5CTLA

Crystal structure of the first bromodomain of human brd4 in complex with benzo[cd]indol-2(1h)-one ligand
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
133
structure length
133
Chain Sequence
HHHHHLVPRGSNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein/inhibitor
molecule keywords Bromodomain-containing protein 4
publication title Discovery of Benzo[cd]indol-2(1H)-ones as Potent and Specific BET Bromodomain Inhibitors: Structure-Based Virtual Screening, Optimization, and Biological Evaluation
pubmed doi rcsb
source organism Homo sapiens
total genus 40
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 2015-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5ctlA01
4ZC9A 2OO1A 4TT4A 4OGIA 2RFJA 4MR6A 4XUBA 5KTWA 4HBYA 3LJWA 5CQ6A 2YW5A 5D0CA 4NQMA 4NR4A 5L97A 5JWMA 5FH7A 4LR6A 5A7CA 3UVDA 4TS8A 5HRVA 1F68A 5D3RA 5EISA 5K29A 5CQ7A 5DKDA 4QSSA 5DBMA 5J0DA 5ENHA 3RCWA 5D3PA 4YYNA 3AADA 4LDFA 5C4QA 4YYGA 4CFKA 2L5EA 3LQHA 5C89A 5L96A 5DYUA 5E3DA 4UIVA 3HMEA 5EWDA 5F2PA 4NR8A 3P1CA 4BW2A 4N4HA 2DKWA 3UW9A 4YH3A 4TZ8A 5CUGA 2MJVB 2D82A 5DKCA 5LKXA 4HXSA 4Y03A 5FG5A 5LJ1A 4NRCA 2E3KA 5E9LA 4NQNA 2GRCA 5A5RA 4UYFA 3HMFA 2RO1A 4HXKA 5FFWA 4QBMA 4NR9A 4QR4A 5E73A 4A9FA 4QSXA 5I80A 4Q0OA 5F1HA 5LJ0A 5CQAA 4F3IA 4UIYA 5E9YA 4TTEA 4YC9A 3UV5A 5ETDA 4TYLA 4QC3A 5I29A 3UVYA 5LVQA 4HBVA 4O75A 3DWYA 3U5NA 5L8UA 5CQ8A 5KTXA 4UYFB 3LQJA 4MR4A 4YAXA 4TU6A 5F60A 4UYHA 5A5NA 5F5ZA 4CUPA 2KTBB 4BW4A 5AMFA 4BW1A 5FE1A 4HXOA 5CQ5A 5ENBA 4E96A 3JVLA 1EQFA 3U5LA 5FH6A 5HQ6A 4O72A 5F25A 4IR6A 3U5KA 1ZS5A 4YYIA 4Z93A 4C66A 4MEQA 5EQ1A 5LKZA 5HENA 3MULA 5HQ5A 4YBTA 4BHWA 4PY6A 4QSVA 4NUDA 5KU3A 4J1PA 5CS8A 4O7AA 4O7EA 5LKTA 5COIA 3O34A 4A9JA 4OGJA 5E74A 5CQ4A 4TT2A 5EWHA 4N3WA 5EK9A 4NS5A 4YY6A 4A9HA 3ONIA 2RS9B 5EM3A 5IGLA 4CUUA 5C8GA 2YYNA 5DYXA 3JVKA 5D7XA 4CFLA 4YADA 5D3JA 4YYMA 5CUEA 3IU5A 4YYDA 2F6JA 4LC2A 4TQNA 4UYEA 5A5SA 4O7CA 4IOQA 5FFYA 2DVQA 5FG4A 4QSRA 2H60A 5DYAA 4XUAA 4O70A 3O37A 5C7NA 5CGPA 5FE8A 4UIZA 5FBXA 5AMEA 4IR3A 3U5OA 4YYKA 4O78A 4YY4A 5LJ2A 4BJXA 4QEWA 5A83A 4Q0NA 5DFCA 5E9KA 5F36A 5E9IA 4WHWA 5HELA 2YQDA 5ACYA 4NRAA 3HMHA 5ENEA 5CU8A 5C85A 3DAIA 2FSAA 4QUUA 4C67A 4QSUA 5I1QA 3G0JA 5H1VA 4Z1QA 4J0RA 4IR5A 5HLSA 4HXPA 1E6IA 5E9VA 4KV1A 2YDWA 2L84A 5ENJA 3U5PA 5H85A 5DW1A 3MUKA 5FG6A 5EU1A 3MB4A 5EICA 5LVRA 4LZRA 5A81A 2R0SA 5I88A 5FB1A 5A5PA 5DW2A 5I83A 4QEVA 2D9EA 3QZVA 2OUOA 4MR3A 4Z6HA 5F1LA 4UYGA 5ENIA 5L98A 5LUUA 4PCEA 3P5OA 2WP1A 3I3JA 4FLPA 5EPBA 4RVRA 4NYVA 4QYLA 2G4AA 5D3SA 3U5MA 3LQIA 2OSSA 3P1EA 4QR3A 5EV9A 4LZSA 3LXJA 5CRZA 4O74A 3SVFA 4XY8A 5ENCA 5H1TA 4A9EA 5EWCA 5HFQA 3UV4A 4OUFA 4PKLA 1N72A 5BT5A 5CFWA 1X0JA 3MQMA 1JSPB 3Q2FA 3GG3A 2R10A 5A85A 4YBMA 4HXMA 3S92A 5A5OA 5LKUA 4UIXA 5FE4A 3JVMA 5KTUA 4QR5A 4QYDA 5EI4A 1WUMA 4LYIA 5FFVA 4ALGA 5HRXA 2WP2A 3D7CA 2LSPB 4Z1SA 3QZTA 4NUEA 4YBSA 4XYAA 4AKNA 4TU4A 4NXJA 5HCLA 4CUSA 5CUDA 5FDZA 5DFBA 5DKHA 5EGUA 5HJCA 4A9MA 4CUTA 5AD2A 4QEUA 5D3TA 5EA1A 5F61A 5I86A 5FE9A 3UVXA 5CY9A 5HEMA 5CPEA 5ETBA 4BW3A 4YATA 2DVRA 4IORA 4ALHA 4HBWA 4QZSA 4QSTA 5CZGA 4MR5A 3MB3A 5L8TA 5CQTA 4NR7A 5I7XA 4HXNA 5EPRA 5ENGA 5H1UA 5FE7A 5C87A 5JI8A 5DLZA 4XY9A 5AD3A 4MEPA 1WUGA 3P1DA 5CUCA 4NR5A 5DLXA 5KHMA 2DWWA 3K2JA 5F62A 3UVWA 2R0YA 4QC1A 3SVGA 3JVJA 4QSPA 4NYWA 4QSQA 1JM4B 4NR6A 4A9OA 4X2IA 2NXBA 5FE3A 4LRGA 3S91A 2I7KA 5CUBA 4LYSA 4N4FA 5IG6A 2F6NA 5DX4A 5EPSA 3Q2EA 4KCXA 4NRBA 5CRMA 5ENFA 4MENA 4NYXA 3TLPA 5II1A 3G0LA 2YELA 3NXBA 5D3NA 5I89A 5IGNA 3O33A 3UV2A 4PS5A 3O35A 4QB3A 4HXRA 4LYWA 4KV4A 3U5JA 4YABA 4Z6IA 5BT4A 4LZ2A 5FE0A 3AQAA 4WIVA 2E7OA 4UIUA 5CP5A 5HM0A 5F63A 5TCMA 4IR4A 5I40A 4O7FA 4CLBA 5D26A 4CURA 5I7YA 4DONA 2YEKA 4J0SA 3MXFA 5A82A 4N4GA 4HXLA 3IU6A 5HFRA 4GPJA 5IGKA 4UYDA 2DVSA 5IBNA 4YYJA 2RNYA 5CTLA 5BT3A 5CQ3A 4J3IA 2RNWA 4YH4A 4UIWA 2R0VA 4QUTA 5L99A 2E7NA 4A9KA 5E7DA 5G4SA 2DVVA 4QNSA 4QY4A 5II2A 4TT6A 5E9MA 5EWVA 2L85A 4A9IA 4PTBA 4YYHA 3O36A 3P1FA 4NUCA 4PCIA 3FKMX 3QZSA 5D24A 4YK0A 4CL9A 5G4RA 5D3HA 4CUQA 4TZ2A 5E0RA 2YEMA 5DY7A 5FH8A 4QSWA 4O7BA 5D3LA 4ZW1A 2I8NA 4A9LA 5E3GA 5EVAA 4UITA 4O71A 4N4IA 5HQ7A 5CUAA 5FE2A 5D25A 4WHUA 4MEOA 5IIDA 5FE6A 4ZQLA 4O77A 2DATA 5DFDA 3ZYUA 5KO4A 5DYCA 3SVHA 5FB0A 5FE5A 5TB6A 2RI7A 5F3AA 4IOOA 5EP7A 2RNXA 5A5QA 5HRWA 4O76A 4A9NA 4HBXA 5IGMA 2N9GA 5EWWA
chains in the Genus database with same CATH superfamily
4ZC9A 2OO1A 4TT4A 4OGIA 2RFJA 4MR6A 4XUBA 5KTWA 4HBYA 3LJWA 2EJNA 5CQ6A 2YW5A 5D0CA 4NQMA 4NR4A 5L97A 5JWMA 5FH7A 4LR6A 5A7CA 3UVDA 4TS8A 5HRVA 1F68A 5D3RA 5EISA 5K29A 5CQ7A 5DKDA 4QSSA 5DBMA 5J0DA 5ENHA 3RCWA 5D3PA 4YYNA 3AADA 4LDFA 5C4QA 4YYGA 4CFKA 2L5EA 3LQHA 5C89A 5L96A 5DYUA 5E3DA 4UIVA 3HMEA 5EWDA 5F2PA 4NR8A 3P1CA 4BW2A 4N4HA 2DKWA 3UW9A 4YH3A 4TZ8A 5CUGA 2MJVB 2D82A 5DKCA 5LKXA 4HXSA 4Y03A 5FG5A 5LJ1A 4NRCA 2E3KA 5E9LA 4NQNA 2GRCA 5A5RA 4UYFA 3HMFA 2RO1A 4HXKA 5FFWA 4QBMA 4NR9A 4QR4A 5E73A 4A9FA 4QSXA 4AKHA 5I80A 4Q0OA 5F1HA 5LJ0A 5CQAA 4F3IA 4UIYA 5E9YA 4TTEA 4YC9A 3UV5A 5ETDA 4TYLA 4QC3A 5I29A 3UVYA 5LVQA 4HBVA 4O75A 3DWYA 3U5NA 5L8UA 5CQ8A 5KTXA 4UYFB 3LQJA 4MR4A 4YAXA 3VKHA 4TU6A 5F60A 4UYHA 5A5NA 5F5ZA 4CUPA 2KTBB 4BW4A 5AMFA 4BW1A 5FE1A 4HXOA 5CQ5A 5ENBA 4E96A 3JVLA 1EQFA 3U5LA 5FH6A 5HQ6A 4O72A 5F25A 4IR6A 3U5KA 1ZS5A 4YYIA 4Z93A 4C66A 4MEQA 5EQ1A 5LKZA 5HENA 3MULA 5HQ5A 4YBTA 4BHWA 4PY6A 4QSVA 4NUDA 5KU3A 4AKGA 4J1PA 5CS8A 4O7AA 4O7EA 5LKTA 5COIA 3O34A 4A9JA 4OGJA 5E74A 5CQ4A 4TT2A 5EWHA 4N3WA 5EK9A 4NS5A 4YY6A 4A9HA 3ONIA 2RS9B 5EM3A 3ERRA 5IGLA 4CUUA 5C8GA 2YYNA 5DYXA 3JVKA 5D7XA 4CFLA 4YADA 5D3JA 4YYMA 5CUEA 3IU5A 4YYDA 1ZKRA 2F6JA 4LC2A 4TQNA 4UYEA 5A5SA 4O7CA 4IOQA 5FFYA 2DVQA 5FG4A 4QSRA 2H60A 5DYAA 4XUAA 4O70A 3O37A 5C7NA 5CGPA 5FE8A 4UIZA 5FBXA 5AMEA 4IR3A 3U5OA 4YYKA 4O78A 4YY4A 5LJ2A 4BJXA 4QEWA 5A83A 4Q0NA 5DFCA 5E9KA 5F36A 5E9IA 4WHWA 5HELA 2YQDA 5ACYA 4NRAA 3HMHA 5ENEA 4AKIA 5CU8A 5C85A 3DAIA 2FSAA 4QUUA 4C67A 4QSUA 5I1QA 3G0JA 5H1VA 4Z1QA 4J0RA 4IR5A 5HLSA 4HXPA 1E6IA 5E9VA 4KV1A 2YDWA 2L84A 5ENJA 3U5PA 5H85A 5DW1A 3MUKA 5FG6A 5EU1A 3MB4A 5EICA 5LVRA 4LZRA 5A81A 2R0SA 5I88A 5FB1A 5A5PA 5DW2A 5I83A 1PUOA 4QEVA 2D9EA 3QZVA 2OUOA 4MR3A 4Z6HA 5F1LA 4UYGA 5ENIA 5L98A 5LUUA 4PCEA 3P5OA 2WP1A 3I3JA 4FLPA 5EPBA 4RVRA 4NYVA 4QYLA 2G4AA 5D3SA 3U5MA 3LQIA 2OSSA 3P1EA 4QR3A 5EV9A 4LZSA 3LXJA 5CRZA 4O74A 3SVFA 4XY8A 5ENCA 5H1TA 4A9EA 5EWCA 5HFQA 3UV4A 4OUFA 4PKLA 1N72A 5BT5A 5CFWA 1X0JA 3MQMA 1JSPB 3Q2FA 3GG3A 2R10A 5A85A 4YBMA 4HXMA 3S92A 5A5OA 5LKUA 4UIXA 5FE4A 3JVMA 5KTUA 4QR5A 4QYDA 5EI4A 1WUMA 4LYIA 5FFVA 4ALGA 5HRXA 3VKGA 2WP2A 3D7CA 2LSPB 4Z1SA 3QZTA 4NUEA 4YBSA 4XYAA 4AKNA 4TU4A 4NXJA 5HCLA 4CUSA 5CUDA 5FDZA 5DFBA 5DKHA 5EGUA 5HJCA 4A9MA 4CUTA 5AD2A 4QEUA 5D3TA 5EA1A 5F61A 5I86A 5FE9A 3UVXA 5CY9A 5HEMA 5CPEA 5ETBA 4BW3A 4YATA 2DVRA 4IORA 4ALHA 4HBWA 4QZSA 4QSTA 5CZGA 4MR5A 3MB3A 5L8TA 5CQTA 4NR7A 5I7XA 4HXNA 5EPRA 5ENGA 5H1UA 5FE7A 5C87A 5JI8A 5DLZA 4XY9A 5AD3A 4MEPA 1WUGA 3P1DA 5CUCA 4NR5A 5DLXA 5KHMA 2DWWA 3K2JA 5F62A 3UVWA 2R0YA 4QC1A 3SVGA 3JVJA 4QSPA 4NYWA 4QSQA 1JM4B 4NR6A 4A9OA 4X2IA 2NXBA 5FE3A 4LRGA 3S91A 2I7KA 5CUBA 4LYSA 4N4FA 5IG6A 2F6NA 5DX4A 5EPSA 3Q2EA 4KCXA 4NRBA 5CRMA 5ENFA 4MENA 4NYXA 3TLPA 5II1A 3G0LA 2YELA 3NXBA 5D3NA 5I89A 5IGNA 3O33A 3UV2A 4PS5A 3O35A 4QB3A 4HXRA 4LYWA 4KV4A 3U5JA 4AI6A 4YABA 4Z6IA 5BT4A 4LZ2A 5FE0A 3AQAA 4WIVA 2E7OA 4UIUA 5CP5A 5HM0A 5F63A 5TCMA 4IR4A 5I40A 4O7FA 4CLBA 5D26A 4CURA 5I7YA 4DONA 2YEKA 4J0SA 3MXFA 5A82A 4N4GA 4HXLA 3IU6A 5HFRA 4GPJA 5IGKA 4UYDA 2DVSA 5IBNA 4YYJA 2RNYA 5CTLA 5BT3A 5CQ3A 4J3IA 2RNWA 4YH4A 4UIWA 2R0VA 4QUTA 5L99A 2E7NA 4A9KA 5E7DA 5G4SA 2DVVA 4QNSA 4QY4A 5II2A 4TT6A 5E9MA 5EWVA 2L85A 4A9IA 4PTBA 4YYHA 3O36A 3P1FA 4NUCA 4PCIA 3FKMX 3QZSA 5D24A 4YK0A 4CL9A 5G4RA 5D3HA 3D1BA 4CUQA 4TZ2A 5E0RA 2YEMA 5DY7A 5FH8A 4QSWA 4O7BA 5D3LA 4ZW1A 2I8NA 4A9LA 5E3GA 5EVAA 4UITA 3D1DA 4O71A 4N4IA 5HQ7A 5CUAA 5FE2A 5D25A 4WHUA 4MEOA 5IIDA 5FE6A 4ZQLA 4O77A 2DATA 5DFDA 3ZYUA 5KO4A 5DYCA 3SVHA 5FB0A 5FE5A 5TB6A 2RI7A 5F3AA 4IOOA 5EP7A 2RNXA 5A5QA 5HRWA 4O76A 4A9NA 4HBXA 5IGMA 2N9GA 5EWWA
chains in the Genus database with same CATH topology
4ZC9A 2OO1A 4TT4A 4OGIA 2RFJA 4MR6A 4XUBA 5KTWA 4HBYA 3LJWA 5CQ6A 2YW5A 5D0CA 4NQMA 4NR4A 5L97A 5JWMA 5FH7A 4LR6A 5A7CA 3UVDA 4TS8A 5HRVA 1F68A 5D3RA 5EISA 5K29A 5CQ7A 5DKDA 4QSSA 5DBMA 5J0DA 5ENHA 3RCWA 5D3PA 4YYNA 3AADA 4LDFA 5C4QA 4YYGA 4CFKA 2L5EA 3LQHA 5C89A 5L96A 5DYUA 5E3DA 4UIVA 3HMEA 5EWDA 5F2PA 4NR8A 3P1CA 4BW2A 4N4HA 2DKWA 3UW9A 4YH3A 4TZ8A 5CUGA 2MJVB 2D82A 5DKCA 5LKXA 4HXSA 4Y03A 5FG5A 5LJ1A 4NRCA 2E3KA 5E9LA 4NQNA 2GRCA 5A5RA 4UYFA 3HMFA 2RO1A 4HXKA 5FFWA 4QBMA 4NR9A 4QR4A 5E73A 4A9FA 4QSXA 5I80A 4Q0OA 5F1HA 5LJ0A 5CQAA 4F3IA 4UIYA 5E9YA 4TTEA 4YC9A 3UV5A 5ETDA 4TYLA 4QC3A 5I29A 3UVYA 5LVQA 4HBVA 4O75A 3DWYA 3U5NA 5L8UA 5CQ8A 5KTXA 4UYFB 3LQJA 4MR4A 4YAXA 4TU6A 5F60A 4UYHA 5A5NA 5F5ZA 4CUPA 2KTBB 4BW4A 5AMFA 4BW1A 5FE1A 4HXOA 5CQ5A 5ENBA 4E96A 3JVLA 1EQFA 3U5LA 5FH6A 5HQ6A 4O72A 5F25A 4IR6A 3U5KA 1ZS5A 4YYIA 4Z93A 4C66A 4MEQA 5EQ1A 5LKZA 5HENA 3MULA 5HQ5A 4YBTA 4BHWA 4PY6A 4QSVA 4NUDA 5KU3A 4J1PA 5CS8A 4O7AA 4O7EA 5LKTA 5COIA 3O34A 4A9JA 4OGJA 5E74A 5CQ4A 4TT2A 5EWHA 4N3WA 5EK9A 4NS5A 4YY6A 4A9HA 3ONIA 2RS9B 5EM3A 5IGLA 4CUUA 5C8GA 2YYNA 5DYXA 3JVKA 5D7XA 4CFLA 4YADA 5D3JA 4YYMA 5CUEA 3IU5A 4YYDA 2F6JA 4LC2A 4TQNA 4UYEA 5A5SA 4O7CA 4IOQA 5FFYA 2DVQA 5FG4A 4QSRA 2H60A 5DYAA 4XUAA 4O70A 3O37A 5C7NA 5CGPA 5FE8A 4UIZA 5FBXA 5AMEA 4IR3A 3U5OA 4YYKA 4O78A 4YY4A 5LJ2A 4BJXA 4QEWA 5A83A 4Q0NA 5DFCA 5E9KA 5F36A 5E9IA 4WHWA 5HELA 2YQDA 5ACYA 4NRAA 3HMHA 5ENEA 5CU8A 5C85A 3DAIA 2FSAA 4QUUA 4C67A 4QSUA 5I1QA 3G0JA 5H1VA 4Z1QA 4J0RA 4IR5A 5HLSA 4HXPA 1E6IA 5E9VA 4KV1A 2YDWA 2L84A 5ENJA 3U5PA 5H85A 5DW1A 3MUKA 5FG6A 5EU1A 3MB4A 5EICA 5LVRA 4LZRA 5A81A 2R0SA 5I88A 5FB1A 5A5PA 5DW2A 5I83A 4QEVA 2D9EA 3QZVA 2OUOA 4MR3A 4Z6HA 5F1LA 4UYGA 5ENIA 5L98A 5LUUA 4PCEA 3P5OA 2WP1A 3I3JA 4FLPA 5EPBA 4RVRA 4NYVA 4QYLA 2G4AA 5D3SA 3U5MA 3LQIA 2OSSA 3P1EA 4QR3A 5EV9A 4LZSA 3LXJA 5CRZA 4O74A 3SVFA 4XY8A 5ENCA 5H1TA 4A9EA 5EWCA 5HFQA 3UV4A 4OUFA 4PKLA 1N72A 5BT5A 5CFWA 1X0JA 3MQMA 1JSPB 3Q2FA 3GG3A 2R10A 5A85A 4YBMA 4HXMA 3S92A 5A5OA 5LKUA 4UIXA 5FE4A 3JVMA 5KTUA 4QR5A 4QYDA 5EI4A 1WUMA 4LYIA 5FFVA 4ALGA 5HRXA 2WP2A 3D7CA 2LSPB 4Z1SA 3QZTA 4NUEA 4YBSA 4XYAA 4AKNA 4TU4A 4NXJA 5HCLA 4CUSA 5CUDA 5FDZA 5DFBA 5DKHA 5EGUA 5HJCA 4A9MA 4CUTA 5AD2A 4QEUA 5D3TA 5EA1A 5F61A 5I86A 5FE9A 3UVXA 5CY9A 5HEMA 5CPEA 5ETBA 4BW3A 4YATA 2DVRA 4IORA 4ALHA 4HBWA 4QZSA 4QSTA 5CZGA 4MR5A 3MB3A 5L8TA 5CQTA 4NR7A 5I7XA 4HXNA 5EPRA 5ENGA 5H1UA 5FE7A 5C87A 5JI8A 5DLZA 4XY9A 5AD3A 4MEPA 1WUGA 3P1DA 5CUCA 4NR5A 5DLXA 5KHMA 2DWWA 3K2JA 5F62A 3UVWA 2R0YA 4QC1A 3SVGA 3JVJA 4QSPA 4NYWA 4QSQA 1JM4B 4NR6A 4A9OA 4X2IA 2NXBA 5FE3A 4LRGA 3S91A 2I7KA 5CUBA 4LYSA 4N4FA 5IG6A 2F6NA 5DX4A 5EPSA 3Q2EA 4KCXA 4NRBA 5CRMA 5ENFA 4MENA 4NYXA 3TLPA 5II1A 3G0LA 2YELA 3NXBA 5D3NA 5I89A 5IGNA 3O33A 3UV2A 4PS5A 3O35A 4QB3A 4HXRA 4LYWA 4KV4A 3U5JA 4YABA 4Z6IA 5BT4A 4LZ2A 5FE0A 3AQAA 4WIVA 2E7OA 4UIUA 5CP5A 5HM0A 5F63A 5TCMA 4IR4A 5I40A 4O7FA 4CLBA 5D26A 4CURA 5I7YA 4DONA 2YEKA 4J0SA 3MXFA 5A82A 4N4GA 4HXLA 3IU6A 5HFRA 4GPJA 5IGKA 4UYDA 2DVSA 5IBNA 4YYJA 2RNYA 5CTLA 5BT3A 5CQ3A 4J3IA 2RNWA 4YH4A 4UIWA 2R0VA 4QUTA 5L99A 2E7NA 4A9KA 5E7DA 5G4SA 2DVVA 4QNSA 4QY4A 5II2A 4TT6A 5E9MA 5EWVA 2L85A 4A9IA 4PTBA 4YYHA 3O36A 3P1FA 4NUCA 4PCIA 3FKMX 3QZSA 5D24A 4YK0A 4CL9A 5G4RA 5D3HA 4CUQA 4TZ2A 5E0RA 2YEMA 5DY7A 5FH8A 4QSWA 4O7BA 5D3LA 4ZW1A 2I8NA 4A9LA 5E3GA 5EVAA 4UITA 4O71A 4N4IA 5HQ7A 5CUAA 5FE2A 5D25A 4WHUA 4MEOA 5IIDA 5FE6A 4ZQLA 4O77A 2DATA 5DFDA 3ZYUA 5KO4A 5DYCA 3SVHA 5FB0A 5FE5A 5TB6A 2RI7A 5F3AA 4IOOA 5EP7A 2RNXA 5A5QA 5HRWA 4O76A 4A9NA 4HBXA 5IGMA 2N9GA 5EWWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZC9 A;  2OO1 A;  4TT4 A;  4OGI A;  2RFJ A;  4MR6 A;  4XUB A;  5KTW A;  4HBY A;  3LJW A;  5CQ6 A;  2YW5 A;  5D0C A;  4NQM A;  4NR4 A;  5L97 A;  5JWM A;  5FH7 A;  4LR6 A;  5A7C A;  3UVD A;  4TS8 A;  5HRV A;  1F68 A;  5D3R A;  5EIS A;  5K29 A;  5CQ7 A;  5DKD A;  4QSS A;  5DBM A;  5J0D A;  5ENH A;  3RCW A;  5D3P A;  4YYN A;  3AAD A;  4LDF A;  5C4Q A;  4YYG A;  4CFK A;  2L5E A;  3LQH A;  5C89 A;  5L96 A;  5DYU A;  5E3D A;  4UIV A;  3HME A;  5EWD A;  5F2P A;  4NR8 A;  3P1C A;  4BW2 A;  4N4H A;  2DKW A;  3UW9 A;  4YH3 A;  4TZ8 A;  5CUG A;  2MJV B;  2D82 A;  5DKC A;  5LKX A;  4HXS A;  4Y03 A;  5FG5 A;  5LJ1 A;  4NRC A;  2E3K A;  5E9L A;  4NQN A;  2GRC A;  5A5R A;  4UYF A;  3HMF A;  2RO1 A;  4HXK A;  5FFW A;  4QBM A;  4NR9 A;  4QR4 A;  5E73 A;  4A9F A;  4QSX A;  5I80 A;  4Q0O A;  5F1H A;  5LJ0 A;  5CQA A;  4F3I A;  4UIY A;  5E9Y A;  4TTE A;  4YC9 A;  3UV5 A;  5ETD A;  4TYL A;  4QC3 A;  5I29 A;  3UVY A;  5LVQ A;  4HBV A;  4O75 A;  3DWY A;  3U5N A;  5L8U A;  5CQ8 A;  5KTX A;  4UYF B;  3LQJ A;  4MR4 A;  4YAX A;  4TU6 A;  5F60 A;  4UYH A;  5A5N A;  5F5Z A;  4CUP A;  2KTB B;  4BW4 A;  5AMF A;  4BW1 A;  5FE1 A;  4HXO A;  5CQ5 A;  5ENB A;  4E96 A;  3JVL A;  1EQF A;  3U5L A;  5FH6 A;  5HQ6 A;  4O72 A;  5F25 A;  4IR6 A;  3U5K A;  1ZS5 A;  4YYI A;  4Z93 A;  4C66 A;  4MEQ A;  5EQ1 A;  5LKZ A;  5HEN A;  3MUL A;  5HQ5 A;  4YBT A;  4BHW A;  4PY6 A;  4QSV A;  4NUD A;  5KU3 A;  4J1P A;  5CS8 A;  4O7A A;  4O7E A;  5LKT A;  5COI A;  3O34 A;  4A9J A;  4OGJ A;  5E74 A;  5CQ4 A;  4TT2 A;  5EWH A;  4N3W A;  5EK9 A;  4NS5 A;  4YY6 A;  4A9H A;  3ONI A;  2RS9 B;  5EM3 A;  5IGL A;  4CUU A;  5C8G A;  2YYN A;  5DYX A;  3JVK A;  5D7X A;  4CFL A;  4YAD A;  5D3J A;  4YYM A;  5CUE A;  3IU5 A;  4YYD A;  2F6J A;  4LC2 A;  4TQN A;  4UYE A;  5A5S A;  4O7C A;  4IOQ A;  5FFY A;  2DVQ A;  5FG4 A;  4QSR A;  2H60 A;  5DYA A;  4XUA A;  4O70 A;  3O37 A;  5C7N A;  5CGP A;  5FE8 A;  4UIZ A;  5FBX A;  5AME A;  4IR3 A;  3U5O A;  4YYK A;  4O78 A;  4YY4 A;  5LJ2 A;  4BJX A;  4QEW A;  5A83 A;  4Q0N A;  5DFC A;  5E9K A;  5F36 A;  5E9I A;  4WHW A;  5HEL A;  2YQD A;  5ACY A;  4NRA A;  3HMH A;  5ENE A;  5CU8 A;  5C85 A;  3DAI A;  2FSA A;  4QUU A;  4C67 A;  4QSU A;  5I1Q A;  3G0J A;  5H1V A;  4Z1Q A;  4J0R A;  4IR5 A;  5HLS A;  4HXP A;  1E6I A;  5E9V A;  4KV1 A;  2YDW A;  2L84 A;  5ENJ A;  3U5P A;  5H85 A;  5DW1 A;  3MUK A;  5FG6 A;  5EU1 A;  3MB4 A;  5EIC A;  5LVR A;  4LZR A;  5A81 A;  2R0S A;  5I88 A;  5FB1 A;  5A5P A;  5DW2 A;  5I83 A;  4QEV A;  2D9E A;  3QZV A;  2OUO A;  4MR3 A;  4Z6H A;  5F1L A;  4UYG A;  5ENI A;  5L98 A;  5LUU A;  4PCE A;  3P5O A;  2WP1 A;  3I3J A;  4FLP A;  5EPB A;  4RVR A;  4NYV A;  4QYL A;  2G4A A;  5D3S A;  3U5M A;  3LQI A;  2OSS A;  3P1E A;  4QR3 A;  5EV9 A;  4LZS A;  3LXJ A;  5CRZ A;  4O74 A;  3SVF A;  4XY8 A;  5ENC A;  5H1T A;  4A9E A;  5EWC A;  5HFQ A;  3UV4 A;  4OUF A;  4PKL A;  1N72 A;  5BT5 A;  5CFW A;  1X0J A;  3MQM A;  1JSP B;  3Q2F A;  3GG3 A;  2R10 A;  5A85 A;  4YBM A;  4HXM A;  3S92 A;  5A5O A;  5LKU A;  4UIX A;  5FE4 A;  3JVM A;  5KTU A;  4QR5 A;  4QYD A;  5EI4 A;  1WUM A;  4LYI A;  5FFV A;  4ALG A;  5HRX A;  2WP2 A;  3D7C A;  2LSP B;  4Z1S A;  3QZT A;  4NUE A;  4YBS A;  4XYA A;  4AKN A;  4TU4 A;  4NXJ A;  5HCL A;  4CUS A;  5CUD A;  5FDZ A;  5DFB A;  5DKH A;  5EGU A;  5HJC A;  4A9M A;  4CUT A;  5AD2 A;  4QEU A;  5D3T A;  5EA1 A;  5F61 A;  5I86 A;  5FE9 A;  3UVX A;  5CY9 A;  5HEM A;  5CPE A;  5ETB A;  4BW3 A;  4YAT A;  2DVR A;  4IOR A;  4ALH A;  4HBW A;  4QZS A;  4QST A;  5CZG A;  4MR5 A;  3MB3 A;  5L8T A;  5CQT A;  4NR7 A;  5I7X A;  4HXN A;  5EPR A;  5ENG A;  5H1U A;  5FE7 A;  5C87 A;  5JI8 A;  5DLZ A;  4XY9 A;  5AD3 A;  4MEP A;  1WUG A;  3P1D A;  5CUC A;  4NR5 A;  5DLX A;  5KHM A;  2DWW A;  3K2J A;  5F62 A;  3UVW A;  2R0Y A;  4QC1 A;  3SVG A;  3JVJ A;  4QSP A;  4NYW A;  4QSQ A;  1JM4 B;  4NR6 A;  4A9O A;  4X2I A;  2NXB A;  5FE3 A;  4LRG A;  3S91 A;  2I7K A;  5CUB A;  4LYS A;  4N4F A;  5IG6 A;  2F6N A;  5DX4 A;  5EPS A;  3Q2E A;  4KCX A;  4NRB A;  5CRM A;  5ENF A;  4MEN A;  4NYX A;  3TLP A;  5II1 A;  3G0L A;  2YEL A;  3NXB A;  5D3N A;  5I89 A;  5IGN A;  3O33 A;  3UV2 A;  4PS5 A;  3O35 A;  4QB3 A;  4HXR A;  4LYW A;  4KV4 A;  3U5J A;  4YAB A;  4Z6I A;  5BT4 A;  4LZ2 A;  5FE0 A;  3AQA A;  4WIV A;  2E7O A;  4UIU A;  5CP5 A;  5HM0 A;  5F63 A;  5TCM A;  4IR4 A;  5I40 A;  4O7F A;  4CLB A;  5D26 A;  4CUR A;  5I7Y A;  4DON A;  2YEK A;  4J0S A;  3MXF A;  5A82 A;  4N4G A;  4HXL A;  3IU6 A;  5HFR A;  4GPJ A;  5IGK A;  4UYD A;  2DVS A;  5IBN A;  4YYJ A;  2RNY A;  5CTL A;  5BT3 A;  5CQ3 A;  4J3I A;  2RNW A;  4YH4 A;  4UIW A;  2R0V A;  4QUT A;  5L99 A;  2E7N A;  4A9K A;  5E7D A;  5G4S A;  2DVV A;  4QNS A;  4QY4 A;  5II2 A;  4TT6 A;  5E9M A;  5EWV A;  2L85 A;  4A9I A;  4PTB A;  4YYH A;  3O36 A;  3P1F A;  4NUC A;  4PCI A;  3FKM X;  3QZS A;  5D24 A;  4YK0 A;  4CL9 A;  5G4R A;  5D3H A;  4CUQ A;  4TZ2 A;  5E0R A;  2YEM A;  5DY7 A;  5FH8 A;  4QSW A;  4O7B A;  5D3L A;  4ZW1 A;  2I8N A;  4A9L A;  5E3G A;  5EVA A;  4UIT A;  4O71 A;  4N4I A;  5HQ7 A;  5CUA A;  5FE2 A;  5D25 A;  4WHU A;  4MEO A;  5IID A;  5FE6 A;  4ZQL A;  4O77 A;  2DAT A;  5DFD A;  3ZYU A;  5KO4 A;  5DYC A;  3SVH A;  5FB0 A;  5FE5 A;  5TB6 A;  2RI7 A;  5F3A A;  4IOO A;  5EP7 A;  2RNX A;  5A5Q A;  5HRW A;  4O76 A;  4A9N A;  4HBX A;  5IGM A;  2N9G A;  5EWW A; 
#chains in the Genus database with same CATH topology
 4ZC9 A;  2OO1 A;  4TT4 A;  4OGI A;  2RFJ A;  4MR6 A;  4XUB A;  5KTW A;  4HBY A;  3LJW A;  2EJN A;  5CQ6 A;  2YW5 A;  5D0C A;  4NQM A;  4NR4 A;  5L97 A;  5JWM A;  5FH7 A;  4LR6 A;  5A7C A;  3UVD A;  4TS8 A;  5HRV A;  1F68 A;  5D3R A;  5EIS A;  5K29 A;  5CQ7 A;  5DKD A;  4QSS A;  5DBM A;  5J0D A;  5ENH A;  3RCW A;  5D3P A;  4YYN A;  3AAD A;  4LDF A;  5C4Q A;  4YYG A;  4CFK A;  2L5E A;  3LQH A;  5C89 A;  5L96 A;  5DYU A;  5E3D A;  4UIV A;  3HME A;  5EWD A;  5F2P A;  4NR8 A;  3P1C A;  4BW2 A;  4N4H A;  2DKW A;  3UW9 A;  4YH3 A;  4TZ8 A;  5CUG A;  2MJV B;  2D82 A;  5DKC A;  5LKX A;  4HXS A;  4Y03 A;  5FG5 A;  5LJ1 A;  4NRC A;  2E3K A;  5E9L A;  4NQN A;  2GRC A;  5A5R A;  4UYF A;  3HMF A;  2RO1 A;  4HXK A;  5FFW A;  4QBM A;  4NR9 A;  4QR4 A;  5E73 A;  4A9F A;  4QSX A;  4AKH A;  5I80 A;  4Q0O A;  5F1H A;  5LJ0 A;  5CQA A;  4F3I A;  4UIY A;  5E9Y A;  4TTE A;  4YC9 A;  3UV5 A;  5ETD A;  4TYL A;  4QC3 A;  5I29 A;  3UVY A;  5LVQ A;  4HBV A;  4O75 A;  3DWY A;  3U5N A;  5L8U A;  5CQ8 A;  5KTX A;  4UYF B;  3LQJ A;  4MR4 A;  4YAX A;  3VKH A;  4TU6 A;  5F60 A;  4UYH A;  5A5N A;  5F5Z A;  4CUP A;  2KTB B;  4BW4 A;  5AMF A;  4BW1 A;  5FE1 A;  4HXO A;  5CQ5 A;  5ENB A;  4E96 A;  3JVL A;  1EQF A;  3U5L A;  5FH6 A;  5HQ6 A;  4O72 A;  5F25 A;  4IR6 A;  3U5K A;  1ZS5 A;  4YYI A;  4Z93 A;  4C66 A;  4MEQ A;  5EQ1 A;  5LKZ A;  5HEN A;  3MUL A;  5HQ5 A;  4YBT A;  4BHW A;  4PY6 A;  4QSV A;  4NUD A;  5KU3 A;  4AKG A;  4J1P A;  5CS8 A;  4O7A A;  4O7E A;  5LKT A;  5COI A;  3O34 A;  4A9J A;  4OGJ A;  5E74 A;  5CQ4 A;  4TT2 A;  5EWH A;  4N3W A;  5EK9 A;  4NS5 A;  4YY6 A;  4A9H A;  3ONI A;  2RS9 B;  5EM3 A;  3ERR A;  5IGL A;  4CUU A;  5C8G A;  2YYN A;  5DYX A;  3JVK A;  5D7X A;  4CFL A;  4YAD A;  5D3J A;  4YYM A;  5CUE A;  3IU5 A;  4YYD A;  1ZKR A;  2F6J A;  4LC2 A;  4TQN A;  4UYE A;  5A5S A;  4O7C A;  4IOQ A;  5FFY A;  2DVQ A;  5FG4 A;  4QSR A;  2H60 A;  5DYA A;  4XUA A;  4O70 A;  3O37 A;  5C7N A;  5CGP A;  5FE8 A;  4UIZ A;  5FBX A;  5AME A;  4IR3 A;  3U5O A;  4YYK A;  4O78 A;  4YY4 A;  5LJ2 A;  4BJX A;  4QEW A;  5A83 A;  4Q0N A;  5DFC A;  5E9K A;  5F36 A;  5E9I A;  4WHW A;  5HEL A;  2YQD A;  5ACY A;  4NRA A;  3HMH A;  5ENE A;  4AKI A;  5CU8 A;  5C85 A;  3DAI A;  2FSA A;  4QUU A;  4C67 A;  4QSU A;  5I1Q A;  3G0J A;  5H1V A;  4Z1Q A;  4J0R A;  4IR5 A;  5HLS A;  4HXP A;  1E6I A;  5E9V A;  4KV1 A;  2YDW A;  2L84 A;  5ENJ A;  3U5P A;  5H85 A;  5DW1 A;  3MUK A;  5FG6 A;  5EU1 A;  3MB4 A;  5EIC A;  5LVR A;  4LZR A;  5A81 A;  2R0S A;  5I88 A;  5FB1 A;  5A5P A;  5DW2 A;  5I83 A;  1PUO A;  4QEV A;  2D9E A;  3QZV A;  2OUO A;  4MR3 A;  4Z6H A;  5F1L A;  4UYG A;  5ENI A;  5L98 A;  5LUU A;  4PCE A;  3P5O A;  2WP1 A;  3I3J A;  4FLP A;  5EPB A;  4RVR A;  4NYV A;  4QYL A;  2G4A A;  5D3S A;  3U5M A;  3LQI A;  2OSS A;  3P1E A;  4QR3 A;  5EV9 A;  4LZS A;  3LXJ A;  5CRZ A;  4O74 A;  3SVF A;  4XY8 A;  5ENC A;  5H1T A;  4A9E A;  5EWC A;  5HFQ A;  3UV4 A;  4OUF A;  4PKL A;  1N72 A;  5BT5 A;  5CFW A;  1X0J A;  3MQM A;  1JSP B;  3Q2F A;  3GG3 A;  2R10 A;  5A85 A;  4YBM A;  4HXM A;  3S92 A;  5A5O A;  5LKU A;  4UIX A;  5FE4 A;  3JVM A;  5KTU A;  4QR5 A;  4QYD A;  5EI4 A;  1WUM A;  4LYI A;  5FFV A;  4ALG A;  5HRX A;  3VKG A;  2WP2 A;  3D7C A;  2LSP B;  4Z1S A;  3QZT A;  4NUE A;  4YBS A;  4XYA A;  4AKN A;  4TU4 A;  4NXJ A;  5HCL A;  4CUS A;  5CUD A;  5FDZ A;  5DFB A;  5DKH A;  5EGU A;  5HJC A;  4A9M A;  4CUT A;  5AD2 A;  4QEU A;  5D3T A;  5EA1 A;  5F61 A;  5I86 A;  5FE9 A;  3UVX A;  5CY9 A;  5HEM A;  5CPE A;  5ETB A;  4BW3 A;  4YAT A;  2DVR A;  4IOR A;  4ALH A;  4HBW A;  4QZS A;  4QST A;  5CZG A;  4MR5 A;  3MB3 A;  5L8T A;  5CQT A;  4NR7 A;  5I7X A;  4HXN A;  5EPR A;  5ENG A;  5H1U A;  5FE7 A;  5C87 A;  5JI8 A;  5DLZ A;  4XY9 A;  5AD3 A;  4MEP A;  1WUG A;  3P1D A;  5CUC A;  4NR5 A;  5DLX A;  5KHM A;  2DWW A;  3K2J A;  5F62 A;  3UVW A;  2R0Y A;  4QC1 A;  3SVG A;  3JVJ A;  4QSP A;  4NYW A;  4QSQ A;  1JM4 B;  4NR6 A;  4A9O A;  4X2I A;  2NXB A;  5FE3 A;  4LRG A;  3S91 A;  2I7K A;  5CUB A;  4LYS A;  4N4F A;  5IG6 A;  2F6N A;  5DX4 A;  5EPS A;  3Q2E A;  4KCX A;  4NRB A;  5CRM A;  5ENF A;  4MEN A;  4NYX A;  3TLP A;  5II1 A;  3G0L A;  2YEL A;  3NXB A;  5D3N A;  5I89 A;  5IGN A;  3O33 A;  3UV2 A;  4PS5 A;  3O35 A;  4QB3 A;  4HXR A;  4LYW A;  4KV4 A;  3U5J A;  4AI6 A;  4YAB A;  4Z6I A;  5BT4 A;  4LZ2 A;  5FE0 A;  3AQA A;  4WIV A;  2E7O A;  4UIU A;  5CP5 A;  5HM0 A;  5F63 A;  5TCM A;  4IR4 A;  5I40 A;  4O7F A;  4CLB A;  5D26 A;  4CUR A;  5I7Y A;  4DON A;  2YEK A;  4J0S A;  3MXF A;  5A82 A;  4N4G A;  4HXL A;  3IU6 A;  5HFR A;  4GPJ A;  5IGK A;  4UYD A;  2DVS A;  5IBN A;  4YYJ A;  2RNY A;  5CTL A;  5BT3 A;  5CQ3 A;  4J3I A;  2RNW A;  4YH4 A;  4UIW A;  2R0V A;  4QUT A;  5L99 A;  2E7N A;  4A9K A;  5E7D A;  5G4S A;  2DVV A;  4QNS A;  4QY4 A;  5II2 A;  4TT6 A;  5E9M A;  5EWV A;  2L85 A;  4A9I A;  4PTB A;  4YYH A;  3O36 A;  3P1F A;  4NUC A;  4PCI A;  3FKM X;  3QZS A;  5D24 A;  4YK0 A;  4CL9 A;  5G4R A;  5D3H A;  3D1B A;  4CUQ A;  4TZ2 A;  5E0R A;  2YEM A;  5DY7 A;  5FH8 A;  4QSW A;  4O7B A;  5D3L A;  4ZW1 A;  2I8N A;  4A9L A;  5E3G A;  5EVA A;  4UIT A;  3D1D A;  4O71 A;  4N4I A;  5HQ7 A;  5CUA A;  5FE2 A;  5D25 A;  4WHU A;  4MEO A;  5IID A;  5FE6 A;  4ZQL A;  4O77 A;  2DAT A;  5DFD A;  3ZYU A;  5KO4 A;  5DYC A;  3SVH A;  5FB0 A;  5FE5 A;  5TB6 A;  2RI7 A;  5F3A A;  4IOO A;  5EP7 A;  2RNX A;  5A5Q A;  5HRW A;  4O76 A;  4A9N A;  4HBX A;  5IGM A;  2N9G A;  5EWW A; 
#chains in the Genus database with same CATH homology
 4ZC9 A;  2OO1 A;  4TT4 A;  4OGI A;  2RFJ A;  4MR6 A;  4XUB A;  5KTW A;  4HBY A;  3LJW A;  5CQ6 A;  2YW5 A;  5D0C A;  4NQM A;  4NR4 A;  5L97 A;  5JWM A;  5FH7 A;  4LR6 A;  5A7C A;  3UVD A;  4TS8 A;  5HRV A;  1F68 A;  5D3R A;  5EIS A;  5K29 A;  5CQ7 A;  5DKD A;  4QSS A;  5DBM A;  5J0D A;  5ENH A;  3RCW A;  5D3P A;  4YYN A;  3AAD A;  4LDF A;  5C4Q A;  4YYG A;  4CFK A;  2L5E A;  3LQH A;  5C89 A;  5L96 A;  5DYU A;  5E3D A;  4UIV A;  3HME A;  5EWD A;  5F2P A;  4NR8 A;  3P1C A;  4BW2 A;  4N4H A;  2DKW A;  3UW9 A;  4YH3 A;  4TZ8 A;  5CUG A;  2MJV B;  2D82 A;  5DKC A;  5LKX A;  4HXS A;  4Y03 A;  5FG5 A;  5LJ1 A;  4NRC A;  2E3K A;  5E9L A;  4NQN A;  2GRC A;  5A5R A;  4UYF A;  3HMF A;  2RO1 A;  4HXK A;  5FFW A;  4QBM A;  4NR9 A;  4QR4 A;  5E73 A;  4A9F A;  4QSX A;  5I80 A;  4Q0O A;  5F1H A;  5LJ0 A;  5CQA A;  4F3I A;  4UIY A;  5E9Y A;  4TTE A;  4YC9 A;  3UV5 A;  5ETD A;  4TYL A;  4QC3 A;  5I29 A;  3UVY A;  5LVQ A;  4HBV A;  4O75 A;  3DWY A;  3U5N A;  5L8U A;  5CQ8 A;  5KTX A;  4UYF B;  3LQJ A;  4MR4 A;  4YAX A;  4TU6 A;  5F60 A;  4UYH A;  5A5N A;  5F5Z A;  4CUP A;  2KTB B;  4BW4 A;  5AMF A;  4BW1 A;  5FE1 A;  4HXO A;  5CQ5 A;  5ENB A;  4E96 A;  3JVL A;  1EQF A;  3U5L A;  5FH6 A;  5HQ6 A;  4O72 A;  5F25 A;  4IR6 A;  3U5K A;  1ZS5 A;  4YYI A;  4Z93 A;  4C66 A;  4MEQ A;  5EQ1 A;  5LKZ A;  5HEN A;  3MUL A;  5HQ5 A;  4YBT A;  4BHW A;  4PY6 A;  4QSV A;  4NUD A;  5KU3 A;  4J1P A;  5CS8 A;  4O7A A;  4O7E A;  5LKT A;  5COI A;  3O34 A;  4A9J A;  4OGJ A;  5E74 A;  5CQ4 A;  4TT2 A;  5EWH A;  4N3W A;  5EK9 A;  4NS5 A;  4YY6 A;  4A9H A;  3ONI A;  2RS9 B;  5EM3 A;  5IGL A;  4CUU A;  5C8G A;  2YYN A;  5DYX A;  3JVK A;  5D7X A;  4CFL A;  4YAD A;  5D3J A;  4YYM A;  5CUE A;  3IU5 A;  4YYD A;  2F6J A;  4LC2 A;  4TQN A;  4UYE A;  5A5S A;  4O7C A;  4IOQ A;  5FFY A;  2DVQ A;  5FG4 A;  4QSR A;  2H60 A;  5DYA A;  4XUA A;  4O70 A;  3O37 A;  5C7N A;  5CGP A;  5FE8 A;  4UIZ A;  5FBX A;  5AME A;  4IR3 A;  3U5O A;  4YYK A;  4O78 A;  4YY4 A;  5LJ2 A;  4BJX A;  4QEW A;  5A83 A;  4Q0N A;  5DFC A;  5E9K A;  5F36 A;  5E9I A;  4WHW A;  5HEL A;  2YQD A;  5ACY A;  4NRA A;  3HMH A;  5ENE A;  5CU8 A;  5C85 A;  3DAI A;  2FSA A;  4QUU A;  4C67 A;  4QSU A;  5I1Q A;  3G0J A;  5H1V A;  4Z1Q A;  4J0R A;  4IR5 A;  5HLS A;  4HXP A;  1E6I A;  5E9V A;  4KV1 A;  2YDW A;  2L84 A;  5ENJ A;  3U5P A;  5H85 A;  5DW1 A;  3MUK A;  5FG6 A;  5EU1 A;  3MB4 A;  5EIC A;  5LVR A;  4LZR A;  5A81 A;  2R0S A;  5I88 A;  5FB1 A;  5A5P A;  5DW2 A;  5I83 A;  4QEV A;  2D9E A;  3QZV A;  2OUO A;  4MR3 A;  4Z6H A;  5F1L A;  4UYG A;  5ENI A;  5L98 A;  5LUU A;  4PCE A;  3P5O A;  2WP1 A;  3I3J A;  4FLP A;  5EPB A;  4RVR A;  4NYV A;  4QYL A;  2G4A A;  5D3S A;  3U5M A;  3LQI A;  2OSS A;  3P1E A;  4QR3 A;  5EV9 A;  4LZS A;  3LXJ A;  5CRZ A;  4O74 A;  3SVF A;  4XY8 A;  5ENC A;  5H1T A;  4A9E A;  5EWC A;  5HFQ A;  3UV4 A;  4OUF A;  4PKL A;  1N72 A;  5BT5 A;  5CFW A;  1X0J A;  3MQM A;  1JSP B;  3Q2F A;  3GG3 A;  2R10 A;  5A85 A;  4YBM A;  4HXM A;  3S92 A;  5A5O A;  5LKU A;  4UIX A;  5FE4 A;  3JVM A;  5KTU A;  4QR5 A;  4QYD A;  5EI4 A;  1WUM A;  4LYI A;  5FFV A;  4ALG A;  5HRX A;  2WP2 A;  3D7C A;  2LSP B;  4Z1S A;  3QZT A;  4NUE A;  4YBS A;  4XYA A;  4AKN A;  4TU4 A;  4NXJ A;  5HCL A;  4CUS A;  5CUD A;  5FDZ A;  5DFB A;  5DKH A;  5EGU A;  5HJC A;  4A9M A;  4CUT A;  5AD2 A;  4QEU A;  5D3T A;  5EA1 A;  5F61 A;  5I86 A;  5FE9 A;  3UVX A;  5CY9 A;  5HEM A;  5CPE A;  5ETB A;  4BW3 A;  4YAT A;  2DVR A;  4IOR A;  4ALH A;  4HBW A;  4QZS A;  4QST A;  5CZG A;  4MR5 A;  3MB3 A;  5L8T A;  5CQT A;  4NR7 A;  5I7X A;  4HXN A;  5EPR A;  5ENG A;  5H1U A;  5FE7 A;  5C87 A;  5JI8 A;  5DLZ A;  4XY9 A;  5AD3 A;  4MEP A;  1WUG A;  3P1D A;  5CUC A;  4NR5 A;  5DLX A;  5KHM A;  2DWW A;  3K2J A;  5F62 A;  3UVW A;  2R0Y A;  4QC1 A;  3SVG A;  3JVJ A;  4QSP A;  4NYW A;  4QSQ A;  1JM4 B;  4NR6 A;  4A9O A;  4X2I A;  2NXB A;  5FE3 A;  4LRG A;  3S91 A;  2I7K A;  5CUB A;  4LYS A;  4N4F A;  5IG6 A;  2F6N A;  5DX4 A;  5EPS A;  3Q2E A;  4KCX A;  4NRB A;  5CRM A;  5ENF A;  4MEN A;  4NYX A;  3TLP A;  5II1 A;  3G0L A;  2YEL A;  3NXB A;  5D3N A;  5I89 A;  5IGN A;  3O33 A;  3UV2 A;  4PS5 A;  3O35 A;  4QB3 A;  4HXR A;  4LYW A;  4KV4 A;  3U5J A;  4YAB A;  4Z6I A;  5BT4 A;  4LZ2 A;  5FE0 A;  3AQA A;  4WIV A;  2E7O A;  4UIU A;  5CP5 A;  5HM0 A;  5F63 A;  5TCM A;  4IR4 A;  5I40 A;  4O7F A;  4CLB A;  5D26 A;  4CUR A;  5I7Y A;  4DON A;  2YEK A;  4J0S A;  3MXF A;  5A82 A;  4N4G A;  4HXL A;  3IU6 A;  5HFR A;  4GPJ A;  5IGK A;  4UYD A;  2DVS A;  5IBN A;  4YYJ A;  2RNY A;  5CTL A;  5BT3 A;  5CQ3 A;  4J3I A;  2RNW A;  4YH4 A;  4UIW A;  2R0V A;  4QUT A;  5L99 A;  2E7N A;  4A9K A;  5E7D A;  5G4S A;  2DVV A;  4QNS A;  4QY4 A;  5II2 A;  4TT6 A;  5E9M A;  5EWV A;  2L85 A;  4A9I A;  4PTB A;  4YYH A;  3O36 A;  3P1F A;  4NUC A;  4PCI A;  3FKM X;  3QZS A;  5D24 A;  4YK0 A;  4CL9 A;  5G4R A;  5D3H A;  4CUQ A;  4TZ2 A;  5E0R A;  2YEM A;  5DY7 A;  5FH8 A;  4QSW A;  4O7B A;  5D3L A;  4ZW1 A;  2I8N A;  4A9L A;  5E3G A;  5EVA A;  4UIT A;  4O71 A;  4N4I A;  5HQ7 A;  5CUA A;  5FE2 A;  5D25 A;  4WHU A;  4MEO A;  5IID A;  5FE6 A;  4ZQL A;  4O77 A;  2DAT A;  5DFD A;  3ZYU A;  5KO4 A;  5DYC A;  3SVH A;  5FB0 A;  5FE5 A;  5TB6 A;  2RI7 A;  5F3A A;  4IOO A;  5EP7 A;  2RNX A;  5A5Q A;  5HRW A;  4O76 A;  4A9N A;  4HBX A;  5IGM A;  2N9G A;  5EWW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...