4YK0A

Crystal structure of the cbp bromodomain in complex with cpi098
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
113
structure length
113
Chain Sequence
IFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CREB-binding protein
publication title Regulatory T Cell Modulation by CBP/EP300 Bromodomain Inhibition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 38
structure length 113
sequence length 113
chains with identical sequence B, C, D
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2015-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4yk0A00
3LQJA 5FE3A 5HELA 2RFJA 5FB0A 5CQ8A 5IGMA 3IU5A 5FG5A 3O37A 5EV9A 3P1FA 5LJ2A 5EPSA 4AKNA 2YELA 4QYDA 2R0SA 5D3RA 5DYCA 5CFWA 4YH3A 5DFDA 4TT4A 4LYSA 3HMFA 4HBXA 4Z6IA 5H1UA 4NRBA 2OSSA 4TS8A 4TZ2A 4CUSA 5A5SA 4O77A 5F36A 4QUTA 4O72A 5ETBA 5KTWA 4YY4A 2G4AA 4QSQA 4QC1A 3UV2A 5DLZA 4HXNA 4Z1SA 5EPBA 5F61A 3UVDA 4C67A 2RS9B 4O70A 3HMEA 4NQNA 4PCEA 2R0YA 4O76A 5CGPA 3P1DA 4YY6A 4BW3A 2RO1A 5ENBA 4YYNA 4YBTA 4UIXA 4ALGA 3GG3A 5C4QA 4UIVA 4J3IA 3FKMX 5FE0A 4NR5A 4O7FA 5HQ5A 2YEKA 2YYNA 5E9VA 5G4RA 3SVHA 5EGUA 5EQ1A 4YYJA 4NRAA 4ZQLA 4QSPA 5FE8A 3QZSA 2N9GA 2L84A 4HXKA 5CQ3A 4HXPA 5IGLA 5D3HA 5KTXA 5CUGA 3JVKA 4TT6A 4WHUA 5CQ7A 5LUUA 5I29A 4HXOA 5CQ5A 5EVAA 3S92A 3JVLA 5EA1A 5IG6A 5LKZA 4YBMA 4NUCA 4A9LA 5AMFA 4FLPA 4BJXA 2OUOA 5FE6A 2DVRA 5EU1A 4WHWA 2NXBA 3Q2EA 5A81A 5ENFA 5A83A 1X0JA 5FH8A 2YQDA 2DVVA 3O35A 5DYAA 5CUBA 4Z1QA 4A9NA 3AQAA 5CTLA 3MUKA 4LZSA 4NYVA 5I40A 4NUEA 5H1TA 5F2PA 4MR4A 4NYXA 5D3SA 4O7CA 4QB3A 2WP1A 4MR5A 5E73A 4GPJA 5L8TA 4YYGA 5DKHA 3AADA 3UV5A 5FH6A 4TQNA 5ENJA 5ENGA 4NXJA 4CL9A 2I7KA 4QSXA 5E9YA 5ENHA 4QZSA 5BT5A 5C87A 5FFVA 4YYDA 4QEUA 3P5OA 5C89A 4YABA 4OGIA 4QEVA 2DVSA 3DWYA 2I8NA 4NR6A 5IGNA 3QZTA 4XUBA 5D3LA 5E9LA 5F25A 3U5MA 4TU4A 5I7YA 3UW9A 5KTUA 4YH4A 4IORA 5ENEA 5G4SA 5I86A 5CQ4A 5LVQA 5CUCA 5D3NA 3TLPA 3S91A 5LVRA 4IOOA 5HQ6A 4A9FA 4UIWA 5IBNA 2D82A 4TYLA 5TCMA 3JVJA 5DLXA 3SVGA 4UYDA 3SVFA 4BHWA 4CUTA 3P1CA 4UYHA 3UVYA 4YC9A 5LKTA 4ZC9A 1E6IA 4N4GA 5C8GA 5EK9A 4IR4A 4C66A 5TB6A 5DYUA 4CFKA 3ZYUA 2RNWA 5D3PA 5HENA 2D9EA 5CP5A 5F62A 4UYFB 4Z93A 4QBMA 4PCIA 4QY4A 5CQAA 5E9MA 2RNYA 5J0DA 3I3JA 5HRWA 5HFRA 4NR7A 1ZS5A 4O7AA 3LJWA 4MENA 4J0RA 4YYKA 5I80A 5HM0A 2MJVB 4A9KA 4QNSA 2LSPB 3MULA 4HBVA 3U5NA 5K29A 5L8UA 4N4IA 4OUFA 5CRMA 4IR5A 5AMEA 4IOQA 4LRGA 4QSTA 4NYWA 4CURA 2L5EA 4E96A 4LDFA 5CQ6A 5EI4A 4HXMA 5EM3A 4HXLA 4BW1A 5KU3A 4QSWA 5CUAA 4NR8A 4OGJA 5I88A 2R10A 5CU8A 2DATA 4HXRA 4NRCA 5EISA 3O36A 5DW1A 2YW5A 4UYGA 5A7CA 5A82A 5HEMA 4ALHA 1N72A 2E7OA 3RCWA 5CY9A 3LQIA 4CFLA 5F1LA 5E7DA 4IR3A 4LYIA 5E74A 5F60A 5D3JA 4A9IA 5E9KA 5HQ7A 2RI7A 2E3KA 3NXBA 4HBYA 4KV1A 5FG4A 5A5RA 2RNXA 4RVRA 5DW2A 2R0VA 4CLBA 4XUAA 4Y03A 3MB4A 4J1PA 5ETDA 4A9EA 3MXFA 4TZ8A 4CUPA 4UYEA 2YEMA 3MQMA 3LXJA 5E0RA 3JVMA 5KHMA 5COIA 1WUMA 4O74A 5L96A 4A9MA 5EP7A 5A5QA 5BT4A 4YK0A 5JWMA 5HCLA 5DBMA 3DAIA 4YYIA 2H60A 4YAXA 4XYAA 3D7CA 5DKCA 5H85A 2GRCA 4PS5A 5CPEA 5FG6A 5H1VA 3LQHA 5F3AA 5I89A 2OO1A 4LYWA 4MEPA 5DY7A 4HBWA 4QSUA 4KCXA 5D3TA 4LC2A 4LZRA 5D25A 5A5OA 2DWWA 4YYMA 4LZ2A 4O78A 5EWCA 2YDWA 4XY9A 4YATA 5FE7A 3IU6A 5FDZA 4TTEA 5CZGA 5ENCA 2DKWA 5CUDA 5CUEA 5EPRA 5FE1A 4N3WA 5I7XA 5CQTA 4YADA 3O34A 5II2A 4TU6A 2L85A 4NS5A 4DONA 4CUQA 5LJ0A 5DYXA 4O7EA 5HRVA 5II1A 3UVWA 5ENIA 1WUGA 1F68A 5I83A 3HMHA 4O71A 4A9OA 2E7NA 4PY6A 4IR6A 5HJCA 5F5ZA 2WP2A 3Q2FA 4QSVA 4O75A 3MB3A 3U5LA 4MR3A 4QR3A 3O33A 4MR6A 5EWDA 5FE2A 5D26A 5E3DA 5AD3A 3G0LA 5FFWA 5EWWA 4HXSA 5D0CA 5A5NA 4CUUA 4UIUA 4O7BA 4ZW1A 5KO4A 5AD2A 4QUUA 3UVXA 4QSRA 5CS8A 5E3GA 4BW4A 2F6JA 4PKLA 4QR4A 4QR5A 4QC3A 5LKXA 5L97A 5I1QA 3U5KA 4KV4A 2FSAA 4Q0OA 3U5JA 5DFBA 5FE5A 5IIDA 4UITA 3K2JA 5A85A 5EWHA 3UV4A 1EQFA 4UIYA 4QYLA 5A5PA 5C85A 5ACYA 1JSPB 4N4FA 5L98A 4NUDA 5DKDA 4YYHA 4TT2A 5EWVA 4X2IA 5FBXA 4PTBA 5D7XA 5HRXA 5HLSA 4WIVA 5E9IA 4A9HA 5LKUA 5LJ1A 5IGKA 4MEOA 5FB1A 5BT3A 5DFCA 4QSSA 5EICA 4Q0NA 4QEWA 5L99A 5F63A 5D24A 5C7NA 4XY8A 3U5PA 5CRZA 3P1EA 5HFQA 1JM4B 3G0JA 2KTBB 4YBSA 4NR4A 4UYFA 5DX4A 4F3IA 5JI8A 4UIZA 4J0SA 4A9JA 3ONIA 2F6NA 4BW2A 5FE4A 5FE9A 4MEQA 4NQMA 3U5OA 5FFYA 3QZVA 4N4HA 4LR6A 2DVQA 4NR9A 5F1HA 4Z6HA 5FH7A
chains in the Genus database with same CATH superfamily
3LQJA 5FE3A 5HELA 2RFJA 5FB0A 5CQ8A 5IGMA 3IU5A 5FG5A 3O37A 5EV9A 3P1FA 5LJ2A 5EPSA 4AKNA 2YELA 3VKGA 4QYDA 2R0SA 5D3RA 5DYCA 5CFWA 4YH3A 5DFDA 4TT4A 4LYSA 3HMFA 4HBXA 4Z6IA 5H1UA 4NRBA 2OSSA 4TS8A 4TZ2A 4CUSA 5A5SA 4O77A 5F36A 4QUTA 4O72A 5ETBA 5KTWA 4YY4A 2G4AA 4QSQA 4QC1A 3UV2A 5DLZA 4HXNA 4Z1SA 5EPBA 5F61A 3UVDA 4C67A 2RS9B 4O70A 3HMEA 4NQNA 4PCEA 2R0YA 4O76A 5CGPA 3P1DA 4YY6A 4BW3A 2RO1A 5ENBA 4YYNA 4YBTA 4UIXA 4ALGA 3GG3A 5C4QA 4UIVA 4J3IA 3FKMX 5FE0A 4NR5A 3ERRA 4O7FA 5HQ5A 2YEKA 2YYNA 5E9VA 5G4RA 3SVHA 5EGUA 5EQ1A 4YYJA 4NRAA 4ZQLA 4QSPA 5FE8A 3QZSA 2N9GA 2L84A 4HXKA 5CQ3A 4HXPA 5IGLA 5D3HA 5KTXA 5CUGA 3JVKA 4TT6A 4WHUA 5CQ7A 5LUUA 4AI6A 5I29A 4HXOA 5CQ5A 5EVAA 3S92A 3JVLA 5EA1A 5IG6A 5LKZA 4YBMA 4NUCA 4A9LA 5AMFA 4FLPA 4BJXA 2OUOA 5FE6A 2DVRA 5EU1A 4WHWA 2NXBA 3Q2EA 5A81A 5ENFA 5A83A 1X0JA 5FH8A 2YQDA 2DVVA 3O35A 5DYAA 5CUBA 4Z1QA 4A9NA 3AQAA 5CTLA 3MUKA 4LZSA 4NYVA 5I40A 4NUEA 5H1TA 5F2PA 4MR4A 4NYXA 5D3SA 4O7CA 4QB3A 2WP1A 4MR5A 5E73A 4GPJA 5L8TA 4YYGA 5DKHA 3AADA 3UV5A 5FH6A 4TQNA 5ENJA 5ENGA 4NXJA 4CL9A 2I7KA 4QSXA 5E9YA 5ENHA 4QZSA 5BT5A 5C87A 5FFVA 3VKHA 4YYDA 4QEUA 3P5OA 5C89A 4YABA 4OGIA 4QEVA 2DVSA 3DWYA 4AKGA 2I8NA 4NR6A 5IGNA 3QZTA 4XUBA 5D3LA 5E9LA 5F25A 3U5MA 4TU4A 5I7YA 3UW9A 5KTUA 4YH4A 4IORA 5ENEA 5G4SA 5I86A 5CQ4A 5LVQA 5CUCA 5D3NA 3TLPA 3S91A 5LVRA 4IOOA 5HQ6A 4A9FA 4UIWA 5IBNA 2D82A 4AKHA 4TYLA 5TCMA 3JVJA 5DLXA 3SVGA 4UYDA 3SVFA 4BHWA 4CUTA 3P1CA 4UYHA 3UVYA 4YC9A 5LKTA 4ZC9A 1E6IA 4N4GA 5C8GA 5EK9A 4IR4A 4C66A 5TB6A 5DYUA 4CFKA 3ZYUA 2RNWA 5D3PA 5HENA 2D9EA 5CP5A 5F62A 4UYFB 4Z93A 4QBMA 4PCIA 4QY4A 5CQAA 5E9MA 2RNYA 5J0DA 3I3JA 5HRWA 5HFRA 4NR7A 1ZS5A 4O7AA 3LJWA 4MENA 4J0RA 4YYKA 5I80A 5HM0A 2MJVB 4A9KA 4QNSA 2LSPB 3MULA 4AKIA 4HBVA 3U5NA 5K29A 5L8UA 4N4IA 4OUFA 5CRMA 4IR5A 5AMEA 4IOQA 4LRGA 4QSTA 4NYWA 4CURA 2L5EA 4E96A 4LDFA 5CQ6A 5EI4A 4HXMA 5EM3A 4HXLA 4BW1A 5KU3A 4QSWA 5CUAA 4NR8A 4OGJA 5I88A 2R10A 5CU8A 2DATA 1ZKRA 4HXRA 4NRCA 1PUOA 5EISA 3O36A 5DW1A 2YW5A 4UYGA 5A7CA 5A82A 5HEMA 4ALHA 1N72A 2E7OA 3RCWA 5CY9A 3LQIA 4CFLA 5F1LA 2EJNA 5E7DA 4IR3A 4LYIA 5E74A 5F60A 5D3JA 4A9IA 5E9KA 5HQ7A 2RI7A 2E3KA 3NXBA 4HBYA 4KV1A 5FG4A 5A5RA 2RNXA 4RVRA 5DW2A 2R0VA 3D1DA 4CLBA 4XUAA 4Y03A 3MB4A 4J1PA 5ETDA 4A9EA 3MXFA 4TZ8A 4CUPA 4UYEA 2YEMA 3MQMA 3LXJA 5E0RA 3JVMA 5KHMA 5COIA 1WUMA 4O74A 5L96A 4A9MA 5EP7A 5A5QA 5BT4A 4YK0A 5JWMA 5HCLA 5DBMA 3DAIA 4YYIA 2H60A 4YAXA 4XYAA 3D7CA 5DKCA 5H85A 2GRCA 4PS5A 5CPEA 5FG6A 5H1VA 3LQHA 5F3AA 5I89A 2OO1A 4LYWA 4MEPA 5DY7A 4HBWA 4QSUA 4KCXA 5D3TA 4LC2A 4LZRA 5D25A 5A5OA 2DWWA 4YYMA 4LZ2A 4O78A 5EWCA 2YDWA 4XY9A 4YATA 5FE7A 3IU6A 5FDZA 4TTEA 5CZGA 5ENCA 2DKWA 5CUDA 5CUEA 5EPRA 5FE1A 4N3WA 5I7XA 5CQTA 4YADA 3O34A 5II2A 4TU6A 2L85A 4NS5A 4DONA 4CUQA 5LJ0A 5DYXA 4O7EA 5HRVA 5II1A 3UVWA 5ENIA 1WUGA 1F68A 5I83A 3HMHA 4O71A 4A9OA 2E7NA 4PY6A 4IR6A 5HJCA 5F5ZA 2WP2A 3Q2FA 4QSVA 4O75A 3MB3A 3U5LA 4MR3A 4QR3A 3O33A 4MR6A 5EWDA 5FE2A 5D26A 5E3DA 5AD3A 3G0LA 5FFWA 5EWWA 4HXSA 5D0CA 5A5NA 4CUUA 4UIUA 4O7BA 4ZW1A 5KO4A 5AD2A 4QUUA 3UVXA 4QSRA 5CS8A 5E3GA 4BW4A 2F6JA 4PKLA 4QR4A 4QR5A 4QC3A 5LKXA 5L97A 5I1QA 3U5KA 4KV4A 2FSAA 4Q0OA 3U5JA 5DFBA 5FE5A 5IIDA 4UITA 3K2JA 5A85A 5EWHA 3UV4A 1EQFA 4UIYA 4QYLA 5A5PA 5C85A 5ACYA 1JSPB 4N4FA 5L98A 4NUDA 5DKDA 4YYHA 4TT2A 5EWVA 4X2IA 5FBXA 4PTBA 5D7XA 5HRXA 5HLSA 4WIVA 5E9IA 4A9HA 5LKUA 5LJ1A 5IGKA 4MEOA 5FB1A 5BT3A 5DFCA 4QSSA 5EICA 4Q0NA 4QEWA 5L99A 5F63A 5D24A 5C7NA 4XY8A 3U5PA 5CRZA 3P1EA 5HFQA 1JM4B 3G0JA 2KTBB 4YBSA 4NR4A 4UYFA 5DX4A 4F3IA 5JI8A 4UIZA 4J0SA 4A9JA 3ONIA 2F6NA 4BW2A 5FE4A 5FE9A 4MEQA 4NQMA 3U5OA 5FFYA 3QZVA 4N4HA 4LR6A 2DVQA 3D1BA 4NR9A 5F1HA 4Z6HA 5FH7A
chains in the Genus database with same CATH topology
3LQJA 5FE3A 5HELA 2RFJA 5FB0A 5CQ8A 5IGMA 3IU5A 5FG5A 3O37A 5EV9A 3P1FA 5LJ2A 5EPSA 4AKNA 2YELA 4QYDA 2R0SA 5D3RA 5DYCA 5CFWA 4YH3A 5DFDA 4TT4A 4LYSA 3HMFA 4HBXA 4Z6IA 5H1UA 4NRBA 2OSSA 4TS8A 4TZ2A 4CUSA 5A5SA 4O77A 5F36A 4QUTA 4O72A 5ETBA 5KTWA 4YY4A 2G4AA 4QSQA 4QC1A 3UV2A 5DLZA 4HXNA 4Z1SA 5EPBA 5F61A 3UVDA 4C67A 2RS9B 4O70A 3HMEA 4NQNA 4PCEA 2R0YA 4O76A 5CGPA 3P1DA 4YY6A 4BW3A 2RO1A 5ENBA 4YYNA 4YBTA 4UIXA 4ALGA 3GG3A 5C4QA 4UIVA 4J3IA 3FKMX 5FE0A 4NR5A 4O7FA 5HQ5A 2YEKA 2YYNA 5E9VA 5G4RA 3SVHA 5EGUA 5EQ1A 4YYJA 4NRAA 4ZQLA 4QSPA 5FE8A 3QZSA 2N9GA 2L84A 4HXKA 5CQ3A 4HXPA 5IGLA 5D3HA 5KTXA 5CUGA 3JVKA 4TT6A 4WHUA 5CQ7A 5LUUA 5I29A 4HXOA 5CQ5A 5EVAA 3S92A 3JVLA 5EA1A 5IG6A 5LKZA 4YBMA 4NUCA 4A9LA 5AMFA 4FLPA 4BJXA 2OUOA 5FE6A 2DVRA 5EU1A 4WHWA 2NXBA 3Q2EA 5A81A 5ENFA 5A83A 1X0JA 5FH8A 2YQDA 2DVVA 3O35A 5DYAA 5CUBA 4Z1QA 4A9NA 3AQAA 5CTLA 3MUKA 4LZSA 4NYVA 5I40A 4NUEA 5H1TA 5F2PA 4MR4A 4NYXA 5D3SA 4O7CA 4QB3A 2WP1A 4MR5A 5E73A 4GPJA 5L8TA 4YYGA 5DKHA 3AADA 3UV5A 5FH6A 4TQNA 5ENJA 5ENGA 4NXJA 4CL9A 2I7KA 4QSXA 5E9YA 5ENHA 4QZSA 5BT5A 5C87A 5FFVA 4YYDA 4QEUA 3P5OA 5C89A 4YABA 4OGIA 4QEVA 2DVSA 3DWYA 2I8NA 4NR6A 5IGNA 3QZTA 4XUBA 5D3LA 5E9LA 5F25A 3U5MA 4TU4A 5I7YA 3UW9A 5KTUA 4YH4A 4IORA 5ENEA 5G4SA 5I86A 5CQ4A 5LVQA 5CUCA 5D3NA 3TLPA 3S91A 5LVRA 4IOOA 5HQ6A 4A9FA 4UIWA 5IBNA 2D82A 4TYLA 5TCMA 3JVJA 5DLXA 3SVGA 4UYDA 3SVFA 4BHWA 4CUTA 3P1CA 4UYHA 3UVYA 4YC9A 5LKTA 4ZC9A 1E6IA 4N4GA 5C8GA 5EK9A 4IR4A 4C66A 5TB6A 5DYUA 4CFKA 3ZYUA 2RNWA 5D3PA 5HENA 2D9EA 5CP5A 5F62A 4UYFB 4Z93A 4QBMA 4PCIA 4QY4A 5CQAA 5E9MA 2RNYA 5J0DA 3I3JA 5HRWA 5HFRA 4NR7A 1ZS5A 4O7AA 3LJWA 4MENA 4J0RA 4YYKA 5I80A 5HM0A 2MJVB 4A9KA 4QNSA 2LSPB 3MULA 4HBVA 3U5NA 5K29A 5L8UA 4N4IA 4OUFA 5CRMA 4IR5A 5AMEA 4IOQA 4LRGA 4QSTA 4NYWA 4CURA 2L5EA 4E96A 4LDFA 5CQ6A 5EI4A 4HXMA 5EM3A 4HXLA 4BW1A 5KU3A 4QSWA 5CUAA 4NR8A 4OGJA 5I88A 2R10A 5CU8A 2DATA 4HXRA 4NRCA 5EISA 3O36A 5DW1A 2YW5A 4UYGA 5A7CA 5A82A 5HEMA 4ALHA 1N72A 2E7OA 3RCWA 5CY9A 3LQIA 4CFLA 5F1LA 5E7DA 4IR3A 4LYIA 5E74A 5F60A 5D3JA 4A9IA 5E9KA 5HQ7A 2RI7A 2E3KA 3NXBA 4HBYA 4KV1A 5FG4A 5A5RA 2RNXA 4RVRA 5DW2A 2R0VA 4CLBA 4XUAA 4Y03A 3MB4A 4J1PA 5ETDA 4A9EA 3MXFA 4TZ8A 4CUPA 4UYEA 2YEMA 3MQMA 3LXJA 5E0RA 3JVMA 5KHMA 5COIA 1WUMA 4O74A 5L96A 4A9MA 5EP7A 5A5QA 5BT4A 4YK0A 5JWMA 5HCLA 5DBMA 3DAIA 4YYIA 2H60A 4YAXA 4XYAA 3D7CA 5DKCA 5H85A 2GRCA 4PS5A 5CPEA 5FG6A 5H1VA 3LQHA 5F3AA 5I89A 2OO1A 4LYWA 4MEPA 5DY7A 4HBWA 4QSUA 4KCXA 5D3TA 4LC2A 4LZRA 5D25A 5A5OA 2DWWA 4YYMA 4LZ2A 4O78A 5EWCA 2YDWA 4XY9A 4YATA 5FE7A 3IU6A 5FDZA 4TTEA 5CZGA 5ENCA 2DKWA 5CUDA 5CUEA 5EPRA 5FE1A 4N3WA 5I7XA 5CQTA 4YADA 3O34A 5II2A 4TU6A 2L85A 4NS5A 4DONA 4CUQA 5LJ0A 5DYXA 4O7EA 5HRVA 5II1A 3UVWA 5ENIA 1WUGA 1F68A 5I83A 3HMHA 4O71A 4A9OA 2E7NA 4PY6A 4IR6A 5HJCA 5F5ZA 2WP2A 3Q2FA 4QSVA 4O75A 3MB3A 3U5LA 4MR3A 4QR3A 3O33A 4MR6A 5EWDA 5FE2A 5D26A 5E3DA 5AD3A 3G0LA 5FFWA 5EWWA 4HXSA 5D0CA 5A5NA 4CUUA 4UIUA 4O7BA 4ZW1A 5KO4A 5AD2A 4QUUA 3UVXA 4QSRA 5CS8A 5E3GA 4BW4A 2F6JA 4PKLA 4QR4A 4QR5A 4QC3A 5LKXA 5L97A 5I1QA 3U5KA 4KV4A 2FSAA 4Q0OA 3U5JA 5DFBA 5FE5A 5IIDA 4UITA 3K2JA 5A85A 5EWHA 3UV4A 1EQFA 4UIYA 4QYLA 5A5PA 5C85A 5ACYA 1JSPB 4N4FA 5L98A 4NUDA 5DKDA 4YYHA 4TT2A 5EWVA 4X2IA 5FBXA 4PTBA 5D7XA 5HRXA 5HLSA 4WIVA 5E9IA 4A9HA 5LKUA 5LJ1A 5IGKA 4MEOA 5FB1A 5BT3A 5DFCA 4QSSA 5EICA 4Q0NA 4QEWA 5L99A 5F63A 5D24A 5C7NA 4XY8A 3U5PA 5CRZA 3P1EA 5HFQA 1JM4B 3G0JA 2KTBB 4YBSA 4NR4A 4UYFA 5DX4A 4F3IA 5JI8A 4UIZA 4J0SA 4A9JA 3ONIA 2F6NA 4BW2A 5FE4A 5FE9A 4MEQA 4NQMA 3U5OA 5FFYA 3QZVA 4N4HA 4LR6A 2DVQA 4NR9A 5F1HA 4Z6HA 5FH7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LQJ A;  5FE3 A;  5HEL A;  2RFJ A;  5FB0 A;  5CQ8 A;  5IGM A;  3IU5 A;  5FG5 A;  3O37 A;  5EV9 A;  3P1F A;  5LJ2 A;  5EPS A;  4AKN A;  2YEL A;  4QYD A;  2R0S A;  5D3R A;  5DYC A;  5CFW A;  4YH3 A;  5DFD A;  4TT4 A;  4LYS A;  3HMF A;  4HBX A;  4Z6I A;  5H1U A;  4NRB A;  2OSS A;  4TS8 A;  4TZ2 A;  4CUS A;  5A5S A;  4O77 A;  5F36 A;  4QUT A;  4O72 A;  5ETB A;  5KTW A;  4YY4 A;  2G4A A;  4QSQ A;  4QC1 A;  3UV2 A;  5DLZ A;  4HXN A;  4Z1S A;  5EPB A;  5F61 A;  3UVD A;  4C67 A;  2RS9 B;  4O70 A;  3HME A;  4NQN A;  4PCE A;  2R0Y A;  4O76 A;  5CGP A;  3P1D A;  4YY6 A;  4BW3 A;  2RO1 A;  5ENB A;  4YYN A;  4YBT A;  4UIX A;  4ALG A;  3GG3 A;  5C4Q A;  4UIV A;  4J3I A;  3FKM X;  5FE0 A;  4NR5 A;  4O7F A;  5HQ5 A;  2YEK A;  2YYN A;  5E9V A;  5G4R A;  3SVH A;  5EGU A;  5EQ1 A;  4YYJ A;  4NRA A;  4ZQL A;  4QSP A;  5FE8 A;  3QZS A;  2N9G A;  2L84 A;  4HXK A;  5CQ3 A;  4HXP A;  5IGL A;  5D3H A;  5KTX A;  5CUG A;  3JVK A;  4TT6 A;  4WHU A;  5CQ7 A;  5LUU A;  5I29 A;  4HXO A;  5CQ5 A;  5EVA A;  3S92 A;  3JVL A;  5EA1 A;  5IG6 A;  5LKZ A;  4YBM A;  4NUC A;  4A9L A;  5AMF A;  4FLP A;  4BJX A;  2OUO A;  5FE6 A;  2DVR A;  5EU1 A;  4WHW A;  2NXB A;  3Q2E A;  5A81 A;  5ENF A;  5A83 A;  1X0J A;  5FH8 A;  2YQD A;  2DVV A;  3O35 A;  5DYA A;  5CUB A;  4Z1Q A;  4A9N A;  3AQA A;  5CTL A;  3MUK A;  4LZS A;  4NYV A;  5I40 A;  4NUE A;  5H1T A;  5F2P A;  4MR4 A;  4NYX A;  5D3S A;  4O7C A;  4QB3 A;  2WP1 A;  4MR5 A;  5E73 A;  4GPJ A;  5L8T A;  4YYG A;  5DKH A;  3AAD A;  3UV5 A;  5FH6 A;  4TQN A;  5ENJ A;  5ENG A;  4NXJ A;  4CL9 A;  2I7K A;  4QSX A;  5E9Y A;  5ENH A;  4QZS A;  5BT5 A;  5C87 A;  5FFV A;  4YYD A;  4QEU A;  3P5O A;  5C89 A;  4YAB A;  4OGI A;  4QEV A;  2DVS A;  3DWY A;  2I8N A;  4NR6 A;  5IGN A;  3QZT A;  4XUB A;  5D3L A;  5E9L A;  5F25 A;  3U5M A;  4TU4 A;  5I7Y A;  3UW9 A;  5KTU A;  4YH4 A;  4IOR A;  5ENE A;  5G4S A;  5I86 A;  5CQ4 A;  5LVQ A;  5CUC A;  5D3N A;  3TLP A;  3S91 A;  5LVR A;  4IOO A;  5HQ6 A;  4A9F A;  4UIW A;  5IBN A;  2D82 A;  4TYL A;  5TCM A;  3JVJ A;  5DLX A;  3SVG A;  4UYD A;  3SVF A;  4BHW A;  4CUT A;  3P1C A;  4UYH A;  3UVY A;  4YC9 A;  5LKT A;  4ZC9 A;  1E6I A;  4N4G A;  5C8G A;  5EK9 A;  4IR4 A;  4C66 A;  5TB6 A;  5DYU A;  4CFK A;  3ZYU A;  2RNW A;  5D3P A;  5HEN A;  2D9E A;  5CP5 A;  5F62 A;  4UYF B;  4Z93 A;  4QBM A;  4PCI A;  4QY4 A;  5CQA A;  5E9M A;  2RNY A;  5J0D A;  3I3J A;  5HRW A;  5HFR A;  4NR7 A;  1ZS5 A;  4O7A A;  3LJW A;  4MEN A;  4J0R A;  4YYK A;  5I80 A;  5HM0 A;  2MJV B;  4A9K A;  4QNS A;  2LSP B;  3MUL A;  4HBV A;  3U5N A;  5K29 A;  5L8U A;  4N4I A;  4OUF A;  5CRM A;  4IR5 A;  5AME A;  4IOQ A;  4LRG A;  4QST A;  4NYW A;  4CUR A;  2L5E A;  4E96 A;  4LDF A;  5CQ6 A;  5EI4 A;  4HXM A;  5EM3 A;  4HXL A;  4BW1 A;  5KU3 A;  4QSW A;  5CUA A;  4NR8 A;  4OGJ A;  5I88 A;  2R10 A;  5CU8 A;  2DAT A;  4HXR A;  4NRC A;  5EIS A;  3O36 A;  5DW1 A;  2YW5 A;  4UYG A;  5A7C A;  5A82 A;  5HEM A;  4ALH A;  1N72 A;  2E7O A;  3RCW A;  5CY9 A;  3LQI A;  4CFL A;  5F1L A;  5E7D A;  4IR3 A;  4LYI A;  5E74 A;  5F60 A;  5D3J A;  4A9I A;  5E9K A;  5HQ7 A;  2RI7 A;  2E3K A;  3NXB A;  4HBY A;  4KV1 A;  5FG4 A;  5A5R A;  2RNX A;  4RVR A;  5DW2 A;  2R0V A;  4CLB A;  4XUA A;  4Y03 A;  3MB4 A;  4J1P A;  5ETD A;  4A9E A;  3MXF A;  4TZ8 A;  4CUP A;  4UYE A;  2YEM A;  3MQM A;  3LXJ A;  5E0R A;  3JVM A;  5KHM A;  5COI A;  1WUM A;  4O74 A;  5L96 A;  4A9M A;  5EP7 A;  5A5Q A;  5BT4 A;  4YK0 A;  5JWM A;  5HCL A;  5DBM A;  3DAI A;  4YYI A;  2H60 A;  4YAX A;  4XYA A;  3D7C A;  5DKC A;  5H85 A;  2GRC A;  4PS5 A;  5CPE A;  5FG6 A;  5H1V A;  3LQH A;  5F3A A;  5I89 A;  2OO1 A;  4LYW A;  4MEP A;  5DY7 A;  4HBW A;  4QSU A;  4KCX A;  5D3T A;  4LC2 A;  4LZR A;  5D25 A;  5A5O A;  2DWW A;  4YYM A;  4LZ2 A;  4O78 A;  5EWC A;  2YDW A;  4XY9 A;  4YAT A;  5FE7 A;  3IU6 A;  5FDZ A;  4TTE A;  5CZG A;  5ENC A;  2DKW A;  5CUD A;  5CUE A;  5EPR A;  5FE1 A;  4N3W A;  5I7X A;  5CQT A;  4YAD A;  3O34 A;  5II2 A;  4TU6 A;  2L85 A;  4NS5 A;  4DON A;  4CUQ A;  5LJ0 A;  5DYX A;  4O7E A;  5HRV A;  5II1 A;  3UVW A;  5ENI A;  1WUG A;  1F68 A;  5I83 A;  3HMH A;  4O71 A;  4A9O A;  2E7N A;  4PY6 A;  4IR6 A;  5HJC A;  5F5Z A;  2WP2 A;  3Q2F A;  4QSV A;  4O75 A;  3MB3 A;  3U5L A;  4MR3 A;  4QR3 A;  3O33 A;  4MR6 A;  5EWD A;  5FE2 A;  5D26 A;  5E3D A;  5AD3 A;  3G0L A;  5FFW A;  5EWW A;  4HXS A;  5D0C A;  5A5N A;  4CUU A;  4UIU A;  4O7B A;  4ZW1 A;  5KO4 A;  5AD2 A;  4QUU A;  3UVX A;  4QSR A;  5CS8 A;  5E3G A;  4BW4 A;  2F6J A;  4PKL A;  4QR4 A;  4QR5 A;  4QC3 A;  5LKX A;  5L97 A;  5I1Q A;  3U5K A;  4KV4 A;  2FSA A;  4Q0O A;  3U5J A;  5DFB A;  5FE5 A;  5IID A;  4UIT A;  3K2J A;  5A85 A;  5EWH A;  3UV4 A;  1EQF A;  4UIY A;  4QYL A;  5A5P A;  5C85 A;  5ACY A;  1JSP B;  4N4F A;  5L98 A;  4NUD A;  5DKD A;  4YYH A;  4TT2 A;  5EWV A;  4X2I A;  5FBX A;  4PTB A;  5D7X A;  5HRX A;  5HLS A;  4WIV A;  5E9I A;  4A9H A;  5LKU A;  5LJ1 A;  5IGK A;  4MEO A;  5FB1 A;  5BT3 A;  5DFC A;  4QSS A;  5EIC A;  4Q0N A;  4QEW A;  5L99 A;  5F63 A;  5D24 A;  5C7N A;  4XY8 A;  3U5P A;  5CRZ A;  3P1E A;  5HFQ A;  1JM4 B;  3G0J A;  2KTB B;  4YBS A;  4NR4 A;  4UYF A;  5DX4 A;  4F3I A;  5JI8 A;  4UIZ A;  4J0S A;  4A9J A;  3ONI A;  2F6N A;  4BW2 A;  5FE4 A;  5FE9 A;  4MEQ A;  4NQM A;  3U5O A;  5FFY A;  3QZV A;  4N4H A;  4LR6 A;  2DVQ A;  4NR9 A;  5F1H A;  4Z6H A;  5FH7 A; 
#chains in the Genus database with same CATH topology
 3LQJ A;  5FE3 A;  5HEL A;  2RFJ A;  5FB0 A;  5CQ8 A;  5IGM A;  3IU5 A;  5FG5 A;  3O37 A;  5EV9 A;  3P1F A;  5LJ2 A;  5EPS A;  4AKN A;  2YEL A;  3VKG A;  4QYD A;  2R0S A;  5D3R A;  5DYC A;  5CFW A;  4YH3 A;  5DFD A;  4TT4 A;  4LYS A;  3HMF A;  4HBX A;  4Z6I A;  5H1U A;  4NRB A;  2OSS A;  4TS8 A;  4TZ2 A;  4CUS A;  5A5S A;  4O77 A;  5F36 A;  4QUT A;  4O72 A;  5ETB A;  5KTW A;  4YY4 A;  2G4A A;  4QSQ A;  4QC1 A;  3UV2 A;  5DLZ A;  4HXN A;  4Z1S A;  5EPB A;  5F61 A;  3UVD A;  4C67 A;  2RS9 B;  4O70 A;  3HME A;  4NQN A;  4PCE A;  2R0Y A;  4O76 A;  5CGP A;  3P1D A;  4YY6 A;  4BW3 A;  2RO1 A;  5ENB A;  4YYN A;  4YBT A;  4UIX A;  4ALG A;  3GG3 A;  5C4Q A;  4UIV A;  4J3I A;  3FKM X;  5FE0 A;  4NR5 A;  3ERR A;  4O7F A;  5HQ5 A;  2YEK A;  2YYN A;  5E9V A;  5G4R A;  3SVH A;  5EGU A;  5EQ1 A;  4YYJ A;  4NRA A;  4ZQL A;  4QSP A;  5FE8 A;  3QZS A;  2N9G A;  2L84 A;  4HXK A;  5CQ3 A;  4HXP A;  5IGL A;  5D3H A;  5KTX A;  5CUG A;  3JVK A;  4TT6 A;  4WHU A;  5CQ7 A;  5LUU A;  4AI6 A;  5I29 A;  4HXO A;  5CQ5 A;  5EVA A;  3S92 A;  3JVL A;  5EA1 A;  5IG6 A;  5LKZ A;  4YBM A;  4NUC A;  4A9L A;  5AMF A;  4FLP A;  4BJX A;  2OUO A;  5FE6 A;  2DVR A;  5EU1 A;  4WHW A;  2NXB A;  3Q2E A;  5A81 A;  5ENF A;  5A83 A;  1X0J A;  5FH8 A;  2YQD A;  2DVV A;  3O35 A;  5DYA A;  5CUB A;  4Z1Q A;  4A9N A;  3AQA A;  5CTL A;  3MUK A;  4LZS A;  4NYV A;  5I40 A;  4NUE A;  5H1T A;  5F2P A;  4MR4 A;  4NYX A;  5D3S A;  4O7C A;  4QB3 A;  2WP1 A;  4MR5 A;  5E73 A;  4GPJ A;  5L8T A;  4YYG A;  5DKH A;  3AAD A;  3UV5 A;  5FH6 A;  4TQN A;  5ENJ A;  5ENG A;  4NXJ A;  4CL9 A;  2I7K A;  4QSX A;  5E9Y A;  5ENH A;  4QZS A;  5BT5 A;  5C87 A;  5FFV A;  3VKH A;  4YYD A;  4QEU A;  3P5O A;  5C89 A;  4YAB A;  4OGI A;  4QEV A;  2DVS A;  3DWY A;  4AKG A;  2I8N A;  4NR6 A;  5IGN A;  3QZT A;  4XUB A;  5D3L A;  5E9L A;  5F25 A;  3U5M A;  4TU4 A;  5I7Y A;  3UW9 A;  5KTU A;  4YH4 A;  4IOR A;  5ENE A;  5G4S A;  5I86 A;  5CQ4 A;  5LVQ A;  5CUC A;  5D3N A;  3TLP A;  3S91 A;  5LVR A;  4IOO A;  5HQ6 A;  4A9F A;  4UIW A;  5IBN A;  2D82 A;  4AKH A;  4TYL A;  5TCM A;  3JVJ A;  5DLX A;  3SVG A;  4UYD A;  3SVF A;  4BHW A;  4CUT A;  3P1C A;  4UYH A;  3UVY A;  4YC9 A;  5LKT A;  4ZC9 A;  1E6I A;  4N4G A;  5C8G A;  5EK9 A;  4IR4 A;  4C66 A;  5TB6 A;  5DYU A;  4CFK A;  3ZYU A;  2RNW A;  5D3P A;  5HEN A;  2D9E A;  5CP5 A;  5F62 A;  4UYF B;  4Z93 A;  4QBM A;  4PCI A;  4QY4 A;  5CQA A;  5E9M A;  2RNY A;  5J0D A;  3I3J A;  5HRW A;  5HFR A;  4NR7 A;  1ZS5 A;  4O7A A;  3LJW A;  4MEN A;  4J0R A;  4YYK A;  5I80 A;  5HM0 A;  2MJV B;  4A9K A;  4QNS A;  2LSP B;  3MUL A;  4AKI A;  4HBV A;  3U5N A;  5K29 A;  5L8U A;  4N4I A;  4OUF A;  5CRM A;  4IR5 A;  5AME A;  4IOQ A;  4LRG A;  4QST A;  4NYW A;  4CUR A;  2L5E A;  4E96 A;  4LDF A;  5CQ6 A;  5EI4 A;  4HXM A;  5EM3 A;  4HXL A;  4BW1 A;  5KU3 A;  4QSW A;  5CUA A;  4NR8 A;  4OGJ A;  5I88 A;  2R10 A;  5CU8 A;  2DAT A;  1ZKR A;  4HXR A;  4NRC A;  1PUO A;  5EIS A;  3O36 A;  5DW1 A;  2YW5 A;  4UYG A;  5A7C A;  5A82 A;  5HEM A;  4ALH A;  1N72 A;  2E7O A;  3RCW A;  5CY9 A;  3LQI A;  4CFL A;  5F1L A;  2EJN A;  5E7D A;  4IR3 A;  4LYI A;  5E74 A;  5F60 A;  5D3J A;  4A9I A;  5E9K A;  5HQ7 A;  2RI7 A;  2E3K A;  3NXB A;  4HBY A;  4KV1 A;  5FG4 A;  5A5R A;  2RNX A;  4RVR A;  5DW2 A;  2R0V A;  3D1D A;  4CLB A;  4XUA A;  4Y03 A;  3MB4 A;  4J1P A;  5ETD A;  4A9E A;  3MXF A;  4TZ8 A;  4CUP A;  4UYE A;  2YEM A;  3MQM A;  3LXJ A;  5E0R A;  3JVM A;  5KHM A;  5COI A;  1WUM A;  4O74 A;  5L96 A;  4A9M A;  5EP7 A;  5A5Q A;  5BT4 A;  4YK0 A;  5JWM A;  5HCL A;  5DBM A;  3DAI A;  4YYI A;  2H60 A;  4YAX A;  4XYA A;  3D7C A;  5DKC A;  5H85 A;  2GRC A;  4PS5 A;  5CPE A;  5FG6 A;  5H1V A;  3LQH A;  5F3A A;  5I89 A;  2OO1 A;  4LYW A;  4MEP A;  5DY7 A;  4HBW A;  4QSU A;  4KCX A;  5D3T A;  4LC2 A;  4LZR A;  5D25 A;  5A5O A;  2DWW A;  4YYM A;  4LZ2 A;  4O78 A;  5EWC A;  2YDW A;  4XY9 A;  4YAT A;  5FE7 A;  3IU6 A;  5FDZ A;  4TTE A;  5CZG A;  5ENC A;  2DKW A;  5CUD A;  5CUE A;  5EPR A;  5FE1 A;  4N3W A;  5I7X A;  5CQT A;  4YAD A;  3O34 A;  5II2 A;  4TU6 A;  2L85 A;  4NS5 A;  4DON A;  4CUQ A;  5LJ0 A;  5DYX A;  4O7E A;  5HRV A;  5II1 A;  3UVW A;  5ENI A;  1WUG A;  1F68 A;  5I83 A;  3HMH A;  4O71 A;  4A9O A;  2E7N A;  4PY6 A;  4IR6 A;  5HJC A;  5F5Z A;  2WP2 A;  3Q2F A;  4QSV A;  4O75 A;  3MB3 A;  3U5L A;  4MR3 A;  4QR3 A;  3O33 A;  4MR6 A;  5EWD A;  5FE2 A;  5D26 A;  5E3D A;  5AD3 A;  3G0L A;  5FFW A;  5EWW A;  4HXS A;  5D0C A;  5A5N A;  4CUU A;  4UIU A;  4O7B A;  4ZW1 A;  5KO4 A;  5AD2 A;  4QUU A;  3UVX A;  4QSR A;  5CS8 A;  5E3G A;  4BW4 A;  2F6J A;  4PKL A;  4QR4 A;  4QR5 A;  4QC3 A;  5LKX A;  5L97 A;  5I1Q A;  3U5K A;  4KV4 A;  2FSA A;  4Q0O A;  3U5J A;  5DFB A;  5FE5 A;  5IID A;  4UIT A;  3K2J A;  5A85 A;  5EWH A;  3UV4 A;  1EQF A;  4UIY A;  4QYL A;  5A5P A;  5C85 A;  5ACY A;  1JSP B;  4N4F A;  5L98 A;  4NUD A;  5DKD A;  4YYH A;  4TT2 A;  5EWV A;  4X2I A;  5FBX A;  4PTB A;  5D7X A;  5HRX A;  5HLS A;  4WIV A;  5E9I A;  4A9H A;  5LKU A;  5LJ1 A;  5IGK A;  4MEO A;  5FB1 A;  5BT3 A;  5DFC A;  4QSS A;  5EIC A;  4Q0N A;  4QEW A;  5L99 A;  5F63 A;  5D24 A;  5C7N A;  4XY8 A;  3U5P A;  5CRZ A;  3P1E A;  5HFQ A;  1JM4 B;  3G0J A;  2KTB B;  4YBS A;  4NR4 A;  4UYF A;  5DX4 A;  4F3I A;  5JI8 A;  4UIZ A;  4J0S A;  4A9J A;  3ONI A;  2F6N A;  4BW2 A;  5FE4 A;  5FE9 A;  4MEQ A;  4NQM A;  3U5O A;  5FFY A;  3QZV A;  4N4H A;  4LR6 A;  2DVQ A;  3D1B A;  4NR9 A;  5F1H A;  4Z6H A;  5FH7 A; 
#chains in the Genus database with same CATH homology
 3LQJ A;  5FE3 A;  5HEL A;  2RFJ A;  5FB0 A;  5CQ8 A;  5IGM A;  3IU5 A;  5FG5 A;  3O37 A;  5EV9 A;  3P1F A;  5LJ2 A;  5EPS A;  4AKN A;  2YEL A;  4QYD A;  2R0S A;  5D3R A;  5DYC A;  5CFW A;  4YH3 A;  5DFD A;  4TT4 A;  4LYS A;  3HMF A;  4HBX A;  4Z6I A;  5H1U A;  4NRB A;  2OSS A;  4TS8 A;  4TZ2 A;  4CUS A;  5A5S A;  4O77 A;  5F36 A;  4QUT A;  4O72 A;  5ETB A;  5KTW A;  4YY4 A;  2G4A A;  4QSQ A;  4QC1 A;  3UV2 A;  5DLZ A;  4HXN A;  4Z1S A;  5EPB A;  5F61 A;  3UVD A;  4C67 A;  2RS9 B;  4O70 A;  3HME A;  4NQN A;  4PCE A;  2R0Y A;  4O76 A;  5CGP A;  3P1D A;  4YY6 A;  4BW3 A;  2RO1 A;  5ENB A;  4YYN A;  4YBT A;  4UIX A;  4ALG A;  3GG3 A;  5C4Q A;  4UIV A;  4J3I A;  3FKM X;  5FE0 A;  4NR5 A;  4O7F A;  5HQ5 A;  2YEK A;  2YYN A;  5E9V A;  5G4R A;  3SVH A;  5EGU A;  5EQ1 A;  4YYJ A;  4NRA A;  4ZQL A;  4QSP A;  5FE8 A;  3QZS A;  2N9G A;  2L84 A;  4HXK A;  5CQ3 A;  4HXP A;  5IGL A;  5D3H A;  5KTX A;  5CUG A;  3JVK A;  4TT6 A;  4WHU A;  5CQ7 A;  5LUU A;  5I29 A;  4HXO A;  5CQ5 A;  5EVA A;  3S92 A;  3JVL A;  5EA1 A;  5IG6 A;  5LKZ A;  4YBM A;  4NUC A;  4A9L A;  5AMF A;  4FLP A;  4BJX A;  2OUO A;  5FE6 A;  2DVR A;  5EU1 A;  4WHW A;  2NXB A;  3Q2E A;  5A81 A;  5ENF A;  5A83 A;  1X0J A;  5FH8 A;  2YQD A;  2DVV A;  3O35 A;  5DYA A;  5CUB A;  4Z1Q A;  4A9N A;  3AQA A;  5CTL A;  3MUK A;  4LZS A;  4NYV A;  5I40 A;  4NUE A;  5H1T A;  5F2P A;  4MR4 A;  4NYX A;  5D3S A;  4O7C A;  4QB3 A;  2WP1 A;  4MR5 A;  5E73 A;  4GPJ A;  5L8T A;  4YYG A;  5DKH A;  3AAD A;  3UV5 A;  5FH6 A;  4TQN A;  5ENJ A;  5ENG A;  4NXJ A;  4CL9 A;  2I7K A;  4QSX A;  5E9Y A;  5ENH A;  4QZS A;  5BT5 A;  5C87 A;  5FFV A;  4YYD A;  4QEU A;  3P5O A;  5C89 A;  4YAB A;  4OGI A;  4QEV A;  2DVS A;  3DWY A;  2I8N A;  4NR6 A;  5IGN A;  3QZT A;  4XUB A;  5D3L A;  5E9L A;  5F25 A;  3U5M A;  4TU4 A;  5I7Y A;  3UW9 A;  5KTU A;  4YH4 A;  4IOR A;  5ENE A;  5G4S A;  5I86 A;  5CQ4 A;  5LVQ A;  5CUC A;  5D3N A;  3TLP A;  3S91 A;  5LVR A;  4IOO A;  5HQ6 A;  4A9F A;  4UIW A;  5IBN A;  2D82 A;  4TYL A;  5TCM A;  3JVJ A;  5DLX A;  3SVG A;  4UYD A;  3SVF A;  4BHW A;  4CUT A;  3P1C A;  4UYH A;  3UVY A;  4YC9 A;  5LKT A;  4ZC9 A;  1E6I A;  4N4G A;  5C8G A;  5EK9 A;  4IR4 A;  4C66 A;  5TB6 A;  5DYU A;  4CFK A;  3ZYU A;  2RNW A;  5D3P A;  5HEN A;  2D9E A;  5CP5 A;  5F62 A;  4UYF B;  4Z93 A;  4QBM A;  4PCI A;  4QY4 A;  5CQA A;  5E9M A;  2RNY A;  5J0D A;  3I3J A;  5HRW A;  5HFR A;  4NR7 A;  1ZS5 A;  4O7A A;  3LJW A;  4MEN A;  4J0R A;  4YYK A;  5I80 A;  5HM0 A;  2MJV B;  4A9K A;  4QNS A;  2LSP B;  3MUL A;  4HBV A;  3U5N A;  5K29 A;  5L8U A;  4N4I A;  4OUF A;  5CRM A;  4IR5 A;  5AME A;  4IOQ A;  4LRG A;  4QST A;  4NYW A;  4CUR A;  2L5E A;  4E96 A;  4LDF A;  5CQ6 A;  5EI4 A;  4HXM A;  5EM3 A;  4HXL A;  4BW1 A;  5KU3 A;  4QSW A;  5CUA A;  4NR8 A;  4OGJ A;  5I88 A;  2R10 A;  5CU8 A;  2DAT A;  4HXR A;  4NRC A;  5EIS A;  3O36 A;  5DW1 A;  2YW5 A;  4UYG A;  5A7C A;  5A82 A;  5HEM A;  4ALH A;  1N72 A;  2E7O A;  3RCW A;  5CY9 A;  3LQI A;  4CFL A;  5F1L A;  5E7D A;  4IR3 A;  4LYI A;  5E74 A;  5F60 A;  5D3J A;  4A9I A;  5E9K A;  5HQ7 A;  2RI7 A;  2E3K A;  3NXB A;  4HBY A;  4KV1 A;  5FG4 A;  5A5R A;  2RNX A;  4RVR A;  5DW2 A;  2R0V A;  4CLB A;  4XUA A;  4Y03 A;  3MB4 A;  4J1P A;  5ETD A;  4A9E A;  3MXF A;  4TZ8 A;  4CUP A;  4UYE A;  2YEM A;  3MQM A;  3LXJ A;  5E0R A;  3JVM A;  5KHM A;  5COI A;  1WUM A;  4O74 A;  5L96 A;  4A9M A;  5EP7 A;  5A5Q A;  5BT4 A;  4YK0 A;  5JWM A;  5HCL A;  5DBM A;  3DAI A;  4YYI A;  2H60 A;  4YAX A;  4XYA A;  3D7C A;  5DKC A;  5H85 A;  2GRC A;  4PS5 A;  5CPE A;  5FG6 A;  5H1V A;  3LQH A;  5F3A A;  5I89 A;  2OO1 A;  4LYW A;  4MEP A;  5DY7 A;  4HBW A;  4QSU A;  4KCX A;  5D3T A;  4LC2 A;  4LZR A;  5D25 A;  5A5O A;  2DWW A;  4YYM A;  4LZ2 A;  4O78 A;  5EWC A;  2YDW A;  4XY9 A;  4YAT A;  5FE7 A;  3IU6 A;  5FDZ A;  4TTE A;  5CZG A;  5ENC A;  2DKW A;  5CUD A;  5CUE A;  5EPR A;  5FE1 A;  4N3W A;  5I7X A;  5CQT A;  4YAD A;  3O34 A;  5II2 A;  4TU6 A;  2L85 A;  4NS5 A;  4DON A;  4CUQ A;  5LJ0 A;  5DYX A;  4O7E A;  5HRV A;  5II1 A;  3UVW A;  5ENI A;  1WUG A;  1F68 A;  5I83 A;  3HMH A;  4O71 A;  4A9O A;  2E7N A;  4PY6 A;  4IR6 A;  5HJC A;  5F5Z A;  2WP2 A;  3Q2F A;  4QSV A;  4O75 A;  3MB3 A;  3U5L A;  4MR3 A;  4QR3 A;  3O33 A;  4MR6 A;  5EWD A;  5FE2 A;  5D26 A;  5E3D A;  5AD3 A;  3G0L A;  5FFW A;  5EWW A;  4HXS A;  5D0C A;  5A5N A;  4CUU A;  4UIU A;  4O7B A;  4ZW1 A;  5KO4 A;  5AD2 A;  4QUU A;  3UVX A;  4QSR A;  5CS8 A;  5E3G A;  4BW4 A;  2F6J A;  4PKL A;  4QR4 A;  4QR5 A;  4QC3 A;  5LKX A;  5L97 A;  5I1Q A;  3U5K A;  4KV4 A;  2FSA A;  4Q0O A;  3U5J A;  5DFB A;  5FE5 A;  5IID A;  4UIT A;  3K2J A;  5A85 A;  5EWH A;  3UV4 A;  1EQF A;  4UIY A;  4QYL A;  5A5P A;  5C85 A;  5ACY A;  1JSP B;  4N4F A;  5L98 A;  4NUD A;  5DKD A;  4YYH A;  4TT2 A;  5EWV A;  4X2I A;  5FBX A;  4PTB A;  5D7X A;  5HRX A;  5HLS A;  4WIV A;  5E9I A;  4A9H A;  5LKU A;  5LJ1 A;  5IGK A;  4MEO A;  5FB1 A;  5BT3 A;  5DFC A;  4QSS A;  5EIC A;  4Q0N A;  4QEW A;  5L99 A;  5F63 A;  5D24 A;  5C7N A;  4XY8 A;  3U5P A;  5CRZ A;  3P1E A;  5HFQ A;  1JM4 B;  3G0J A;  2KTB B;  4YBS A;  4NR4 A;  4UYF A;  5DX4 A;  4F3I A;  5JI8 A;  4UIZ A;  4J0S A;  4A9J A;  3ONI A;  2F6N A;  4BW2 A;  5FE4 A;  5FE9 A;  4MEQ A;  4NQM A;  3U5O A;  5FFY A;  3QZV A;  4N4H A;  4LR6 A;  2DVQ A;  4NR9 A;  5F1H A;  4Z6H A;  5FH7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...