2OUOA

Crystal structure of the bromo domain 2 in human bromodomain containing protein 4 (brd4)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
111
structure length
111
Chain Sequence
KVSEQLKCCSGILKEMFAKKHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Bromodomain-containing protein 4
publication title Histone recognition and large-scale structural analysis of the human bromodomain family.
pubmed doi rcsb
source organism Homo sapiens
total genus 38
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2007-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2ouoA00
4NR5A 5KHMA 4IOOA 4RVRA 5CUGA 4QSQA 2YYNA 4LZSA 4HXLA 5I1QA 2RNYA 4XYAA 4MEPA 2R0VA 4WHUA 2DATA 2G4AA 4UIYA 5II1A 3O36A 5EWHA 2KTBB 1E6IA 4ZQLA 4CUQA 3SVFA 3S92A 5IG6A 4UYFA 4Z1QA 5CRZA 4O7EA 4MEQA 4QYLA 3U5PA 1JSPB 5CGPA 5AD3A 2I8NA 5D25A 5EQ1A 5A81A 3ZYUA 4A9KA 5ENCA 5FG5A 5E9IA 3IU6A 4KV1A 5E73A 5EU1A 2RNXA 5D3JA 5ENGA 5KTWA 1EQFA 5CQ8A 4QR3A 5CPEA 4YYIA 4HBXA 4XUBA 5ENBA 5DBMA 3MQMA 4QYDA 4TT2A 5LJ0A 3TLPA 3IU5A 4OGIA 4QZSA 4MR6A 5AD2A 3UV4A 5KTXA 4NRBA 3LQHA 3MXFA 4QSUA 5FE9A 5FFVA 5A5PA 4PTBA 5TB6A 5BT3A 5CQTA 4CLBA 2DKWA 3UVXA 5HFRA 5FH8A 5F60A 5L96A 5J0DA 5FH6A 5EI4A 1WUMA 3JVLA 4MR4A 5F2PA 4YYNA 3JVMA 3NXBA 4BHWA 5FG4A 4YYDA 5D3HA 5DKHA 4QSPA 3QZSA 5H1VA 4XY8A 3S91A 3O34A 5A7CA 5D0CA 5HRWA 4J0RA 5E74A 5LKTA 5I7YA 4IOQA 4LYIA 4O7AA 5I40A 1JM4B 3O35A 5FG6A 5CUAA 2YEKA 5HLSA 5H1UA 5DYXA 2DWWA 4A9FA 4TQNA 4YY6A 2N9GA 4UYEA 2YDWA 5H85A 3DWYA 3LJWA 4NXJA 5LJ2A 5A82A 5ENEA 2E7OA 3U5OA 3DAIA 4UYDA 4CUSA 4FLPA 5C85A 3JVKA 3HMFA 5AMFA 3P5OA 4LC2A 5DFDA 4UITA 4N4IA 3SVHA 3HMEA 4NYWA 4YBTA 3HMHA 5II2A 4QSWA 3JVJA 5FFYA 4UYHA 5H1TA 4CURA 3U5LA 2OSSA 5IGKA 3MB3A 5KTUA 4XUAA 5FB1A 3O37A 4WIVA 3U5MA 5F62A 5E7DA 4N4GA 4ALGA 1ZS5A 5F3AA 2DVVA 5DLZA 5KU3A 4HXKA 4F3IA 4YYJA 5G4RA 4A9NA 5FE7A 5CQ5A 3P1CA 5FBXA 5HENA 5I83A 5LVQA 4NRAA 4HXPA 4YYGA 4A9MA 3SVGA 5I88A 4O7CA 4MR3A 5D3TA 4A9LA 5LJ1A 4HXMA 5EVAA 5EV9A 3UV5A 4NUCA 4XY9A 4A9IA 4O7BA 5IIDA 4HXNA 4MR5A 5C7NA 5LUUA 3U5NA 4TU4A 2OUOA 4PS5A 5F63A 5F25A 5JI8A 2I7KA 4UIZA 5A5NA 5FE5A 4IR6A 3RCWA 5CTLA 4BW2A 5K29A 5F1HA 4O74A 2RFJA 4CFKA 4NR9A 1WUGA 5D3PA 4CUPA 2RO1A 5L97A 4LR6A 4NUDA 2H60A 4O70A 4YY4A 4NYVA 3O33A 5D7XA 3LXJA 3U5KA 2DVQA 4HBYA 4AKNA 5HQ6A 4O75A 2RS9B 5IBNA 4Z6HA 4J0SA 5EISA 2MJVB 5L8TA 4UIUA 5JWMA 2GRCA 5CUDA 5CRMA 4QNSA 5LKZA 5F5ZA 4UIWA 5A83A 5CU8A 5HM0A 2WP1A 4IR4A 4QY4A 4QEWA 5ACYA 4TZ8A 4QSSA 5ENJA 5DYUA 4A9OA 5FE0A 3LQIA 3G0LA 4Y03A 5KO4A 4UIXA 5HRVA 3UVYA 4LYSA 5ENFA 5CQ7A 4N3WA 3MULA 4LDFA 4X2IA 4NR6A 5CQ6A 5I89A 5ETBA 5EWCA 5IGMA 2OO1A 4TYLA 3QZVA 5D3NA 5A5SA 3ONIA 4YYKA 5EWWA 4QC3A 5EWVA 5FE1A 4YBSA 2YELA 5A5RA 1X0JA 5E3GA 2L85A 4YATA 2WP2A 4NR4A 3FKMX 5CY9A 5CUEA 3UVDA 4ALHA 4CUTA 4IR5A 5CS8A 5L99A 5DW1A 4OUFA 4TTEA 4QR5A 5DFBA 2D82A 4QUTA 5CUCA 4O72A 5CZGA 5E9LA 4TZ2A 5TCMA 2LSPB 5E9MA 4Q0OA 2E7NA 3P1FA 4NS5A 4TS8A 5C89A 4LYWA 2YW5A 4NQMA 4E96A 4YK0A 4MENA 5D3LA 4YC9A 5HELA 3U5JA 5CQAA 2DVSA 4HXSA 5HCLA 4PCEA 5A5QA 4TT4A 5A85A 4TU6A 5HRXA 2D9EA 4QSVA 5C8GA 4O7FA 4Q0NA 2RI7A 4PKLA 2L5EA 5DKCA 2L84A 5DX4A 3P1DA 5I29A 5HFQA 1F68A 4HBWA 4YADA 2F6NA 5FH7A 5FE3A 5I86A 2R0YA 3MB4A 2YQDA 2RNWA 5HJCA 3UVWA 4NR8A 4QSXA 5LVRA 4QB3A 4NQNA 5EGUA 4HBVA 5EPRA 4PY6A 4QR4A 3MUKA 4QSRA 4BW4A 4UYFB 3LQJA 5FE4A 5DYAA 5D3RA 5E9VA 4O71A 5ENIA 4C66A 4QBMA 5DYCA 4HXOA 3UV2A 5EPSA 3QZTA 4NRCA 1N72A 4NUEA 5DW2A 5FE2A 4UIVA 4A9EA 4CFLA 5CFWA 5IGNA 4DONA 5EP7A 4LZ2A 4O78A 5L98A 5D3SA 4LRGA 4ZC9A 5E0RA 4A9JA 4O77A 5EPBA 5I80A 4CL9A 5EWDA 4OGJA 5EM3A 4BJXA 5FFWA 3P1EA 5FE6A 4PCIA 5F1LA 3UW9A 4BW1A 3D7CA 4N4FA 5EA1A 3G0JA 5DFCA 5E3DA 5HQ7A 4YAXA 4N4HA 5EK9A 5HQ5A 5I7XA 5BT4A 4C67A 3K2JA 4WHWA 5IGLA 4LZRA 4QUUA 4HXRA 4IR3A 4Z6IA 5CQ4A 3GG3A 2R10A 5DLXA 5FB0A 4IORA 5L8UA 2DVRA 4J1PA 2R0SA 3I3JA 2F6JA 5DKDA 4NYXA 2E3KA 4KCXA 4YABA 5D26A 4QEUA 4Z93A 5ENHA 5HEMA 5EICA 5CP5A 4CUUA 5LKXA 5DY7A 5CUBA 3Q2EA 5COIA 4UYGA 5CQ3A 5BT5A 5D24A 4QEVA 5E9YA 4TT6A 5FE8A 4ZW1A 4NR7A 4YYHA 5AMEA 4GPJA 4QSTA 4MEOA 5C87A 4BW3A 4A9HA 4KV4A 4YYMA 3Q2FA 4YH4A 4QC1A 2FSAA 5F36A 2YEMA 3AADA 5ETDA 5G4SA 4Z1SA 5C4QA 4YH3A 5E9KA 2NXBA 4J3IA 4O76A 4YBMA 5FDZA 3AQAA 5F61A 5LKUA 5A5OA
chains in the Genus database with same CATH superfamily
4NR5A 5KHMA 4IOOA 4RVRA 5CUGA 4QSQA 2YYNA 4LZSA 4HXLA 5I1QA 2RNYA 4XYAA 4MEPA 2R0VA 4WHUA 2DATA 2G4AA 4UIYA 5II1A 3O36A 5EWHA 2KTBB 1E6IA 4ZQLA 4CUQA 3SVFA 3S92A 5IG6A 4UYFA 4Z1QA 5CRZA 4O7EA 4MEQA 4QYLA 3U5PA 1JSPB 5CGPA 5AD3A 2I8NA 5D25A 5EQ1A 5A81A 3ZYUA 4A9KA 5ENCA 5FG5A 5E9IA 3IU6A 4KV1A 5E73A 5EU1A 2RNXA 5D3JA 5ENGA 5KTWA 1EQFA 5CQ8A 4QR3A 5CPEA 4YYIA 4HBXA 4XUBA 5ENBA 5DBMA 3MQMA 4QYDA 4TT2A 5LJ0A 3TLPA 3IU5A 4OGIA 4QZSA 4MR6A 5AD2A 3UV4A 5KTXA 4NRBA 3LQHA 3MXFA 4QSUA 5FE9A 5FFVA 5A5PA 4PTBA 5TB6A 5BT3A 5CQTA 4CLBA 2DKWA 3UVXA 5HFRA 5FH8A 5F60A 5L96A 5J0DA 5FH6A 5EI4A 1WUMA 3JVLA 4MR4A 5F2PA 4YYNA 3JVMA 3NXBA 4BHWA 5FG4A 4YYDA 5D3HA 5DKHA 4QSPA 3QZSA 5H1VA 4XY8A 3S91A 3O34A 5A7CA 5D0CA 5HRWA 4J0RA 5E74A 5LKTA 5I7YA 4IOQA 4LYIA 4O7AA 5I40A 1JM4B 3O35A 5FG6A 5CUAA 2YEKA 5HLSA 5H1UA 5DYXA 2DWWA 4A9FA 4TQNA 4YY6A 2N9GA 4UYEA 2YDWA 5H85A 3DWYA 3LJWA 4NXJA 5LJ2A 5A82A 5ENEA 2E7OA 3U5OA 3DAIA 4UYDA 4CUSA 4FLPA 5C85A 3JVKA 3HMFA 5AMFA 3P5OA 4LC2A 5DFDA 4UITA 4N4IA 3SVHA 3HMEA 4NYWA 4YBTA 3HMHA 5II2A 4QSWA 3JVJA 5FFYA 4UYHA 5H1TA 4CURA 3U5LA 2OSSA 5IGKA 3MB3A 5KTUA 4XUAA 5FB1A 3O37A 4WIVA 3U5MA 5F62A 5E7DA 4N4GA 4ALGA 1ZS5A 5F3AA 2DVVA 5DLZA 5KU3A 4HXKA 4F3IA 4YYJA 5G4RA 4A9NA 5FE7A 5CQ5A 3P1CA 5FBXA 5HENA 5I83A 5LVQA 4NRAA 4HXPA 4YYGA 4A9MA 3SVGA 5I88A 4O7CA 4AKIA 4MR3A 5D3TA 4A9LA 5LJ1A 4HXMA 5EVAA 5EV9A 3UV5A 4NUCA 4XY9A 4A9IA 4O7BA 5IIDA 4HXNA 4MR5A 5C7NA 5LUUA 3U5NA 4TU4A 2OUOA 4PS5A 5F63A 5F25A 5JI8A 2I7KA 4UIZA 5A5NA 5FE5A 4IR6A 3RCWA 5CTLA 4BW2A 5K29A 5F1HA 4O74A 2RFJA 4CFKA 4NR9A 1WUGA 5D3PA 4CUPA 2RO1A 5L97A 3ERRA 4LR6A 4NUDA 2H60A 4O70A 4YY4A 4NYVA 3O33A 5D7XA 3LXJA 3U5KA 2DVQA 4HBYA 4AKNA 5HQ6A 4O75A 2RS9B 5IBNA 4Z6HA 4J0SA 5EISA 2MJVB 5L8TA 4UIUA 5JWMA 2GRCA 5CUDA 5CRMA 4QNSA 5LKZA 5F5ZA 4UIWA 5A83A 5CU8A 5HM0A 2WP1A 4IR4A 4QY4A 4QEWA 5ACYA 4TZ8A 4QSSA 5ENJA 5DYUA 4A9OA 5FE0A 3VKHA 3LQIA 3G0LA 4Y03A 5KO4A 3VKGA 4UIXA 5HRVA 3UVYA 4LYSA 5ENFA 5CQ7A 4N3WA 3MULA 4LDFA 4X2IA 3AQAA 4NR6A 5CQ6A 5I89A 5ETBA 5EWCA 5IGMA 2OO1A 4TYLA 3QZVA 5D3NA 5A5SA 3ONIA 4YYKA 5EWWA 4QC3A 5EWVA 5FE1A 4YBSA 2YELA 5A5RA 1X0JA 5E3GA 2L85A 4YATA 2WP2A 4NR4A 3FKMX 5CY9A 5CUEA 3UVDA 4ALHA 4CUTA 4IR5A 5CS8A 5L99A 5DW1A 4OUFA 4TTEA 4QR5A 5DFBA 2D82A 4QUTA 5CUCA 4O72A 5CZGA 5E9LA 4TZ2A 5TCMA 2LSPB 5E9MA 4Q0OA 2E7NA 3P1FA 4NS5A 4TS8A 5C89A 4LYWA 2YW5A 4NQMA 4E96A 4YK0A 4MENA 5D3LA 4YC9A 5HELA 3U5JA 5CQAA 2DVSA 2EJNA 4HXSA 5HCLA 4PCEA 5A5QA 4TT4A 5A85A 4TU6A 5HRXA 2D9EA 4QSVA 5C8GA 4O7FA 4Q0NA 2RI7A 4PKLA 2L5EA 5DKCA 2L84A 5DX4A 3P1DA 5I29A 5HFQA 1F68A 4HBWA 4YADA 2F6NA 5FH7A 5FE3A 5I86A 2R0YA 3MB4A 2YQDA 2RNWA 5HJCA 3UVWA 4AI6A 4NR8A 4QSXA 5LVRA 4QB3A 4NQNA 5EGUA 4HBVA 5EPRA 4PY6A 4QR4A 3MUKA 4QSRA 4BW4A 4UYFB 3LQJA 5FE4A 5DYAA 5D3RA 5E9VA 4O71A 5ENIA 4C66A 4QBMA 4AKGA 5DYCA 4HXOA 3UV2A 5EPSA 3QZTA 4NRCA 1N72A 4NUEA 5DW2A 5FE2A 4UIVA 4A9EA 4CFLA 5CFWA 5IGNA 4DONA 5EP7A 4LZ2A 4O78A 5L98A 5D3SA 4LRGA 4ZC9A 5E0RA 4A9JA 4O77A 5EPBA 5I80A 4CL9A 5EWDA 4OGJA 5EM3A 3D1BA 5FFWA 4BJXA 3P1EA 5FE6A 4PCIA 5F1LA 3UW9A 4BW1A 3D7CA 4N4FA 5EA1A 3G0JA 5DFCA 5E3DA 5HQ7A 4YAXA 4N4HA 5EK9A 5HQ5A 4AKHA 5I7XA 5BT4A 4C67A 3K2JA 4WHWA 5IGLA 4LZRA 4QUUA 4HXRA 4IR3A 4Z6IA 5CQ4A 3GG3A 2R10A 5DLXA 5FB0A 4IORA 5L8UA 2DVRA 4J1PA 2R0SA 3I3JA 2F6JA 5DKDA 4NYXA 2E3KA 4KCXA 3D1DA 4YABA 5D26A 4QEUA 4Z93A 5ENHA 5HEMA 5EICA 5CP5A 4CUUA 5LKXA 5DY7A 5CUBA 3Q2EA 5COIA 4UYGA 5CQ3A 5BT5A 1PUOA 5D24A 4QEVA 5E9YA 4TT6A 5FE8A 4ZW1A 4NR7A 4YYHA 5AMEA 4GPJA 4QSTA 4MEOA 5C87A 4BW3A 4A9HA 4KV4A 4YYMA 3Q2FA 4YH4A 4QC1A 2FSAA 5F36A 2YEMA 3AADA 5ETDA 5G4SA 4Z1SA 5C4QA 4YH3A 5E9KA 2NXBA 4J3IA 4O76A 4YBMA 5FDZA 1ZKRA 5F61A 5LKUA 5A5OA
chains in the Genus database with same CATH topology
4NR5A 5KHMA 4IOOA 4RVRA 5CUGA 4QSQA 2YYNA 4LZSA 4HXLA 5I1QA 2RNYA 4XYAA 4MEPA 2R0VA 4WHUA 2DATA 2G4AA 4UIYA 5II1A 3O36A 5EWHA 2KTBB 1E6IA 4ZQLA 4CUQA 3SVFA 3S92A 5IG6A 4UYFA 4Z1QA 5CRZA 4O7EA 4MEQA 4QYLA 3U5PA 1JSPB 5CGPA 5AD3A 2I8NA 5D25A 5EQ1A 5A81A 3ZYUA 4A9KA 5ENCA 5FG5A 5E9IA 3IU6A 4KV1A 5E73A 5EU1A 2RNXA 5D3JA 5ENGA 5KTWA 1EQFA 5CQ8A 4QR3A 5CPEA 4YYIA 4HBXA 4XUBA 5ENBA 5DBMA 3MQMA 4QYDA 4TT2A 5LJ0A 3TLPA 3IU5A 4OGIA 4QZSA 4MR6A 5AD2A 3UV4A 5KTXA 4NRBA 3LQHA 3MXFA 4QSUA 5FE9A 5FFVA 5A5PA 4PTBA 5TB6A 5BT3A 5CQTA 4CLBA 2DKWA 3UVXA 5HFRA 5FH8A 5F60A 5L96A 5J0DA 5FH6A 5EI4A 1WUMA 3JVLA 4MR4A 5F2PA 4YYNA 3JVMA 3NXBA 4BHWA 5FG4A 4YYDA 5D3HA 5DKHA 4QSPA 3QZSA 5H1VA 4XY8A 3S91A 3O34A 5A7CA 5D0CA 5HRWA 4J0RA 5E74A 5LKTA 5I7YA 4IOQA 4LYIA 4O7AA 5I40A 1JM4B 3O35A 5FG6A 5CUAA 2YEKA 5HLSA 5H1UA 5DYXA 2DWWA 4A9FA 4TQNA 4YY6A 2N9GA 4UYEA 2YDWA 5H85A 3DWYA 3LJWA 4NXJA 5LJ2A 5A82A 5ENEA 2E7OA 3U5OA 3DAIA 4UYDA 4CUSA 4FLPA 5C85A 3JVKA 3HMFA 5AMFA 3P5OA 4LC2A 5DFDA 4UITA 4N4IA 3SVHA 3HMEA 4NYWA 4YBTA 3HMHA 5II2A 4QSWA 3JVJA 5FFYA 4UYHA 5H1TA 4CURA 3U5LA 2OSSA 5IGKA 3MB3A 5KTUA 4XUAA 5FB1A 3O37A 4WIVA 3U5MA 5F62A 5E7DA 4N4GA 4ALGA 1ZS5A 5F3AA 2DVVA 5DLZA 5KU3A 4HXKA 4F3IA 4YYJA 5G4RA 4A9NA 5FE7A 5CQ5A 3P1CA 5FBXA 5HENA 5I83A 5LVQA 4NRAA 4HXPA 4YYGA 4A9MA 3SVGA 5I88A 4O7CA 4MR3A 5D3TA 4A9LA 5LJ1A 4HXMA 5EVAA 5EV9A 3UV5A 4NUCA 4XY9A 4A9IA 4O7BA 5IIDA 4HXNA 4MR5A 5C7NA 5LUUA 3U5NA 4TU4A 2OUOA 4PS5A 5F63A 5F25A 5JI8A 2I7KA 4UIZA 5A5NA 5FE5A 4IR6A 3RCWA 5CTLA 4BW2A 5K29A 5F1HA 4O74A 2RFJA 4CFKA 4NR9A 1WUGA 5D3PA 4CUPA 2RO1A 5L97A 4LR6A 4NUDA 2H60A 4O70A 4YY4A 4NYVA 3O33A 5D7XA 3LXJA 3U5KA 2DVQA 4HBYA 4AKNA 5HQ6A 4O75A 2RS9B 5IBNA 4Z6HA 4J0SA 5EISA 2MJVB 5L8TA 4UIUA 5JWMA 2GRCA 5CUDA 5CRMA 4QNSA 5LKZA 5F5ZA 4UIWA 5A83A 5CU8A 5HM0A 2WP1A 4IR4A 4QY4A 4QEWA 5ACYA 4TZ8A 4QSSA 5ENJA 5DYUA 4A9OA 5FE0A 3LQIA 3G0LA 4Y03A 5KO4A 4UIXA 5HRVA 3UVYA 4LYSA 5ENFA 5CQ7A 4N3WA 3MULA 4LDFA 4X2IA 4NR6A 5CQ6A 5I89A 5ETBA 5EWCA 5IGMA 2OO1A 4TYLA 3QZVA 5D3NA 5A5SA 3ONIA 4YYKA 5EWWA 4QC3A 5EWVA 5FE1A 4YBSA 2YELA 5A5RA 1X0JA 5E3GA 2L85A 4YATA 2WP2A 4NR4A 3FKMX 5CY9A 5CUEA 3UVDA 4ALHA 4CUTA 4IR5A 5CS8A 5L99A 5DW1A 4OUFA 4TTEA 4QR5A 5DFBA 2D82A 4QUTA 5CUCA 4O72A 5CZGA 5E9LA 4TZ2A 5TCMA 2LSPB 5E9MA 4Q0OA 2E7NA 3P1FA 4NS5A 4TS8A 5C89A 4LYWA 2YW5A 4NQMA 4E96A 4YK0A 4MENA 5D3LA 4YC9A 5HELA 3U5JA 5CQAA 2DVSA 4HXSA 5HCLA 4PCEA 5A5QA 4TT4A 5A85A 4TU6A 5HRXA 2D9EA 4QSVA 5C8GA 4O7FA 4Q0NA 2RI7A 4PKLA 2L5EA 5DKCA 2L84A 5DX4A 3P1DA 5I29A 5HFQA 1F68A 4HBWA 4YADA 2F6NA 5FH7A 5FE3A 5I86A 2R0YA 3MB4A 2YQDA 2RNWA 5HJCA 3UVWA 4NR8A 4QSXA 5LVRA 4QB3A 4NQNA 5EGUA 4HBVA 5EPRA 4PY6A 4QR4A 3MUKA 4QSRA 4BW4A 4UYFB 3LQJA 5FE4A 5DYAA 5D3RA 5E9VA 4O71A 5ENIA 4C66A 4QBMA 5DYCA 4HXOA 3UV2A 5EPSA 3QZTA 4NRCA 1N72A 4NUEA 5DW2A 5FE2A 4UIVA 4A9EA 4CFLA 5CFWA 5IGNA 4DONA 5EP7A 4LZ2A 4O78A 5L98A 5D3SA 4LRGA 4ZC9A 5E0RA 4A9JA 4O77A 5EPBA 5I80A 4CL9A 5EWDA 4OGJA 5EM3A 4BJXA 5FFWA 3P1EA 5FE6A 4PCIA 5F1LA 3UW9A 4BW1A 3D7CA 4N4FA 5EA1A 3G0JA 5DFCA 5E3DA 5HQ7A 4YAXA 4N4HA 5EK9A 5HQ5A 5I7XA 5BT4A 4C67A 3K2JA 4WHWA 5IGLA 4LZRA 4QUUA 4HXRA 4IR3A 4Z6IA 5CQ4A 3GG3A 2R10A 5DLXA 5FB0A 4IORA 5L8UA 2DVRA 4J1PA 2R0SA 3I3JA 2F6JA 5DKDA 4NYXA 2E3KA 4KCXA 4YABA 5D26A 4QEUA 4Z93A 5ENHA 5HEMA 5EICA 5CP5A 4CUUA 5LKXA 5DY7A 5CUBA 3Q2EA 5COIA 4UYGA 5CQ3A 5BT5A 5D24A 4QEVA 5E9YA 4TT6A 5FE8A 4ZW1A 4NR7A 4YYHA 5AMEA 4GPJA 4QSTA 4MEOA 5C87A 4BW3A 4A9HA 4KV4A 4YYMA 3Q2FA 4YH4A 4QC1A 2FSAA 5F36A 2YEMA 3AADA 5ETDA 5G4SA 4Z1SA 5C4QA 4YH3A 5E9KA 2NXBA 4J3IA 4O76A 4YBMA 5FDZA 3AQAA 5F61A 5LKUA 5A5OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NR5 A;  5KHM A;  4IOO A;  4RVR A;  5CUG A;  4QSQ A;  2YYN A;  4LZS A;  4HXL A;  5I1Q A;  2RNY A;  4XYA A;  4MEP A;  2R0V A;  4WHU A;  2DAT A;  2G4A A;  4UIY A;  5II1 A;  3O36 A;  5EWH A;  2KTB B;  1E6I A;  4ZQL A;  4CUQ A;  3SVF A;  3S92 A;  5IG6 A;  4UYF A;  4Z1Q A;  5CRZ A;  4O7E A;  4MEQ A;  4QYL A;  3U5P A;  1JSP B;  5CGP A;  5AD3 A;  2I8N A;  5D25 A;  5EQ1 A;  5A81 A;  3ZYU A;  4A9K A;  5ENC A;  5FG5 A;  5E9I A;  3IU6 A;  4KV1 A;  5E73 A;  5EU1 A;  2RNX A;  5D3J A;  5ENG A;  5KTW A;  1EQF A;  5CQ8 A;  4QR3 A;  5CPE A;  4YYI A;  4HBX A;  4XUB A;  5ENB A;  5DBM A;  3MQM A;  4QYD A;  4TT2 A;  5LJ0 A;  3TLP A;  3IU5 A;  4OGI A;  4QZS A;  4MR6 A;  5AD2 A;  3UV4 A;  5KTX A;  4NRB A;  3LQH A;  3MXF A;  4QSU A;  5FE9 A;  5FFV A;  5A5P A;  4PTB A;  5TB6 A;  5BT3 A;  5CQT A;  4CLB A;  2DKW A;  3UVX A;  5HFR A;  5FH8 A;  5F60 A;  5L96 A;  5J0D A;  5FH6 A;  5EI4 A;  1WUM A;  3JVL A;  4MR4 A;  5F2P A;  4YYN A;  3JVM A;  3NXB A;  4BHW A;  5FG4 A;  4YYD A;  5D3H A;  5DKH A;  4QSP A;  3QZS A;  5H1V A;  4XY8 A;  3S91 A;  3O34 A;  5A7C A;  5D0C A;  5HRW A;  4J0R A;  5E74 A;  5LKT A;  5I7Y A;  4IOQ A;  4LYI A;  4O7A A;  5I40 A;  1JM4 B;  3O35 A;  5FG6 A;  5CUA A;  2YEK A;  5HLS A;  5H1U A;  5DYX A;  2DWW A;  4A9F A;  4TQN A;  4YY6 A;  2N9G A;  4UYE A;  2YDW A;  5H85 A;  3DWY A;  3LJW A;  4NXJ A;  5LJ2 A;  5A82 A;  5ENE A;  2E7O A;  3U5O A;  3DAI A;  4UYD A;  4CUS A;  4FLP A;  5C85 A;  3JVK A;  3HMF A;  5AMF A;  3P5O A;  4LC2 A;  5DFD A;  4UIT A;  4N4I A;  3SVH A;  3HME A;  4NYW A;  4YBT A;  3HMH A;  5II2 A;  4QSW A;  3JVJ A;  5FFY A;  4UYH A;  5H1T A;  4CUR A;  3U5L A;  2OSS A;  5IGK A;  3MB3 A;  5KTU A;  4XUA A;  5FB1 A;  3O37 A;  4WIV A;  3U5M A;  5F62 A;  5E7D A;  4N4G A;  4ALG A;  1ZS5 A;  5F3A A;  2DVV A;  5DLZ A;  5KU3 A;  4HXK A;  4F3I A;  4YYJ A;  5G4R A;  4A9N A;  5FE7 A;  5CQ5 A;  3P1C A;  5FBX A;  5HEN A;  5I83 A;  5LVQ A;  4NRA A;  4HXP A;  4YYG A;  4A9M A;  3SVG A;  5I88 A;  4O7C A;  4MR3 A;  5D3T A;  4A9L A;  5LJ1 A;  4HXM A;  5EVA A;  5EV9 A;  3UV5 A;  4NUC A;  4XY9 A;  4A9I A;  4O7B A;  5IID A;  4HXN A;  4MR5 A;  5C7N A;  5LUU A;  3U5N A;  4TU4 A;  2OUO A;  4PS5 A;  5F63 A;  5F25 A;  5JI8 A;  2I7K A;  4UIZ A;  5A5N A;  5FE5 A;  4IR6 A;  3RCW A;  5CTL A;  4BW2 A;  5K29 A;  5F1H A;  4O74 A;  2RFJ A;  4CFK A;  4NR9 A;  1WUG A;  5D3P A;  4CUP A;  2RO1 A;  5L97 A;  4LR6 A;  4NUD A;  2H60 A;  4O70 A;  4YY4 A;  4NYV A;  3O33 A;  5D7X A;  3LXJ A;  3U5K A;  2DVQ A;  4HBY A;  4AKN A;  5HQ6 A;  4O75 A;  2RS9 B;  5IBN A;  4Z6H A;  4J0S A;  5EIS A;  2MJV B;  5L8T A;  4UIU A;  5JWM A;  2GRC A;  5CUD A;  5CRM A;  4QNS A;  5LKZ A;  5F5Z A;  4UIW A;  5A83 A;  5CU8 A;  5HM0 A;  2WP1 A;  4IR4 A;  4QY4 A;  4QEW A;  5ACY A;  4TZ8 A;  4QSS A;  5ENJ A;  5DYU A;  4A9O A;  5FE0 A;  3LQI A;  3G0L A;  4Y03 A;  5KO4 A;  4UIX A;  5HRV A;  3UVY A;  4LYS A;  5ENF A;  5CQ7 A;  4N3W A;  3MUL A;  4LDF A;  4X2I A;  4NR6 A;  5CQ6 A;  5I89 A;  5ETB A;  5EWC A;  5IGM A;  2OO1 A;  4TYL A;  3QZV A;  5D3N A;  5A5S A;  3ONI A;  4YYK A;  5EWW A;  4QC3 A;  5EWV A;  5FE1 A;  4YBS A;  2YEL A;  5A5R A;  1X0J A;  5E3G A;  2L85 A;  4YAT A;  2WP2 A;  4NR4 A;  3FKM X;  5CY9 A;  5CUE A;  3UVD A;  4ALH A;  4CUT A;  4IR5 A;  5CS8 A;  5L99 A;  5DW1 A;  4OUF A;  4TTE A;  4QR5 A;  5DFB A;  2D82 A;  4QUT A;  5CUC A;  4O72 A;  5CZG A;  5E9L A;  4TZ2 A;  5TCM A;  2LSP B;  5E9M A;  4Q0O A;  2E7N A;  3P1F A;  4NS5 A;  4TS8 A;  5C89 A;  4LYW A;  2YW5 A;  4NQM A;  4E96 A;  4YK0 A;  4MEN A;  5D3L A;  4YC9 A;  5HEL A;  3U5J A;  5CQA A;  2DVS A;  4HXS A;  5HCL A;  4PCE A;  5A5Q A;  4TT4 A;  5A85 A;  4TU6 A;  5HRX A;  2D9E A;  4QSV A;  5C8G A;  4O7F A;  4Q0N A;  2RI7 A;  4PKL A;  2L5E A;  5DKC A;  2L84 A;  5DX4 A;  3P1D A;  5I29 A;  5HFQ A;  1F68 A;  4HBW A;  4YAD A;  2F6N A;  5FH7 A;  5FE3 A;  5I86 A;  2R0Y A;  3MB4 A;  2YQD A;  2RNW A;  5HJC A;  3UVW A;  4NR8 A;  4QSX A;  5LVR A;  4QB3 A;  4NQN A;  5EGU A;  4HBV A;  5EPR A;  4PY6 A;  4QR4 A;  3MUK A;  4QSR A;  4BW4 A;  4UYF B;  3LQJ A;  5FE4 A;  5DYA A;  5D3R A;  5E9V A;  4O71 A;  5ENI A;  4C66 A;  4QBM A;  5DYC A;  4HXO A;  3UV2 A;  5EPS A;  3QZT A;  4NRC A;  1N72 A;  4NUE A;  5DW2 A;  5FE2 A;  4UIV A;  4A9E A;  4CFL A;  5CFW A;  5IGN A;  4DON A;  5EP7 A;  4LZ2 A;  4O78 A;  5L98 A;  5D3S A;  4LRG A;  4ZC9 A;  5E0R A;  4A9J A;  4O77 A;  5EPB A;  5I80 A;  4CL9 A;  5EWD A;  4OGJ A;  5EM3 A;  4BJX A;  5FFW A;  3P1E A;  5FE6 A;  4PCI A;  5F1L A;  3UW9 A;  4BW1 A;  3D7C A;  4N4F A;  5EA1 A;  3G0J A;  5DFC A;  5E3D A;  5HQ7 A;  4YAX A;  4N4H A;  5EK9 A;  5HQ5 A;  5I7X A;  5BT4 A;  4C67 A;  3K2J A;  4WHW A;  5IGL A;  4LZR A;  4QUU A;  4HXR A;  4IR3 A;  4Z6I A;  5CQ4 A;  3GG3 A;  2R10 A;  5DLX A;  5FB0 A;  4IOR A;  5L8U A;  2DVR A;  4J1P A;  2R0S A;  3I3J A;  2F6J A;  5DKD A;  4NYX A;  2E3K A;  4KCX A;  4YAB A;  5D26 A;  4QEU A;  4Z93 A;  5ENH A;  5HEM A;  5EIC A;  5CP5 A;  4CUU A;  5LKX A;  5DY7 A;  5CUB A;  3Q2E A;  5COI A;  4UYG A;  5CQ3 A;  5BT5 A;  5D24 A;  4QEV A;  5E9Y A;  4TT6 A;  5FE8 A;  4ZW1 A;  4NR7 A;  4YYH A;  5AME A;  4GPJ A;  4QST A;  4MEO A;  5C87 A;  4BW3 A;  4A9H A;  4KV4 A;  4YYM A;  3Q2F A;  4YH4 A;  4QC1 A;  2FSA A;  5F36 A;  2YEM A;  3AAD A;  5ETD A;  5G4S A;  4Z1S A;  5C4Q A;  4YH3 A;  5E9K A;  2NXB A;  4J3I A;  4O76 A;  4YBM A;  5FDZ A;  3AQA A;  5F61 A;  5LKU A;  5A5O A; 
#chains in the Genus database with same CATH topology
 4NR5 A;  5KHM A;  4IOO A;  4RVR A;  5CUG A;  4QSQ A;  2YYN A;  4LZS A;  4HXL A;  5I1Q A;  2RNY A;  4XYA A;  4MEP A;  2R0V A;  4WHU A;  2DAT A;  2G4A A;  4UIY A;  5II1 A;  3O36 A;  5EWH A;  2KTB B;  1E6I A;  4ZQL A;  4CUQ A;  3SVF A;  3S92 A;  5IG6 A;  4UYF A;  4Z1Q A;  5CRZ A;  4O7E A;  4MEQ A;  4QYL A;  3U5P A;  1JSP B;  5CGP A;  5AD3 A;  2I8N A;  5D25 A;  5EQ1 A;  5A81 A;  3ZYU A;  4A9K A;  5ENC A;  5FG5 A;  5E9I A;  3IU6 A;  4KV1 A;  5E73 A;  5EU1 A;  2RNX A;  5D3J A;  5ENG A;  5KTW A;  1EQF A;  5CQ8 A;  4QR3 A;  5CPE A;  4YYI A;  4HBX A;  4XUB A;  5ENB A;  5DBM A;  3MQM A;  4QYD A;  4TT2 A;  5LJ0 A;  3TLP A;  3IU5 A;  4OGI A;  4QZS A;  4MR6 A;  5AD2 A;  3UV4 A;  5KTX A;  4NRB A;  3LQH A;  3MXF A;  4QSU A;  5FE9 A;  5FFV A;  5A5P A;  4PTB A;  5TB6 A;  5BT3 A;  5CQT A;  4CLB A;  2DKW A;  3UVX A;  5HFR A;  5FH8 A;  5F60 A;  5L96 A;  5J0D A;  5FH6 A;  5EI4 A;  1WUM A;  3JVL A;  4MR4 A;  5F2P A;  4YYN A;  3JVM A;  3NXB A;  4BHW A;  5FG4 A;  4YYD A;  5D3H A;  5DKH A;  4QSP A;  3QZS A;  5H1V A;  4XY8 A;  3S91 A;  3O34 A;  5A7C A;  5D0C A;  5HRW A;  4J0R A;  5E74 A;  5LKT A;  5I7Y A;  4IOQ A;  4LYI A;  4O7A A;  5I40 A;  1JM4 B;  3O35 A;  5FG6 A;  5CUA A;  2YEK A;  5HLS A;  5H1U A;  5DYX A;  2DWW A;  4A9F A;  4TQN A;  4YY6 A;  2N9G A;  4UYE A;  2YDW A;  5H85 A;  3DWY A;  3LJW A;  4NXJ A;  5LJ2 A;  5A82 A;  5ENE A;  2E7O A;  3U5O A;  3DAI A;  4UYD A;  4CUS A;  4FLP A;  5C85 A;  3JVK A;  3HMF A;  5AMF A;  3P5O A;  4LC2 A;  5DFD A;  4UIT A;  4N4I A;  3SVH A;  3HME A;  4NYW A;  4YBT A;  3HMH A;  5II2 A;  4QSW A;  3JVJ A;  5FFY A;  4UYH A;  5H1T A;  4CUR A;  3U5L A;  2OSS A;  5IGK A;  3MB3 A;  5KTU A;  4XUA A;  5FB1 A;  3O37 A;  4WIV A;  3U5M A;  5F62 A;  5E7D A;  4N4G A;  4ALG A;  1ZS5 A;  5F3A A;  2DVV A;  5DLZ A;  5KU3 A;  4HXK A;  4F3I A;  4YYJ A;  5G4R A;  4A9N A;  5FE7 A;  5CQ5 A;  3P1C A;  5FBX A;  5HEN A;  5I83 A;  5LVQ A;  4NRA A;  4HXP A;  4YYG A;  4A9M A;  3SVG A;  5I88 A;  4O7C A;  4AKI A;  4MR3 A;  5D3T A;  4A9L A;  5LJ1 A;  4HXM A;  5EVA A;  5EV9 A;  3UV5 A;  4NUC A;  4XY9 A;  4A9I A;  4O7B A;  5IID A;  4HXN A;  4MR5 A;  5C7N A;  5LUU A;  3U5N A;  4TU4 A;  2OUO A;  4PS5 A;  5F63 A;  5F25 A;  5JI8 A;  2I7K A;  4UIZ A;  5A5N A;  5FE5 A;  4IR6 A;  3RCW A;  5CTL A;  4BW2 A;  5K29 A;  5F1H A;  4O74 A;  2RFJ A;  4CFK A;  4NR9 A;  1WUG A;  5D3P A;  4CUP A;  2RO1 A;  5L97 A;  3ERR A;  4LR6 A;  4NUD A;  2H60 A;  4O70 A;  4YY4 A;  4NYV A;  3O33 A;  5D7X A;  3LXJ A;  3U5K A;  2DVQ A;  4HBY A;  4AKN A;  5HQ6 A;  4O75 A;  2RS9 B;  5IBN A;  4Z6H A;  4J0S A;  5EIS A;  2MJV B;  5L8T A;  4UIU A;  5JWM A;  2GRC A;  5CUD A;  5CRM A;  4QNS A;  5LKZ A;  5F5Z A;  4UIW A;  5A83 A;  5CU8 A;  5HM0 A;  2WP1 A;  4IR4 A;  4QY4 A;  4QEW A;  5ACY A;  4TZ8 A;  4QSS A;  5ENJ A;  5DYU A;  4A9O A;  5FE0 A;  3VKH A;  3LQI A;  3G0L A;  4Y03 A;  5KO4 A;  3VKG A;  4UIX A;  5HRV A;  3UVY A;  4LYS A;  5ENF A;  5CQ7 A;  4N3W A;  3MUL A;  4LDF A;  4X2I A;  3AQA A;  4NR6 A;  5CQ6 A;  5I89 A;  5ETB A;  5EWC A;  5IGM A;  2OO1 A;  4TYL A;  3QZV A;  5D3N A;  5A5S A;  3ONI A;  4YYK A;  5EWW A;  4QC3 A;  5EWV A;  5FE1 A;  4YBS A;  2YEL A;  5A5R A;  1X0J A;  5E3G A;  2L85 A;  4YAT A;  2WP2 A;  4NR4 A;  3FKM X;  5CY9 A;  5CUE A;  3UVD A;  4ALH A;  4CUT A;  4IR5 A;  5CS8 A;  5L99 A;  5DW1 A;  4OUF A;  4TTE A;  4QR5 A;  5DFB A;  2D82 A;  4QUT A;  5CUC A;  4O72 A;  5CZG A;  5E9L A;  4TZ2 A;  5TCM A;  2LSP B;  5E9M A;  4Q0O A;  2E7N A;  3P1F A;  4NS5 A;  4TS8 A;  5C89 A;  4LYW A;  2YW5 A;  4NQM A;  4E96 A;  4YK0 A;  4MEN A;  5D3L A;  4YC9 A;  5HEL A;  3U5J A;  5CQA A;  2DVS A;  2EJN A;  4HXS A;  5HCL A;  4PCE A;  5A5Q A;  4TT4 A;  5A85 A;  4TU6 A;  5HRX A;  2D9E A;  4QSV A;  5C8G A;  4O7F A;  4Q0N A;  2RI7 A;  4PKL A;  2L5E A;  5DKC A;  2L84 A;  5DX4 A;  3P1D A;  5I29 A;  5HFQ A;  1F68 A;  4HBW A;  4YAD A;  2F6N A;  5FH7 A;  5FE3 A;  5I86 A;  2R0Y A;  3MB4 A;  2YQD A;  2RNW A;  5HJC A;  3UVW A;  4AI6 A;  4NR8 A;  4QSX A;  5LVR A;  4QB3 A;  4NQN A;  5EGU A;  4HBV A;  5EPR A;  4PY6 A;  4QR4 A;  3MUK A;  4QSR A;  4BW4 A;  4UYF B;  3LQJ A;  5FE4 A;  5DYA A;  5D3R A;  5E9V A;  4O71 A;  5ENI A;  4C66 A;  4QBM A;  4AKG A;  5DYC A;  4HXO A;  3UV2 A;  5EPS A;  3QZT A;  4NRC A;  1N72 A;  4NUE A;  5DW2 A;  5FE2 A;  4UIV A;  4A9E A;  4CFL A;  5CFW A;  5IGN A;  4DON A;  5EP7 A;  4LZ2 A;  4O78 A;  5L98 A;  5D3S A;  4LRG A;  4ZC9 A;  5E0R A;  4A9J A;  4O77 A;  5EPB A;  5I80 A;  4CL9 A;  5EWD A;  4OGJ A;  5EM3 A;  3D1B A;  5FFW A;  4BJX A;  3P1E A;  5FE6 A;  4PCI A;  5F1L A;  3UW9 A;  4BW1 A;  3D7C A;  4N4F A;  5EA1 A;  3G0J A;  5DFC A;  5E3D A;  5HQ7 A;  4YAX A;  4N4H A;  5EK9 A;  5HQ5 A;  4AKH A;  5I7X A;  5BT4 A;  4C67 A;  3K2J A;  4WHW A;  5IGL A;  4LZR A;  4QUU A;  4HXR A;  4IR3 A;  4Z6I A;  5CQ4 A;  3GG3 A;  2R10 A;  5DLX A;  5FB0 A;  4IOR A;  5L8U A;  2DVR A;  4J1P A;  2R0S A;  3I3J A;  2F6J A;  5DKD A;  4NYX A;  2E3K A;  4KCX A;  3D1D A;  4YAB A;  5D26 A;  4QEU A;  4Z93 A;  5ENH A;  5HEM A;  5EIC A;  5CP5 A;  4CUU A;  5LKX A;  5DY7 A;  5CUB A;  3Q2E A;  5COI A;  4UYG A;  5CQ3 A;  5BT5 A;  1PUO A;  5D24 A;  4QEV A;  5E9Y A;  4TT6 A;  5FE8 A;  4ZW1 A;  4NR7 A;  4YYH A;  5AME A;  4GPJ A;  4QST A;  4MEO A;  5C87 A;  4BW3 A;  4A9H A;  4KV4 A;  4YYM A;  3Q2F A;  4YH4 A;  4QC1 A;  2FSA A;  5F36 A;  2YEM A;  3AAD A;  5ETD A;  5G4S A;  4Z1S A;  5C4Q A;  4YH3 A;  5E9K A;  2NXB A;  4J3I A;  4O76 A;  4YBM A;  5FDZ A;  1ZKR A;  5F61 A;  5LKU A;  5A5O A; 
#chains in the Genus database with same CATH homology
 4NR5 A;  5KHM A;  4IOO A;  4RVR A;  5CUG A;  4QSQ A;  2YYN A;  4LZS A;  4HXL A;  5I1Q A;  2RNY A;  4XYA A;  4MEP A;  2R0V A;  4WHU A;  2DAT A;  2G4A A;  4UIY A;  5II1 A;  3O36 A;  5EWH A;  2KTB B;  1E6I A;  4ZQL A;  4CUQ A;  3SVF A;  3S92 A;  5IG6 A;  4UYF A;  4Z1Q A;  5CRZ A;  4O7E A;  4MEQ A;  4QYL A;  3U5P A;  1JSP B;  5CGP A;  5AD3 A;  2I8N A;  5D25 A;  5EQ1 A;  5A81 A;  3ZYU A;  4A9K A;  5ENC A;  5FG5 A;  5E9I A;  3IU6 A;  4KV1 A;  5E73 A;  5EU1 A;  2RNX A;  5D3J A;  5ENG A;  5KTW A;  1EQF A;  5CQ8 A;  4QR3 A;  5CPE A;  4YYI A;  4HBX A;  4XUB A;  5ENB A;  5DBM A;  3MQM A;  4QYD A;  4TT2 A;  5LJ0 A;  3TLP A;  3IU5 A;  4OGI A;  4QZS A;  4MR6 A;  5AD2 A;  3UV4 A;  5KTX A;  4NRB A;  3LQH A;  3MXF A;  4QSU A;  5FE9 A;  5FFV A;  5A5P A;  4PTB A;  5TB6 A;  5BT3 A;  5CQT A;  4CLB A;  2DKW A;  3UVX A;  5HFR A;  5FH8 A;  5F60 A;  5L96 A;  5J0D A;  5FH6 A;  5EI4 A;  1WUM A;  3JVL A;  4MR4 A;  5F2P A;  4YYN A;  3JVM A;  3NXB A;  4BHW A;  5FG4 A;  4YYD A;  5D3H A;  5DKH A;  4QSP A;  3QZS A;  5H1V A;  4XY8 A;  3S91 A;  3O34 A;  5A7C A;  5D0C A;  5HRW A;  4J0R A;  5E74 A;  5LKT A;  5I7Y A;  4IOQ A;  4LYI A;  4O7A A;  5I40 A;  1JM4 B;  3O35 A;  5FG6 A;  5CUA A;  2YEK A;  5HLS A;  5H1U A;  5DYX A;  2DWW A;  4A9F A;  4TQN A;  4YY6 A;  2N9G A;  4UYE A;  2YDW A;  5H85 A;  3DWY A;  3LJW A;  4NXJ A;  5LJ2 A;  5A82 A;  5ENE A;  2E7O A;  3U5O A;  3DAI A;  4UYD A;  4CUS A;  4FLP A;  5C85 A;  3JVK A;  3HMF A;  5AMF A;  3P5O A;  4LC2 A;  5DFD A;  4UIT A;  4N4I A;  3SVH A;  3HME A;  4NYW A;  4YBT A;  3HMH A;  5II2 A;  4QSW A;  3JVJ A;  5FFY A;  4UYH A;  5H1T A;  4CUR A;  3U5L A;  2OSS A;  5IGK A;  3MB3 A;  5KTU A;  4XUA A;  5FB1 A;  3O37 A;  4WIV A;  3U5M A;  5F62 A;  5E7D A;  4N4G A;  4ALG A;  1ZS5 A;  5F3A A;  2DVV A;  5DLZ A;  5KU3 A;  4HXK A;  4F3I A;  4YYJ A;  5G4R A;  4A9N A;  5FE7 A;  5CQ5 A;  3P1C A;  5FBX A;  5HEN A;  5I83 A;  5LVQ A;  4NRA A;  4HXP A;  4YYG A;  4A9M A;  3SVG A;  5I88 A;  4O7C A;  4MR3 A;  5D3T A;  4A9L A;  5LJ1 A;  4HXM A;  5EVA A;  5EV9 A;  3UV5 A;  4NUC A;  4XY9 A;  4A9I A;  4O7B A;  5IID A;  4HXN A;  4MR5 A;  5C7N A;  5LUU A;  3U5N A;  4TU4 A;  2OUO A;  4PS5 A;  5F63 A;  5F25 A;  5JI8 A;  2I7K A;  4UIZ A;  5A5N A;  5FE5 A;  4IR6 A;  3RCW A;  5CTL A;  4BW2 A;  5K29 A;  5F1H A;  4O74 A;  2RFJ A;  4CFK A;  4NR9 A;  1WUG A;  5D3P A;  4CUP A;  2RO1 A;  5L97 A;  4LR6 A;  4NUD A;  2H60 A;  4O70 A;  4YY4 A;  4NYV A;  3O33 A;  5D7X A;  3LXJ A;  3U5K A;  2DVQ A;  4HBY A;  4AKN A;  5HQ6 A;  4O75 A;  2RS9 B;  5IBN A;  4Z6H A;  4J0S A;  5EIS A;  2MJV B;  5L8T A;  4UIU A;  5JWM A;  2GRC A;  5CUD A;  5CRM A;  4QNS A;  5LKZ A;  5F5Z A;  4UIW A;  5A83 A;  5CU8 A;  5HM0 A;  2WP1 A;  4IR4 A;  4QY4 A;  4QEW A;  5ACY A;  4TZ8 A;  4QSS A;  5ENJ A;  5DYU A;  4A9O A;  5FE0 A;  3LQI A;  3G0L A;  4Y03 A;  5KO4 A;  4UIX A;  5HRV A;  3UVY A;  4LYS A;  5ENF A;  5CQ7 A;  4N3W A;  3MUL A;  4LDF A;  4X2I A;  4NR6 A;  5CQ6 A;  5I89 A;  5ETB A;  5EWC A;  5IGM A;  2OO1 A;  4TYL A;  3QZV A;  5D3N A;  5A5S A;  3ONI A;  4YYK A;  5EWW A;  4QC3 A;  5EWV A;  5FE1 A;  4YBS A;  2YEL A;  5A5R A;  1X0J A;  5E3G A;  2L85 A;  4YAT A;  2WP2 A;  4NR4 A;  3FKM X;  5CY9 A;  5CUE A;  3UVD A;  4ALH A;  4CUT A;  4IR5 A;  5CS8 A;  5L99 A;  5DW1 A;  4OUF A;  4TTE A;  4QR5 A;  5DFB A;  2D82 A;  4QUT A;  5CUC A;  4O72 A;  5CZG A;  5E9L A;  4TZ2 A;  5TCM A;  2LSP B;  5E9M A;  4Q0O A;  2E7N A;  3P1F A;  4NS5 A;  4TS8 A;  5C89 A;  4LYW A;  2YW5 A;  4NQM A;  4E96 A;  4YK0 A;  4MEN A;  5D3L A;  4YC9 A;  5HEL A;  3U5J A;  5CQA A;  2DVS A;  4HXS A;  5HCL A;  4PCE A;  5A5Q A;  4TT4 A;  5A85 A;  4TU6 A;  5HRX A;  2D9E A;  4QSV A;  5C8G A;  4O7F A;  4Q0N A;  2RI7 A;  4PKL A;  2L5E A;  5DKC A;  2L84 A;  5DX4 A;  3P1D A;  5I29 A;  5HFQ A;  1F68 A;  4HBW A;  4YAD A;  2F6N A;  5FH7 A;  5FE3 A;  5I86 A;  2R0Y A;  3MB4 A;  2YQD A;  2RNW A;  5HJC A;  3UVW A;  4NR8 A;  4QSX A;  5LVR A;  4QB3 A;  4NQN A;  5EGU A;  4HBV A;  5EPR A;  4PY6 A;  4QR4 A;  3MUK A;  4QSR A;  4BW4 A;  4UYF B;  3LQJ A;  5FE4 A;  5DYA A;  5D3R A;  5E9V A;  4O71 A;  5ENI A;  4C66 A;  4QBM A;  5DYC A;  4HXO A;  3UV2 A;  5EPS A;  3QZT A;  4NRC A;  1N72 A;  4NUE A;  5DW2 A;  5FE2 A;  4UIV A;  4A9E A;  4CFL A;  5CFW A;  5IGN A;  4DON A;  5EP7 A;  4LZ2 A;  4O78 A;  5L98 A;  5D3S A;  4LRG A;  4ZC9 A;  5E0R A;  4A9J A;  4O77 A;  5EPB A;  5I80 A;  4CL9 A;  5EWD A;  4OGJ A;  5EM3 A;  4BJX A;  5FFW A;  3P1E A;  5FE6 A;  4PCI A;  5F1L A;  3UW9 A;  4BW1 A;  3D7C A;  4N4F A;  5EA1 A;  3G0J A;  5DFC A;  5E3D A;  5HQ7 A;  4YAX A;  4N4H A;  5EK9 A;  5HQ5 A;  5I7X A;  5BT4 A;  4C67 A;  3K2J A;  4WHW A;  5IGL A;  4LZR A;  4QUU A;  4HXR A;  4IR3 A;  4Z6I A;  5CQ4 A;  3GG3 A;  2R10 A;  5DLX A;  5FB0 A;  4IOR A;  5L8U A;  2DVR A;  4J1P A;  2R0S A;  3I3J A;  2F6J A;  5DKD A;  4NYX A;  2E3K A;  4KCX A;  4YAB A;  5D26 A;  4QEU A;  4Z93 A;  5ENH A;  5HEM A;  5EIC A;  5CP5 A;  4CUU A;  5LKX A;  5DY7 A;  5CUB A;  3Q2E A;  5COI A;  4UYG A;  5CQ3 A;  5BT5 A;  5D24 A;  4QEV A;  5E9Y A;  4TT6 A;  5FE8 A;  4ZW1 A;  4NR7 A;  4YYH A;  5AME A;  4GPJ A;  4QST A;  4MEO A;  5C87 A;  4BW3 A;  4A9H A;  4KV4 A;  4YYM A;  3Q2F A;  4YH4 A;  4QC1 A;  2FSA A;  5F36 A;  2YEM A;  3AAD A;  5ETD A;  5G4S A;  4Z1S A;  5C4Q A;  4YH3 A;  5E9K A;  2NXB A;  4J3I A;  4O76 A;  4YBM A;  5FDZ A;  3AQA A;  5F61 A;  5LKU A;  5A5O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...