6A 4C66A 5E73A 4O72A 4QSVA 4CUSA 5EPRA 4NRAA 4XYAA 5FE5A 2F6NA 5HQ5A 4QSRA 4J0SA 5II2A 4LDFA 4LYWA 4F3IA 3I3JA 5IGNA 4HXLA 4NQMA 5CQ6A 5CUEA 5D24A 2DKWA 5CUBA 5I7YA 5E0RA 2OUOA 4QBMA 4ZQLA 3MXFA 4HBWA 5CUDA 5FE9A 4Z1QA 4NR4A 4QR3A 5DYXA 3O34A 5F1HA 5EPSA 2LSPB 4NXJA 1ZS5A 4UIVA 5KTUA 3SVHA 5I88A 2G4AA 2D9EA 2YW5A 5IIDA 4TT2A 4Q0NA 4Z6HA 4UYGA 5AMEA 5FE1A 1X0JA 4TTEA 5ENGA 5FG4A 5G4SA 4ZW1A 5D0CA 3HMHA 4CFKA 4QYLA 4CL9A 4TT6A 5CTLA 2D82A 4MR3A 5LKZA 3IU6A 4UIXA 5DLZA 2L85A 4UIZA 4QSPA 5DKDA 3LXJA 5FFWA 3S92A 5I7XA 2F6JA 4HXNA 5FBXA 5EWWA 4HXOA 4IR3A 4HBVA 5CPEA 2MJVB 5CS8A 4J1PA 5IG6A 3P1EA 4KV4A 5I80A 1EQFA 4NYVA 4O71A 5I89A 4A9HA 5HFQA 5FE3A 4QB3A 5A5PA 4QZSA 2DVSA 5EWCA 3LQIA 4LR6A 4YBTA 3U5KA 3QZVA 5D3PA 5A7CA 5F2PA 3HMEA 5E7DA 4NQNA 4KV1A 4LC2A 4PCIA 3LQHA 4YH3A 4NR9A 5HFRA 4YK0A 5COIA 5IGKA 3FKMX 5CP5A 5DKCA 3AQAA 4PKLA 4QEUA 2RO1A 4PCEA 5LJ2A 4LYIA 4TYLA 3RCWA 3UV5A 4O7BA 3ZYUA 5DBMA 4NUDA 5EVAA 5KTWA 2L5EA 4O76A 5I83A 4YY6A 5DYCA 3AADA 5FFVA 5KO4A 2H60A 5FE0A 4YAXA 5D3TA 4GPJA 3LQJA 5FE4A 3O33A 5HRXA 2RFJA 3UW9A 3G0LA 2RNYA 5I86A 5HJCA 4YABA 4J3IA 4NRCA 5I29A 5CU8A 5D3JA 4ZC9A 5EP7A 5A5NA 5BT4A 3O35A 4BW3A 5BT5A 5H1UA 4N4IA 4RVRA 3U5JA 2R0VA 4NUEA 5CUGA 4MR5A 5FDZA 4KCXA 5FE6A 4HBYA 4XY9A 4CUUA 4ALHA 5F36A 4OUFA 5HCLA 4MR6A 5D3RA 5FE2A 4CFLA 5LUUA 4O7EA 5EV9A 4O70A 4IOQA 4UIWA 4J0RA 1WUMA 4YBSA 3ONIA 4YY4A 2RS9B 5EM3A 4TU4A 4QSSA 4CLBA 3P1FA 4A9LA 3G0JA 3K2JA 4QR5A 5EWDA 5D3SA 5C89A 4IOOA 4YATA 5CFWA 2OSSA 1E6IA 5EICA 5L8TA 5F63A 3QZSA 2R0SA 1F68A 2NXBA 2YEKA 3Q2FA 4MR4A 4O77A 5E9MA 5H85A 2DVVA 4QR4A 4O75A 4FLPA 4AKNA 2YELA 3LJWA 2DATA 5EU1A 4YYDA 4NR7A 5DFDA 5ETDA 4CUTA 4TZ2A 5EPBA 4QC3A 5HQ7A 3JVKA 5DFCA 5FH8A 4LYSA 3MULA 5FB1A 5AMFA 5E74A 5F25A 4PTBA 4QNSA 5FFYA 4LRGA 4XUBA 4YBMA 2I7KA 4YYJA 5C87A 4O78A 4QSWA 5F62A 5EK9A 4LZSA 5ENIA 5LVRA 4N3WA 5D7XA 5DFBA 5ENCA 4A9MA 5EGUA 4TT4A 4IR6A 4LZRA 4CUPA 5LJ0A 5F3AA 4OGJA 3JVLA 4YC9A 5AD3A 4HXMA 5DW1A 5CGPA 5ACYA 4A9OA 4QSXA 3MB4A 4NUCA 1N72A 4HBXA 5H1TA 5DLXA 4QUTA 5HEMA 5JI8A 4IORA 4WHWA 4BW2A 3DWYA 4XY8A 4A9EA 4DONA 4QSTA 5EA1A 5EWHA 4CUQA 4QYDA 4QSQA 5E3DA 1JSPB 5CQ4A 3P1CA 5LVQA 3TLPA 4UYEA 2GRCA 3S91A 5L96A 3JVJA 4BJXA 5CUAA 4Z1SA 5CQ3A 3MB3A 4Z6IA 4A9NA 2WP1A 5FH7A 4YADA 5F61A 4BW1A 2DVRA 5C4QA 2L84A 3U5NA 5A5RA 4UITA 2N9GA 4IR4A 5KU3A 5KTXA 4UYHA 5C8GA 4TU6A 3U5OA 2YQDA 4XUAA 4MENA 5IBNA 4TQNA 2KTBB 3JVMA 4TZ8A 4OGIA 5AD2A 3QZTA 5L98A 3UV2A 4HXPA 5A5SA 5JWMA
chains in the Genus database with same CATH superfamily
5FG6A 4NRBA 2FSAA 4UIUA 4YYHA 4Y03A 4NR8A 5E9IA 3U5PA 2I8NA 5A5QA 5HELA 4NYWA 4QSUA 5TB6A 4BW4A 5CZGA 4O7AA 3NXBA 2YDWA 5E9VA 5IGMA 5DYAA 3U5MA 5CRZA 5FE8A 4YH4A 4CURA 5CQTA 5C85A 4WHUA 5A82A 5LKTA 1WUGA 4IR5A 5EWVA 5FG5A 4X2IA 5EQ1A 5HQ6A 2RI7A 5D26A 4YYNA 3P5OA 3D7CA 5L97A 4Q0OA 2OO1A 5I1QA 5CQ7A 3MUKA 5A81A 4WIVA 5DY7A 5LKUA 4QEVA 5KHMA 5F5ZA 5A5OA 5E9YA 3SVGA 5HENA 5K29A 5HRWA 4O74A 5F1LA 5CQAA 4HXSA 3UVWA 4MEPA 4QUUA 5C7NA 2RNWA 3UVDA 5HLSA 4UYDA 1JM4B 5D3HA 5D3NA 2R10A 5LKXA 5J0DA 5E9KA 3GG3A 5D3LA 5F60A 4TS8A 3UVXA 4QY4A 5E3GA 2E7OA 3O37A 2E7NA 5FB0A 2R0YA 5II1A 4Z93A 5ETBA 2E3KA 4UYFA 4A9KA 3HMFA 5ENJA 4N4GA 4UIYA 4YYKA 4A9JA 4AKHA 4O7FA 3SVFA 4NS5A 3P1DA 4MEQA 4PS5A 5ENBA 5TCMA 4UYFB 3MQMA 5L99A 3Q2EA 5HRVA 3O36A 2RNXA 5DKHA 5DX4A 5I40A 5IGLA 2DVQA 5ENHA 5LJ1A 5EISA 2YYNA 2WP2A 5E9LA 5CY9A 4QEWA 4AKGA 4AI6A 5DYUA 3DAIA 5A85A 5A83A 5HM0A 4YYMA 3UVYA 4A9IA 2YEMA 5DW2A 5FE7A 5FH6A 5CQ8A 4ALGA 3ERRA 5CRMA 5CUCA 4O7CA 4E96A 4HXRA 4LZ2A 4QC1A 4YYIA 4PY6A 5H1VA 4N4FA 5ENEA 5BT3A 4HXKA 5G4RA 5ENFA 3UV4A 4MEOA 5L8UA 3IU5A 3U5LA 2DWWA 4NYXA 5EI4A 5D25A 3D1BA 4NR5A 4C67A 4YYGA 5CQ5A 4A9FA 4BHWA 3VKGA 4N4HA 4NR6A 4C66A 5E73A 4O72A 4QSVA 4CUSA 5EPRA 4NRAA 4XYAA 5FE5A 2F6NA 5HQ5A 4QSRA 4J0SA 5II2A 4LDFA 4LYWA 4F3IA 3I3JA 5IGNA 4HXLA 4NQMA 5CQ6A 5CUEA 5D24A 2DKWA 5CUBA 5I7YA 5E0RA 2OUOA 4QBMA 4ZQLA 3MXFA 4HBWA 5CUDA 5FE9A 4Z1QA 4NR4A 4QR3A 5DYXA 3O34A 5F1HA 5EPSA 2LSPB 4NXJA 1ZS5A 4UIVA 5KTUA 3SVHA 5I88A 2G4AA 2D9EA 2YW5A 5IIDA 4TT2A 2EJNA 4Q0NA 4Z6HA 4UYGA 5AMEA 5FE1A 1X0JA 4TTEA 5ENGA 5FG4A 5G4SA 4ZW1A 5D0CA 3HMHA 4CFKA 4QYLA 4CL9A 4TT6A 5CTLA 2D82A 4MR3A 5LKZA 3IU6A 4UIXA 5DLZA 2L85A 4UIZA 4QSPA 5DKDA 3LXJA 5FFWA 3S92A 5I7XA 2F6JA 4HXNA 5FBXA 5EWWA 4HXOA 4IR3A 4HBVA 5CPEA 2MJVB 5CS8A 4J1PA 5IG6A 3P1EA 4KV4A 5I80A 1EQFA 4NYVA 4O71A 5I89A 4A9HA 5HFQA 5FE3A 4QB3A 5A5PA 4QZSA 2DVSA 5EWCA 3LQIA 4LR6A 4YBTA 3U5KA 3QZVA 5D3PA 5A7CA 5F2PA 3HMEA 5E7DA 4NQNA 4KV1A 4LC2A 4PCIA 3LQHA 4YH3A 4NR9A 5HFRA 4YK0A 5COIA 5IGKA 3FKMX 5CP5A 5DKCA 3AQAA 4PKLA 4QEUA 2RO1A 4PCEA 5LJ2A 4LYIA 4TYLA 3RCWA 3UV5A 4O7BA 3ZYUA 5DBMA 4NUDA 5EVAA 5KTWA 2L5EA 4O76A 5I83A 4YY6A 5DYCA 3AADA 5FFVA 5KO4A 1ZKRA 2H60A 5FE0A 4YAXA 5D3TA 4GPJA 3LQJA 5FE4A 3O33A 5HRXA 2RFJA 3UW9A 3G0LA 2RNYA 5I86A 5HJCA 4YABA 4J3IA 4NRCA 5I29A 5CU8A 5D3JA 4ZC9A 5EP7A 5A5NA 5BT4A 3O35A 4BW3A 5BT5A 5H1UA 4N4IA 4RVRA 3U5JA 2R0VA 4NUEA 5CUGA 4MR5A 5FDZA 4KCXA 5FE6A 4HBYA 4XY9A 4CUUA 4ALHA 5F36A 4OUFA 5HCLA 4MR6A 5D3RA 5FE2A 4CFLA 5LUUA 4O7EA 5EV9A 4O70A 4IOQA 4UIWA 4J0RA 1WUMA 4YBSA 3ONIA 4YY4A 2RS9B 5EM3A 4TU4A 4QSSA 4CLBA 3P1FA 4A9LA 3G0JA 3K2JA 4QR5A 5EWDA 5D3SA 5C89A 4IOOA 4YATA 5CFWA 2OSSA 1E6IA 5EICA 5L8TA 5F63A 3QZSA 2R0SA 1F68A 2NXBA 2YEKA 3Q2FA 4MR4A 4O77A 5E9MA 5H85A 2DVVA 4QR4A 4O75A 4FLPA 4AKNA 2YELA 3LJWA 2DATA 3D1DA 5EU1A 4YYDA 4NR7A 5DFDA 5ETDA 4CUTA 4TZ2A 5EPBA 4QC3A 5HQ7A 3JVKA 5DFCA 5FH8A 4LYSA 3MULA 5FB1A 5AMFA 5E74A 5F25A 4PTBA 4QNSA 5FFYA 4LRGA 4XUBA 4YBMA 2I7KA 4YYJA 5C87A 4O78A 4QSWA 5F62A 5EK9A 4LZSA 5ENIA 5LVRA 4N3WA 5D7XA 5DFBA 5ENCA 4A9MA 5EGUA 4TT4A 4IR6A 4LZRA 4CUPA 5LJ0A 5F3AA 4OGJA 3JVLA 4YC9A 5AD3A 4HXMA 5DW1A 5CGPA 5ACYA 4A9OA 4QSXA 3MB4A 4NUCA 1N72A 4HBXA 5H1TA 5DLXA 4QUTA 5HEMA 3VKHA 5JI8A 4IORA 4WHWA 4BW2A 3DWYA 4XY8A 4A9EA 4DONA 4QSTA 5EA1A 5EWHA 4CUQA 4QYDA 4QSQA 1PUOA 5E3DA 1JSPB 5CQ4A 3P1CA 5LVQA 3TLPA 4UYEA 2GRCA 3S91A 5L96A 3JVJA 4BJXA 5CUAA 4Z1SA 5CQ3A 3MB3A 4Z6IA 4A9NA 2WP1A 5FH7A 4YADA 5F61A 4BW1A 2DVRA 5C4QA 2L84A 3U5NA 5A5RA 4UITA 2N9GA 4AKIA 4IR4A 5KU3A 5KTXA 4UYHA 5C8GA 4TU6A 3U5OA 2YQDA 4XUAA 4MENA 5IBNA 4TQNA 2KTBB 3JVMA 4TZ8A 4OGIA 5AD2A 3QZTA 5L98A 3UV2A 4HXPA 5A5SA 5JWMA
chains in the Genus database with same CATH topology
5FG6A 4NRBA 2FSAA 4UIUA 4YYHA 4Y03A 4NR8A 5E9IA 3U5PA 2I8NA 5A5QA 5HELA 4NYWA 4QSUA 5TB6A 4BW4A 5CZGA 4O7AA 3NXBA 2YDWA 5E9VA 5IGMA 5DYAA 3U5MA 5CRZA 5FE8A 4YH4A 4CURA 5CQTA 5C85A 4WHUA 5A82A 5LKTA 1WUGA 4IR5A 5EWVA 5FG5A 4X2IA 5EQ1A 5HQ6A 2RI7A 5D26A 4YYNA 3P5OA 3D7CA 5L97A 4Q0OA 2OO1A 5I1QA 5CQ7A 3MUKA 5A81A 4WIVA 5DY7A 5LKUA 4QEVA 5KHMA 5F5ZA 5A5OA 5E9YA 3SVGA 5HENA 5K29A 5HRWA 4O74A 5F1LA 5CQAA 4HXSA 3UVWA 4MEPA 4QUUA 5C7NA 2RNWA 3UVDA 5HLSA 4UYDA 1JM4B 5D3HA 5D3NA 2R10A 5LKXA 5J0DA 5E9KA 3GG3A 5D3LA 5F60A 4TS8A 3UVXA 4QY4A 5E3GA 2E7OA 3O37A 2E7NA 5FB0A 2R0YA 5II1A 4Z93A 5ETBA 2E3KA 4UYFA 4A9KA 3HMFA 5ENJA 4N4GA 4UIYA 4YYKA 4A9JA 4O7FA 3SVFA 4NS5A 3P1DA 4MEQA 4PS5A 5ENBA 5TCMA 4UYFB 3MQMA 5L99A 3Q2EA 5HRVA 3O36A 2RNXA 5DKHA 5DX4A 5I40A 5IGLA 2DVQA 5ENHA 5LJ1A 5EISA 2YYNA 2WP2A 5E9LA 5CY9A 4QEWA 5DYUA 3DAIA 5A85A 5A83A 5HM0A 4YYMA 3UVYA 4A9IA 2YEMA 5DW2A 5FE7A 5FH6A 5CQ8A 4ALGA 5CRMA 5CUCA 4O7CA 4E96A 4HXRA 4LZ2A 4QC1A 4YYIA 4PY6A 5H1VA 4N4FA 5ENEA 5BT3A 4HXKA 5G4RA 5ENFA 3UV4A 4MEOA 5L8UA 3IU5A 3U5LA 2DWWA 4NYXA 5EI4A 5D25A 4NR5A 4C67A 4YYGA 5CQ5A 4A9FA 4BHWA 4N4HA 4NR6A 4C66A 5E73A 4O72A 4QSVA 4CUSA 5EPRA 4NRAA 4XYAA 5FE5A 2F6NA 5HQ5A 4QSRA 4J0SA 5II2A 4LDFA 4LYWA 4F3IA 3I3JA 5IGNA 4HXLA 4NQMA 5CQ6A 5CUEA 5D24A 2DKWA 5CUBA 5I7YA 5E0RA 2OUOA 4QBMA 4ZQLA 3MXFA 4HBWA 5CUDA 5FE9A 4Z1QA 4NR4A 4QR3A 5DYXA 3O34A 5F1HA 5EPSA 2LSPB 4NXJA 1ZS5A 4UIVA 5KTUA 3SVHA 5I88A 2G4AA 2D9EA 2YW5A 5IIDA 4TT2A 4Q0NA 4Z6HA 4UYGA 5AMEA 5FE1A 1X0JA 4TTEA 5ENGA 5FG4A 5G4SA 4ZW1A 5D0CA 3HMHA 4CFKA 4QYLA 4CL9A 4TT6A 5CTLA 2D82A 4MR3A 5LKZA 3IU6A 4UIXA 5DLZA 2L85A 4UIZA 4QSPA 5DKDA 3LXJA 5FFWA 3S92A 5I7XA 2F6JA 4HXNA 5FBXA 5EWWA 4HXOA 4IR3A 4HBVA 5CPEA 2MJVB 5CS8A 4J1PA 5IG6A 3P1EA 4KV4A 5I80A 1EQFA 4NYVA 4O71A 5I89A 4A9HA 5HFQA 5FE3A 4QB3A 5A5PA 4QZSA 2DVSA 5EWCA 3LQIA 4LR6A 4YBTA 3U5KA 3QZVA 5D3PA 5A7CA 5F2PA 3HMEA 5E7DA 4NQNA 4KV1A 4LC2A 4PCIA 3LQHA 4YH3A 4NR9A 5HFRA 4YK0A 5COIA 5IGKA 3FKMX 5CP5A 5DKCA 3AQAA 4PKLA 4QEUA 2RO1A 4PCEA 5LJ2A 4LYIA 4TYLA 3RCWA 3UV5A 4O7BA 3ZYUA 5DBMA 4NUDA 5EVAA 5KTWA 2L5EA 4O76A 5I83A 4YY6A 5DYCA 3AADA 5FFVA 5KO4A 2H60A 5FE0A 4YAXA 5D3TA 4GPJA 3LQJA 5FE4A 3O33A 5HRXA 2RFJA 3UW9A 3G0LA 2RNYA 5I86A 5HJCA 4YABA 4J3IA 4NRCA 5I29A 5CU8A 5D3JA 4ZC9A 5EP7A 5A5NA 5BT4A 3O35A 4BW3A 5BT5A 5H1UA 4N4IA 4RVRA 3U5JA 2R0VA 4NUEA 5CUGA 4MR5A 5FDZA 4KCXA 5FE6A 4HBYA 4XY9A 4CUUA 4ALHA 5F36A 4OUFA 5HCLA 4MR6A 5D3RA 5FE2A 4CFLA 5LUUA 4O7EA 5EV9A 4O70A 4IOQA 4UIWA 4J0RA 1WUMA 4YBSA 3ONIA 4YY4A 2RS9B 5EM3A 4TU4A 4QSSA 4CLBA 3P1FA 4A9LA 3G0JA 3K2JA 4QR5A 5EWDA 5D3SA 5C89A 4IOOA 4YATA 5CFWA 2OSSA 1E6IA 5EICA 5L8TA 5F63A 3QZSA 2R0SA 1F68A 2NXBA 2YEKA 3Q2FA 4MR4A 4O77A 5E9MA 5H85A 2DVVA 4QR4A 4O75A 4FLPA 4AKNA 2YELA 3LJWA 2DATA 5EU1A 4YYDA 4NR7A 5DFDA 5ETDA 4CUTA 4TZ2A 5EPBA 4QC3A 5HQ7A 3JVKA 5DFCA 5FH8A 4LYSA 3MULA 5FB1A 5AMFA 5E74A 5F25A 4PTBA 4QNSA 5FFYA 4LRGA 4XUBA 4YBMA 2I7KA 4YYJA 5C87A 4O78A 4QSWA 5F62A 5EK9A 4LZSA 5ENIA 5LVRA 4N3WA 5D7XA 5DFBA 5ENCA 4A9MA 5EGUA 4TT4A 4IR6A 4LZRA 4CUPA 5LJ0A 5F3AA 4OGJA 3JVLA 4YC9A 5AD3A 4HXMA 5DW1A 5CGPA 5ACYA 4A9OA 4QSXA 3MB4A 4NUCA 1N72A 4HBXA 5H1TA 5DLXA 4QUTA 5HEMA 5JI8A 4IORA 4WHWA 4BW2A 3DWYA 4XY8A 4A9EA 4DONA 4QSTA 5EA1A 5EWHA 4CUQA 4QYDA 4QSQA 5E3DA 1JSPB 5CQ4A 3P1CA 5LVQA 3TLPA 4UYEA 2GRCA 3S91A 5L96A 3JVJA 4BJXA 5CUAA 4Z1SA 5CQ3A 3MB3A 4Z6IA 4A9NA 2WP1A 5FH7A 4YADA 5F61A 4BW1A 2DVRA 5C4QA 2L84A 3U5NA 5A5RA 4UITA 2N9GA 4IR4A 5KU3A 5KTXA 4UYHA 5C8GA 4TU6A 3U5OA 2YQDA 4XUAA 4MENA 5IBNA 4TQNA 2KTBB 3JVMA 4TZ8A 4OGIA 5AD2A 3QZTA 5L98A 3UV2A 4HXPA 5A5SA 5JWMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FG6 A;  4NRB A;  2FSA A;  4UIU A;  4YYH A;  4Y03 A;  4NR8 A;  5E9I A;  3U5P A;  2I8N A;  5A5Q A;  5HEL A;  4NYW A;  4QSU A;  5TB6 A;  4BW4 A;  5CZG A;  4O7A A;  3NXB A;  2YDW A;  5E9V A;  5IGM A;  5DYA A;  3U5M A;  5CRZ A;  5FE8 A;  4YH4 A;  4CUR A;  5CQT A;  5C85 A;  4WHU A;  5A82 A;  5LKT A;  1WUG A;  4IR5 A;  5EWV A;  5FG5 A;  4X2I A;  5EQ1 A;  5HQ6 A;  2RI7 A;  5D26 A;  4YYN A;  3P5O A;  3D7C A;  5L97 A;  4Q0O A;  2OO1 A;  5I1Q A;  5CQ7 A;  3MUK A;  5A81 A;  4WIV A;  5DY7 A;  5LKU A;  4QEV A;  5KHM A;  5F5Z A;  5A5O A;  5E9Y A;  3SVG A;  5HEN A;  5K29 A;  5HRW A;  4O74 A;  5F1L A;  5CQA A;  4HXS A;  3UVW A;  4MEP A;  4QUU A;  5C7N A;  2RNW A;  3UVD A;  5HLS A;  4UYD A;  1JM4 B;  5D3H A;  5D3N A;  2R10 A;  5LKX A;  5J0D A;  5E9K A;  3GG3 A;  5D3L A;  5F60 A;  4TS8 A;  3UVX A;  4QY4 A;  5E3G A;  2E7O A;  3O37 A;  2E7N A;  5FB0 A;  2R0Y A;  5II1 A;  4Z93 A;  5ETB A;  2E3K A;  4UYF A;  4A9K A;  3HMF A;  5ENJ A;  4N4G A;  4UIY A;  4YYK A;  4A9J A;  4O7F A;  3SVF A;  4NS5 A;  3P1D A;  4MEQ A;  4PS5 A;  5ENB A;  5TCM A;  4UYF B;  3MQM A;  5L99 A;  3Q2E A;  5HRV A;  3O36 A;  2RNX A;  5DKH A;  5DX4 A;  5I40 A;  5IGL A;  2DVQ A;  5ENH A;  5LJ1 A;  5EIS A;  2YYN A;  2WP2 A;  5E9L A;  5CY9 A;  4QEW A;  5DYU A;  3DAI A;  5A85 A;  5A83 A;  5HM0 A;  4YYM A;  3UVY A;  4A9I A;  2YEM A;  5DW2 A;  5FE7 A;  5FH6 A;  5CQ8 A;  4ALG A;  5CRM A;  5CUC A;  4O7C A;  4E96 A;  4HXR A;  4LZ2 A;  4QC1 A;  4YYI A;  4PY6 A;  5H1V A;  4N4F A;  5ENE A;  5BT3 A;  4HXK A;  5G4R A;  5ENF A;  3UV4 A;  4MEO A;  5L8U A;  3IU5 A;  3U5L A;  2DWW A;  4NYX A;  5EI4 A;  5D25 A;  4NR5 A;  4C67 A;  4YYG A;  5CQ5 A;  4A9F A;  4BHW A;  4N4H A;  4NR6 A;  4C66 A;  5E73 A;  4O72 A;  4QSV A;  4CUS A;  5EPR A;  4NRA A;  4XYA A;  5FE5 A;  2F6N A;  5HQ5 A;  4QSR A;  4J0S A;  5II2 A;  4LDF A;  4LYW A;  4F3I A;  3I3J A;  5IGN A;  4HXL A;  4NQM A;  5CQ6 A;  5CUE A;  5D24 A;  2DKW A;  5CUB A;  5I7Y A;  5E0R A;  2OUO A;  4QBM A;  4ZQL A;  3MXF A;  4HBW A;  5CUD A;  5FE9 A;  4Z1Q A;  4NR4 A;  4QR3 A;  5DYX A;  3O34 A;  5F1H A;  5EPS A;  2LSP B;  4NXJ A;  1ZS5 A;  4UIV A;  5KTU A;  3SVH A;  5I88 A;  2G4A A;  2D9E A;  2YW5 A;  5IID A;  4TT2 A;  4Q0N A;  4Z6H A;  4UYG A;  5AME A;  5FE1 A;  1X0J A;  4TTE A;  5ENG A;  5FG4 A;  5G4S A;  4ZW1 A;  5D0C A;  3HMH A;  4CFK A;  4QYL A;  4CL9 A;  4TT6 A;  5CTL A;  2D82 A;  4MR3 A;  5LKZ A;  3IU6 A;  4UIX A;  5DLZ A;  2L85 A;  4UIZ A;  4QSP A;  5DKD A;  3LXJ A;  5FFW A;  3S92 A;  5I7X A;  2F6J A;  4HXN A;  5FBX A;  5EWW A;  4HXO A;  4IR3 A;  4HBV A;  5CPE A;  2MJV B;  5CS8 A;  4J1P A;  5IG6 A;  3P1E A;  4KV4 A;  5I80 A;  1EQF A;  4NYV A;  4O71 A;  5I89 A;  4A9H A;  5HFQ A;  5FE3 A;  4QB3 A;  5A5P A;  4QZS A;  2DVS A;  5EWC A;  3LQI A;  4LR6 A;  4YBT A;  3U5K A;  3QZV A;  5D3P A;  5A7C A;  5F2P A;  3HME A;  5E7D A;  4NQN A;  4KV1 A;  4LC2 A;  4PCI A;  3LQH A;  4YH3 A;  4NR9 A;  5HFR A;  4YK0 A;  5COI A;  5IGK A;  3FKM X;  5CP5 A;  5DKC A;  3AQA A;  4PKL A;  4QEU A;  2RO1 A;  4PCE A;  5LJ2 A;  4LYI A;  4TYL A;  3RCW A;  3UV5 A;  4O7B A;  3ZYU A;  5DBM A;  4NUD A;  5EVA A;  5KTW A;  2L5E A;  4O76 A;  5I83 A;  4YY6 A;  5DYC A;  3AAD A;  5FFV A;  5KO4 A;  2H60 A;  5FE0 A;  4YAX A;  5D3T A;  4GPJ A;  3LQJ A;  5FE4 A;  3O33 A;  5HRX A;  2RFJ A;  3UW9 A;  3G0L A;  2RNY A;  5I86 A;  5HJC A;  4YAB A;  4J3I A;  4NRC A;  5I29 A;  5CU8 A;  5D3J A;  4ZC9 A;  5EP7 A;  5A5N A;  5BT4 A;  3O35 A;  4BW3 A;  5BT5 A;  5H1U A;  4N4I A;  4RVR A;  3U5J A;  2R0V A;  4NUE A;  5CUG A;  4MR5 A;  5FDZ A;  4KCX A;  5FE6 A;  4HBY A;  4XY9 A;  4CUU A;  4ALH A;  5F36 A;  4OUF A;  5HCL A;  4MR6 A;  5D3R A;  5FE2 A;  4CFL A;  5LUU A;  4O7E A;  5EV9 A;  4O70 A;  4IOQ A;  4UIW A;  4J0R A;  1WUM A;  4YBS A;  3ONI A;  4YY4 A;  2RS9 B;  5EM3 A;  4TU4 A;  4QSS A;  4CLB A;  3P1F A;  4A9L A;  3G0J A;  3K2J A;  4QR5 A;  5EWD A;  5D3S A;  5C89 A;  4IOO A;  4YAT A;  5CFW A;  2OSS A;  1E6I A;  5EIC A;  5L8T A;  5F63 A;  3QZS A;  2R0S A;  1F68 A;  2NXB A;  2YEK A;  3Q2F A;  4MR4 A;  4O77 A;  5E9M A;  5H85 A;  2DVV A;  4QR4 A;  4O75 A;  4FLP A;  4AKN A;  2YEL A;  3LJW A;  2DAT A;  5EU1 A;  4YYD A;  4NR7 A;  5DFD A;  5ETD A;  4CUT A;  4TZ2 A;  5EPB A;  4QC3 A;  5HQ7 A;  3JVK A;  5DFC A;  5FH8 A;  4LYS A;  3MUL A;  5FB1 A;  5AMF A;  5E74 A;  5F25 A;  4PTB A;  4QNS A;  5FFY A;  4LRG A;  4XUB A;  4YBM A;  2I7K A;  4YYJ A;  5C87 A;  4O78 A;  4QSW A;  5F62 A;  5EK9 A;  4LZS A;  5ENI A;  5LVR A;  4N3W A;  5D7X A;  5DFB A;  5ENC A;  4A9M A;  5EGU A;  4TT4 A;  4IR6 A;  4LZR A;  4CUP A;  5LJ0 A;  5F3A A;  4OGJ A;  3JVL A;  4YC9 A;  5AD3 A;  4HXM A;  5DW1 A;  5CGP A;  5ACY A;  4A9O A;  4QSX A;  3MB4 A;  4NUC A;  1N72 A;  4HBX A;  5H1T A;  5DLX A;  4QUT A;  5HEM A;  5JI8 A;  4IOR A;  4WHW A;  4BW2 A;  3DWY A;  4XY8 A;  4A9E A;  4DON A;  4QST A;  5EA1 A;  5EWH A;  4CUQ A;  4QYD A;  4QSQ A;  5E3D A;  1JSP B;  5CQ4 A;  3P1C A;  5LVQ A;  3TLP A;  4UYE A;  2GRC A;  3S91 A;  5L96 A;  3JVJ A;  4BJX A;  5CUA A;  4Z1S A;  5CQ3 A;  3MB3 A;  4Z6I A;  4A9N A;  2WP1 A;  5FH7 A;  4YAD A;  5F61 A;  4BW1 A;  2DVR A;  5C4Q A;  2L84 A;  3U5N A;  5A5R A;  4UIT A;  2N9G A;  4IR4 A;  5KU3 A;  5KTX A;  4UYH A;  5C8G A;  4TU6 A;  3U5O A;  2YQD A;  4XUA A;  4MEN A;  5IBN A;  4TQN A;  2KTB B;  3JVM A;  4TZ8 A;  4OGI A;  5AD2 A;  3QZT A;  5L98 A;  3UV2 A;  4HXP A;  5A5S A;  5JWM A; 
#chains in the Genus database with same CATH topology
 5FG6 A;  4NRB A;  2FSA A;  4UIU A;  4YYH A;  4Y03 A;  4NR8 A;  5E9I A;  3U5P A;  2I8N A;  5A5Q A;  5HEL A;  4NYW A;  4QSU A;  5TB6 A;  4BW4 A;  5CZG A;  4O7A A;  3NXB A;  2YDW A;  5E9V A;  5IGM A;  5DYA A;  3U5M A;  5CRZ A;  5FE8 A;  4YH4 A;  4CUR A;  5CQT A;  5C85 A;  4WHU A;  5A82 A;  5LKT A;  1WUG A;  4IR5 A;  5EWV A;  5FG5 A;  4X2I A;  5EQ1 A;  5HQ6 A;  2RI7 A;  5D26 A;  4YYN A;  3P5O A;  3D7C A;  5L97 A;  4Q0O A;  2OO1 A;  5I1Q A;  5CQ7 A;  3MUK A;  5A81 A;  4WIV A;  5DY7 A;  5LKU A;  4QEV A;  5KHM A;  5F5Z A;  5A5O A;  5E9Y A;  3SVG A;  5HEN A;  5K29 A;  5HRW A;  4O74 A;  5F1L A;  5CQA A;  4HXS A;  3UVW A;  4MEP A;  4QUU A;  5C7N A;  2RNW A;  3UVD A;  5HLS A;  4UYD A;  1JM4 B;  5D3H A;  5D3N A;  2R10 A;  5LKX A;  5J0D A;  5E9K A;  3GG3 A;  5D3L A;  5F60 A;  4TS8 A;  3UVX A;  4QY4 A;  5E3G A;  2E7O A;  3O37 A;  2E7N A;  5FB0 A;  2R0Y A;  5II1 A;  4Z93 A;  5ETB A;  2E3K A;  4UYF A;  4A9K A;  3HMF A;  5ENJ A;  4N4G A;  4UIY A;  4YYK A;  4A9J A;  4AKH A;  4O7F A;  3SVF A;  4NS5 A;  3P1D A;  4MEQ A;  4PS5 A;  5ENB A;  5TCM A;  4UYF B;  3MQM A;  5L99 A;  3Q2E A;  5HRV A;  3O36 A;  2RNX A;  5DKH A;  5DX4 A;  5I40 A;  5IGL A;  2DVQ A;  5ENH A;  5LJ1 A;  5EIS A;  2YYN A;  2WP2 A;  5E9L A;  5CY9 A;  4QEW A;  4AKG A;  4AI6 A;  5DYU A;  3DAI A;  5A85 A;  5A83 A;  5HM0 A;  4YYM A;  3UVY A;  4A9I A;  2YEM A;  5DW2 A;  5FE7 A;  5FH6 A;  5CQ8 A;  4ALG A;  3ERR A;  5CRM A;  5CUC A;  4O7C A;  4E96 A;  4HXR A;  4LZ2 A;  4QC1 A;  4YYI A;  4PY6 A;  5H1V A;  4N4F A;  5ENE A;  5BT3 A;  4HXK A;  5G4R A;  5ENF A;  3UV4 A;  4MEO A;  5L8U A;  3IU5 A;  3U5L A;  2DWW A;  4NYX A;  5EI4 A;  5D25 A;  3D1B A;  4NR5 A;  4C67 A;  4YYG A;  5CQ5 A;  4A9F A;  4BHW A;  3VKG A;  4N4H A;  4NR6 A;  4C66 A;  5E73 A;  4O72 A;  4QSV A;  4CUS A;  5EPR A;  4NRA A;  4XYA A;  5FE5 A;  2F6N A;  5HQ5 A;  4QSR A;  4J0S A;  5II2 A;  4LDF A;  4LYW A;  4F3I A;  3I3J A;  5IGN A;  4HXL A;  4NQM A;  5CQ6 A;  5CUE A;  5D24 A;  2DKW A;  5CUB A;  5I7Y A;  5E0R A;  2OUO A;  4QBM A;  4ZQL A;  3MXF A;  4HBW A;  5CUD A;  5FE9 A;  4Z1Q A;  4NR4 A;  4QR3 A;  5DYX A;  3O34 A;  5F1H A;  5EPS A;  2LSP B;  4NXJ A;  1ZS5 A;  4UIV A;  5KTU A;  3SVH A;  5I88 A;  2G4A A;  2D9E A;  2YW5 A;  5IID A;  4TT2 A;  2EJN A;  4Q0N A;  4Z6H A;  4UYG A;  5AME A;  5FE1 A;  1X0J A;  4TTE A;  5ENG A;  5FG4 A;  5G4S A;  4ZW1 A;  5D0C A;  3HMH A;  4CFK A;  4QYL A;  4CL9 A;  4TT6 A;  5CTL A;  2D82 A;  4MR3 A;  5LKZ A;  3IU6 A;  4UIX A;  5DLZ A;  2L85 A;  4UIZ A;  4QSP A;  5DKD A;  3LXJ A;  5FFW A;  3S92 A;  5I7X A;  2F6J A;  4HXN A;  5FBX A;  5EWW A;  4HXO A;  4IR3 A;  4HBV A;  5CPE A;  2MJV B;  5CS8 A;  4J1P A;  5IG6 A;  3P1E A;  4KV4 A;  5I80 A;  1EQF A;  4NYV A;  4O71 A;  5I89 A;  4A9H A;  5HFQ A;  5FE3 A;  4QB3 A;  5A5P A;  4QZS A;  2DVS A;  5EWC A;  3LQI A;  4LR6 A;  4YBT A;  3U5K A;  3QZV A;  5D3P A;  5A7C A;  5F2P A;  3HME A;  5E7D A;  4NQN A;  4KV1 A;  4LC2 A;  4PCI A;  3LQH A;  4YH3 A;  4NR9 A;  5HFR A;  4YK0 A;  5COI A;  5IGK A;  3FKM X;  5CP5 A;  5DKC A;  3AQA A;  4PKL A;  4QEU A;  2RO1 A;  4PCE A;  5LJ2 A;  4LYI A;  4TYL A;  3RCW A;  3UV5 A;  4O7B A;  3ZYU A;  5DBM A;  4NUD A;  5EVA A;  5KTW A;  2L5E A;  4O76 A;  5I83 A;  4YY6 A;  5DYC A;  3AAD A;  5FFV A;  5KO4 A;  1ZKR A;  2H60 A;  5FE0 A;  4YAX A;  5D3T A;  4GPJ A;  3LQJ A;  5FE4 A;  3O33 A;  5HRX A;  2RFJ A;  3UW9 A;  3G0L A;  2RNY A;  5I86 A;  5HJC A;  4YAB A;  4J3I A;  4NRC A;  5I29 A;  5CU8 A;  5D3J A;  4ZC9 A;  5EP7 A;  5A5N A;  5BT4 A;  3O35 A;  4BW3 A;  5BT5 A;  5H1U A;  4N4I A;  4RVR A;  3U5J A;  2R0V A;  4NUE A;  5CUG A;  4MR5 A;  5FDZ A;  4KCX A;  5FE6 A;  4HBY A;  4XY9 A;  4CUU A;  4ALH A;  5F36 A;  4OUF A;  5HCL A;  4MR6 A;  5D3R A;  5FE2 A;  4CFL A;  5LUU A;  4O7E A;  5EV9 A;  4O70 A;  4IOQ A;  4UIW A;  4J0R A;  1WUM A;  4YBS A;  3ONI A;  4YY4 A;  2RS9 B;  5EM3 A;  4TU4 A;  4QSS A;  4CLB A;  3P1F A;  4A9L A;  3G0J A;  3K2J A;  4QR5 A;  5EWD A;  5D3S A;  5C89 A;  4IOO A;  4YAT A;  5CFW A;  2OSS A;  1E6I A;  5EIC A;  5L8T A;  5F63 A;  3QZS A;  2R0S A;  1F68 A;  2NXB A;  2YEK A;  3Q2F A;  4MR4 A;  4O77 A;  5E9M A;  5H85 A;  2DVV A;  4QR4 A;  4O75 A;  4FLP A;  4AKN A;  2YEL A;  3LJW A;  2DAT A;  3D1D A;  5EU1 A;  4YYD A;  4NR7 A;  5DFD A;  5ETD A;  4CUT A;  4TZ2 A;  5EPB A;  4QC3 A;  5HQ7 A;  3JVK A;  5DFC A;  5FH8 A;  4LYS A;  3MUL A;  5FB1 A;  5AMF A;  5E74 A;  5F25 A;  4PTB A;  4QNS A;  5FFY A;  4LRG A;  4XUB A;  4YBM A;  2I7K A;  4YYJ A;  5C87 A;  4O78 A;  4QSW A;  5F62 A;  5EK9 A;  4LZS A;  5ENI A;  5LVR A;  4N3W A;  5D7X A;  5DFB A;  5ENC A;  4A9M A;  5EGU A;  4TT4 A;  4IR6 A;  4LZR A;  4CUP A;  5LJ0 A;  5F3A A;  4OGJ A;  3JVL A;  4YC9 A;  5AD3 A;  4HXM A;  5DW1 A;  5CGP A;  5ACY A;  4A9O A;  4QSX A;  3MB4 A;  4NUC A;  1N72 A;  4HBX A;  5H1T A;  5DLX A;  4QUT A;  5HEM A;  3VKH A;  5JI8 A;  4IOR A;  4WHW A;  4BW2 A;  3DWY A;  4XY8 A;  4A9E A;  4DON A;  4QST A;  5EA1 A;  5EWH A;  4CUQ A;  4QYD A;  4QSQ A;  1PUO A;  5E3D A;  1JSP B;  5CQ4 A;  3P1C A;  5LVQ A;  3TLP A;  4UYE A;  2GRC A;  3S91 A;  5L96 A;  3JVJ A;  4BJX A;  5CUA A;  4Z1S A;  5CQ3 A;  3MB3 A;  4Z6I A;  4A9N A;  2WP1 A;  5FH7 A;  4YAD A;  5F61 A;  4BW1 A;  2DVR A;  5C4Q A;  2L84 A;  3U5N A;  5A5R A;  4UIT A;  2N9G A;  4AKI A;  4IR4 A;  5KU3 A;  5KTX A;  4UYH A;  5C8G A;  4TU6 A;  3U5O A;  2YQD A;  4XUA A;  4MEN A;  5IBN A;  4TQN A;  2KTB B;  3JVM A;  4TZ8 A;  4OGI A;  5AD2 A;  3QZT A;  5L98 A;  3UV2 A;  4HXP A;  5A5S A;  5JWM A; 
#chains in the Genus database with same CATH homology
 5FG6 A;  4NRB A;  2FSA A;  4UIU A;  4YYH A;  4Y03 A;  4NR8 A;  5E9I A;  3U5P A;  2I8N A;  5A5Q A;  5HEL A;  4NYW A;  4QSU A;  5TB6 A;  4BW4 A;  5CZG A;  4O7A A;  3NXB A;  2YDW A;  5E9V A;  5IGM A;  5DYA A;  3U5M A;  5CRZ A;  5FE8 A;  4YH4 A;  4CUR A;  5CQT A;  5C85 A;  4WHU A;  5A82 A;  5LKT A;  1WUG A;  4IR5 A;  5EWV A;  5FG5 A;  4X2I A;  5EQ1 A;  5HQ6 A;  2RI7 A;  5D26 A;  4YYN A;  3P5O A;  3D7C A;  5L97 A;  4Q0O A;  2OO1 A;  5I1Q A;  5CQ7 A;  3MUK A;  5A81 A;  4WIV A;  5DY7 A;  5LKU A;  4QEV A;  5KHM A;  5F5Z A;  5A5O A;  5E9Y A;  3SVG A;  5HEN A;  5K29 A;  5HRW A;  4O74 A;  5F1L A;  5CQA A;  4HXS A;  3UVW A;  4MEP A;  4QUU A;  5C7N A;  2RNW A;  3UVD A;  5HLS A;  4UYD A;  1JM4 B;  5D3H A;  5D3N A;  2R10 A;  5LKX A;  5J0D A;  5E9K A;  3GG3 A;  5D3L A;  5F60 A;  4TS8 A;  3UVX A;  4QY4 A;  5E3G A;  2E7O A;  3O37 A;  2E7N A;  5FB0 A;  2R0Y A;  5II1 A;  4Z93 A;  5ETB A;  2E3K A;  4UYF A;  4A9K A;  3HMF A;  5ENJ A;  4N4G A;  4UIY A;  4YYK A;  4A9J A;  4O7F A;  3SVF A;  4NS5 A;  3P1D A;  4MEQ A;  4PS5 A;  5ENB A;  5TCM A;  4UYF B;  3MQM A;  5L99 A;  3Q2E A;  5HRV A;  3O36 A;  2RNX A;  5DKH A;  5DX4 A;  5I40 A;  5IGL A;  2DVQ A;  5ENH A;  5LJ1 A;  5EIS A;  2YYN A;  2WP2 A;  5E9L A;  5CY9 A;  4QEW A;  5DYU A;  3DAI A;  5A85 A;  5A83 A;  5HM0 A;  4YYM A;  3UVY A;  4A9I A;  2YEM A;  5DW2 A;  5FE7 A;  5FH6 A;  5CQ8 A;  4ALG A;  5CRM A;  5CUC A;  4O7C A;  4E96 A;  4HXR A;  4LZ2 A;  4QC1 A;  4YYI A;  4PY6 A;  5H1V A;  4N4F A;  5ENE A;  5BT3 A;  4HXK A;  5G4R A;  5ENF A;  3UV4 A;  4MEO A;  5L8U A;  3IU5 A;  3U5L A;  2DWW A;  4NYX A;  5EI4 A;  5D25 A;  4NR5 A;  4C67 A;  4YYG A;  5CQ5 A;  4A9F A;  4BHW A;  4N4H A;  4NR6 A;  4C66 A;  5E73 A;  4O72 A;  4QSV A;  4CUS A;  5EPR A;  4NRA A;  4XYA A;  5FE5 A;  2F6N A;  5HQ5 A;  4QSR A;  4J0S A;  5II2 A;  4LDF A;  4LYW A;  4F3I A;  3I3J A;  5IGN A;  4HXL A;  4NQM A;  5CQ6 A;  5CUE A;  5D24 A;  2DKW A;  5CUB A;  5I7Y A;  5E0R A;  2OUO A;  4QBM A;  4ZQL A;  3MXF A;  4HBW A;  5CUD A;  5FE9 A;  4Z1Q A;  4NR4 A;  4QR3 A;  5DYX A;  3O34 A;  5F1H A;  5EPS A;  2LSP B;  4NXJ A;  1ZS5 A;  4UIV A;  5KTU A;  3SVH A;  5I88 A;  2G4A A;  2D9E A;  2YW5 A;  5IID A;  4TT2 A;  4Q0N A;  4Z6H A;  4UYG A;  5AME A;  5FE1 A;  1X0J A;  4TTE A;  5ENG A;  5FG4 A;  5G4S A;  4ZW1 A;  5D0C A;  3HMH A;  4CFK A;  4QYL A;  4CL9 A;  4TT6 A;  5CTL A;  2D82 A;  4MR3 A;  5LKZ A;  3IU6 A;  4UIX A;  5DLZ A;  2L85 A;  4UIZ A;  4QSP A;  5DKD A;  3LXJ A;  5FFW A;  3S92 A;  5I7X A;  2F6J A;  4HXN A;  5FBX A;  5EWW A;  4HXO A;  4IR3 A;  4HBV A;  5CPE A;  2MJV B;  5CS8 A;  4J1P A;  5IG6 A;  3P1E A;  4KV4 A;  5I80 A;  1EQF A;  4NYV A;  4O71 A;  5I89 A;  4A9H A;  5HFQ A;  5FE3 A;  4QB3 A;  5A5P A;  4QZS A;  2DVS A;  5EWC A;  3LQI A;  4LR6 A;  4YBT A;  3U5K A;  3QZV A;  5D3P A;  5A7C A;  5F2P A;  3HME A;  5E7D A;  4NQN A;  4KV1 A;  4LC2 A;  4PCI A;  3LQH A;  4YH3 A;  4NR9 A;  5HFR A;  4YK0 A;  5COI A;  5IGK A;  3FKM X;  5CP5 A;  5DKC A;  3AQA A;  4PKL A;  4QEU A;  2RO1 A;  4PCE A;  5LJ2 A;  4LYI A;  4TYL A;  3RCW A;  3UV5 A;  4O7B A;  3ZYU A;  5DBM A;  4NUD A;  5EVA A;  5KTW A;  2L5E A;  4O76 A;  5I83 A;  4YY6 A;  5DYC A;  3AAD A;  5FFV A;  5KO4 A;  2H60 A;  5FE0 A;  4YAX A;  5D3T A;  4GPJ A;  3LQJ A;  5FE4 A;  3O33 A;  5HRX A;  2RFJ A;  3UW9 A;  3G0L A;  2RNY A;  5I86 A;  5HJC A;  4YAB A;  4J3I A;  4NRC A;  5I29 A;  5CU8 A;  5D3J A;  4ZC9 A;  5EP7 A;  5A5N A;  5BT4 A;  3O35 A;  4BW3 A;  5BT5 A;  5H1U A;  4N4I A;  4RVR A;  3U5J A;  2R0V A;  4NUE A;  5CUG A;  4MR5 A;  5FDZ A;  4KCX A;  5FE6 A;  4HBY A;  4XY9 A;  4CUU A;  4ALH A;  5F36 A;  4OUF A;  5HCL A;  4MR6 A;  5D3R A;  5FE2 A;  4CFL A;  5LUU A;  4O7E A;  5EV9 A;  4O70 A;  4IOQ A;  4UIW A;  4J0R A;  1WUM A;  4YBS A;  3ONI A;  4YY4 A;  2RS9 B;  5EM3 A;  4TU4 A;  4QSS A;  4CLB A;  3P1F A;  4A9L A;  3G0J A;  3K2J A;  4QR5 A;  5EWD A;  5D3S A;  5C89 A;  4IOO A;  4YAT A;  5CFW A;  2OSS A;  1E6I A;  5EIC A;  5L8T A;  5F63 A;  3QZS A;  2R0S A;  1F68 A;  2NXB A;  2YEK A;  3Q2F A;  4MR4 A;  4O77 A;  5E9M A;  5H85 A;  2DVV A;  4QR4 A;  4O75 A;  4FLP A;  4AKN A;  2YEL A;  3LJW A;  2DAT A;  5EU1 A;  4YYD A;  4NR7 A;  5DFD A;  5ETD A;  4CUT A;  4TZ2 A;  5EPB A;  4QC3 A;  5HQ7 A;  3JVK A;  5DFC A;  5FH8 A;  4LYS A;  3MUL A;  5FB1 A;  5AMF A;  5E74 A;  5F25 A;  4PTB A;  4QNS A;  5FFY A;  4LRG A;  4XUB A;  4YBM A;  2I7K A;  4YYJ A;  5C87 A;  4O78 A;  4QSW A;  5F62 A;  5EK9 A;  4LZS A;  5ENI A;  5LVR A;  4N3W A;  5D7X A;  5DFB A;  5ENC A;  4A9M A;  5EGU A;  4TT4 A;  4IR6 A;  4LZR A;  4CUP A;  5LJ0 A;  5F3A A;  4OGJ A;  3JVL A;  4YC9 A;  5AD3 A;  4HXM A;  5DW1 A;  5CGP A;  5ACY A;  4A9O A;  4QSX A;  3MB4 A;  4NUC A;  1N72 A;  4HBX A;  5H1T A;  5DLX A;  4QUT A;  5HEM A;  5JI8 A;  4IOR A;  4WHW A;  4BW2 A;  3DWY A;  4XY8 A;  4A9E A;  4DON A;  4QST A;  5EA1 A;  5EWH A;  4CUQ A;  4QYD A;  4QSQ A;  5E3D A;  1JSP B;  5CQ4 A;  3P1C A;  5LVQ A;  3TLP A;  4UYE A;  2GRC A;  3S91 A;  5L96 A;  3JVJ A;  4BJX A;  5CUA A;  4Z1S A;  5CQ3 A;  3MB3 A;  4Z6I A;  4A9N A;  2WP1 A;  5FH7 A;  4YAD A;  5F61 A;  4BW1 A;  2DVR A;  5C4Q A;  2L84 A;  3U5N A;  5A5R A;  4UIT A;  2N9G A;  4IR4 A;  5KU3 A;  5KTX A;  4UYH A;  5C8G A;  4TU6 A;  3U5O A;  2YQD A;  4XUA A;  4MEN A;  5IBN A;  4TQN A;  2KTB B;  3JVM A;  4TZ8 A;  4OGI A;  5AD2 A;  3QZT A;  5L98 A;  3UV2 A;  4HXP A;  5A5S A;  5JWM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...