2YDWA

Crystal structure of the first bromodomain of human brd2 with the inhibitor gw841819x
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
107
structure length
107
Chain Sequence
TNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKIFLQKVASMPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BROMODOMAIN-CONTAINING PROTEIN 2
publication title Discovery and Characterization of Small Molecule Inhibitors of the Bet Family Bromodomains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Nuclear protein
total genus 36
structure length 107
sequence length 107
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2ydwA00
4A9FA 4NQMA 4YYKA 5FG5A 4LYSA 5DY7A 5ETDA 4O7BA 4XUAA 2YQDA 5EPBA 5IGNA 4CL9A 2OUOA 5F5ZA 4QSSA 4RVRA 3Q2FA 5EI4A 4UYGA 5G4RA 5COIA 3MB4A 4Y03A 4A9EA 5A5OA 3U5OA 4XUBA 5FB1A 4HXLA 4CLBA 4C66A 4A9LA 5KTXA 4Q0NA 5LJ1A 4QSPA 5C7NA 5ENHA 4BJXA 4HXRA 4NR9A 5DFBA 2YEKA 2LSPB 2DWWA 4XYAA 3UV4A 4ALHA 5FBXA 5HELA 5CQ6A 5LKXA 3P1CA 4E96A 4LRGA 5F1HA 5H1UA 5HCLA 5HFRA 5CQAA 3U5LA 2RFJA 4KV1A 5E9LA 5H1TA 4O77A 3UVDA 5D24A 4QSUA 4O78A 5E9MA 5AD2A 4YC9A 4IR5A 2RNXA 5EM3A 3ONIA 4F3IA 5I29A 3P1FA 4OUFA 4NUDA 3MQMA 3SVHA 4ZC9A 3UVYA 5DKDA 4TT4A 4YBTA 5DKHA 5HQ6A 5E3DA 5DYXA 5LJ0A 4MR5A 3S91A 5FH8A 3P1DA 5ENJA 5HM0A 4A9OA 4A9NA 5FE0A 5CUEA 4YADA 4LZRA 2I7KA 4WIVA 5I88A 3U5KA 5E3GA 5D3HA 5F36A 4C67A 4NQNA 3UW9A 5TCMA 5CQTA 3LJWA 5H1VA 4X2IA 5HQ5A 3MUKA 2YEMA 2E3KA 2NXBA 5II1A 4QYLA 4Z93A 4YABA 4ALGA 4DONA 4MR3A 4IORA 4FLPA 5DKCA 5HJCA 4LYIA 1JSPB 4YYJA 4YYMA 3O34A 4CURA 5L8TA 4N4IA 2DVSA 4Q0OA 5F60A 5AMFA 5E9VA 4YY4A 4LDFA 4UIZA 5KTUA 2MJVB 4PKLA 5A83A 5ENBA 2OO1A 2RS9B 3NXBA 5E9IA 4IR3A 2GRCA 5DYUA 5BT3A 3HMEA 2L84A 3MB3A 5I80A 2RNWA 5BT5A 5EVAA 4CFKA 4HBWA 5FE5A 1X0JA 4QC1A 4HBYA 3ZYUA 4N4FA 5EWCA 5D3NA 4TTEA 4O7EA 5A5PA 5FE4A 3D7CA 4A9IA 4YH3A 3DAIA 4TU4A 5TB6A 4NRAA 5CGPA 2E7NA 5CQ8A 4UIXA 2WP1A 4HBVA 4HXMA 4UYFA 3DWYA 5IGLA 3TLPA 3JVJA 4O70A 2F6JA 4KV4A 5D26A 5I7YA 3U5NA 5F62A 5DLZA 5FE9A 5CRZA 4NUCA 5ENIA 5C85A 2DVVA 5ENEA 2WP2A 5LJ2A 5EV9A 2D9EA 5FFWA 5ENFA 4J3IA 3MULA 5DYCA 5C89A 3G0LA 3O36A 4O75A 4Z1SA 4NR5A 5F61A 3JVKA 5DW2A 5JI8A 4YK0A 4QNSA 4QBMA 5BT4A 4CUQA 4O7CA 4NS5A 5D25A 4NRBA 5FE1A 5CS8A 5D3RA 5EP7A 4UIUA 5ETBA 2YDWA 5DX4A 4N4GA 4LZSA 4UYDA 5HRXA 5FE2A 5CUDA 4A9KA 3HMFA 4CFLA 4NXJA 5D3SA 5E73A 3LQJA 4YAXA 5J0DA 4QYDA 4YATA 3LQIA 4A9HA 4UITA 5HEMA 4QB3A 4GPJA 5I83A 3P1EA 2FSAA 4CUPA 4MEQA 3SVGA 5A81A 5F1LA 5HRVA 3MXFA 4QSTA 5I1QA 5L96A 4BW3A 4PY6A 4NRCA 4NYXA 3AADA 4MEPA 4J0SA 5EPRA 4TYLA 4NYVA 4IOQA 5FB0A 4NR7A 5A7CA 5LVRA 5AMEA 5CU8A 4TU6A 4AKNA 3IU6A 4NR8A 5ENCA 4YYDA 5EWVA 2DVQA 4O71A 4TZ2A 4HXOA 5HLSA 4YH4A 5KU3A 3U5MA 4CUTA 4QSXA 4IR4A 4IR6A 4NUEA 4YYGA 5DYAA 5CP5A 5FDZA 3G0JA 3QZVA 4QSQA 5EWDA 5D0CA 4Z6HA 4HXPA 4N4HA 5CPEA 5E9YA 4TZ8A 4UYHA 4A9JA 5LVQA 3LQHA 1WUGA 5DFDA 4UYEA 4KCXA 4TT6A 5D7XA 5HRWA 5DW1A 4TQNA 5C8GA 5EQ1A 5DBMA 5KHMA 4CUUA 4BHWA 2DATA 4NR6A 2R10A 5E0RA 4OGIA 5KO4A 2YELA 5FH6A 5LUUA 4PCEA 3K2JA 4WHUA 5CZGA 4N3WA 5LKUA 5EICA 4O7FA 4BW2A 3U5PA 4O72A 4LR6A 5F25A 5A82A 4O76A 4BW1A 4YYNA 3QZSA 5L8UA 4A9MA 4UIWA 5CQ3A 5D3LA 5CUCA 4LZ2A 4WHWA 5KTWA 3UV2A 5CTLA 5DLXA 5H85A 4YBMA 4MR6A 1N72A 2E7OA 3LXJA 5A5NA 4NYWA 2KTBB 5I86A 4BW4A 4PS5A 4UIVA 5FE3A 4QR4A 5C87A 5IG6A 2YYNA 4YBSA 4YYHA 4QY4A 4MENA 4QZSA 4HXSA 2N9GA 5CFWA 3JVMA 4OGJA 3HMHA 5FE7A 4PCIA 2F6NA 5IGMA 2R0YA 5EA1A 3AQAA 5A5SA 2R0SA 5C4QA 3GG3A 4ZW1A 4HXKA 5CRMA 5DFCA 3IU5A 4MR4A 5D3PA 2G4AA 3FKMX 5A5RA 5FFYA 2L85A 4UYFB 3JVLA 4XY8A 4UIYA 1ZS5A 4HBXA 3P5OA 2R0VA 1E6IA 4QSVA 2OSSA 4QUTA 4TT2A 4ZQLA 4QSWA 5IBNA 5L98A 5LKZA 5JWMA 4Z1QA 4XY9A 2YW5A 5A85A 4J0RA 2I8NA 5E7DA 5LKTA 4CUSA 4QR5A 5IGKA 4PTBA 5EU1A 5CY9A 5D3JA 5AD3A 5EGUA 3O33A 4NR4A 3UV5A 5HFQA 5ENGA 4J1PA 5CQ4A 2L5EA 1WUMA 3I3JA 4MEOA 2DKWA 4QUUA 5ACYA 5EWWA 4QEVA 2H60A 5I89A 4Z6IA 2RI7A 4IOOA 5EWHA 3UVWA 4YYIA 5EPSA 3U5JA 1JM4B 1F68A 5FE8A 5CUAA 5E9KA 3SVFA 5F3AA 5L99A 3RCWA 4QEUA 5IIDA 5E74A 4TS8A 5FFVA 3Q2EA 2D82A 4LC2A 4LYWA 5EISA 5I7XA 1EQFA 5L97A 5FG4A 5A5QA 5I40A 3QZTA 5CUBA 2RO1A 4YY6A 4QC3A 2DVRA 5II2A 4O74A 5CQ7A 5CUGA 5FG6A 4QR3A 5EK9A 3O37A 4QSRA 5K29A 2RNYA 3O35A 5D3TA 3S92A 5G4SA 4QEWA 5F2PA 5F63A 5HENA 3UVXA 5FE6A 4O7AA 5CQ5A 5HQ7A 4HXNA 5FH7A
chains in the Genus database with same CATH superfamily
4A9FA 4AKIA 4NQMA 4YYKA 5FG5A 4LYSA 5DY7A 5ETDA 4O7BA 4XUAA 2YQDA 5EPBA 5IGNA 4CL9A 2OUOA 5F5ZA 4QSSA 4RVRA 3Q2FA 5EI4A 4UYGA 5G4RA 5COIA 3MB4A 4Y03A 4A9EA 5A5OA 3U5OA 4XUBA 5FB1A 4HXLA 4CLBA 4C66A 4A9LA 5KTXA 4Q0NA 5LJ1A 4AI6A 4QSPA 5C7NA 5ENHA 4BJXA 4HXRA 4NR9A 5DFBA 2YEKA 2LSPB 2DWWA 4XYAA 3UV4A 4ALHA 5FBXA 5HELA 5CQ6A 5LKXA 3P1CA 4E96A 4LRGA 5F1HA 5H1UA 5HCLA 5HFRA 5CQAA 3U5LA 2RFJA 4KV1A 5E9LA 5H1TA 4O77A 3UVDA 5D24A 4QSUA 4O78A 5E9MA 5AD2A 4YC9A 4IR5A 3D1BA 2RNXA 5EM3A 3ONIA 4F3IA 5I29A 3P1FA 4OUFA 4NUDA 3MQMA 3SVHA 4ZC9A 3UVYA 5DKDA 4TT4A 4YBTA 5DKHA 5HQ6A 5E3DA 5DYXA 5LJ0A 4MR5A 3S91A 5FH8A 3P1DA 5ENJA 5HM0A 4A9OA 4A9NA 5FE0A 5CUEA 4YADA 4LZRA 2I7KA 4WIVA 5I88A 3U5KA 5E3GA 5D3HA 5F36A 4C67A 4NQNA 3UW9A 5TCMA 5CQTA 3LJWA 5H1VA 4X2IA 5HQ5A 3MUKA 2YEMA 2E3KA 2NXBA 5II1A 4QYLA 3VKGA 4Z93A 4YABA 4ALGA 4DONA 4MR3A 4IORA 4FLPA 5DKCA 5HJCA 4LYIA 1JSPB 4YYJA 4YYMA 3O34A 4CURA 5L8TA 4N4IA 2DVSA 4Q0OA 5F60A 5AMFA 5E9VA 4YY4A 4LDFA 4UIZA 5KTUA 2MJVB 4PKLA 5A83A 5ENBA 2OO1A 2RS9B 3NXBA 5E9IA 4IR3A 2GRCA 5DYUA 5BT3A 3HMEA 2L84A 3MB3A 5I80A 2RNWA 5BT5A 5EVAA 4CFKA 4HBWA 5FE5A 1X0JA 4QC1A 4HBYA 3ZYUA 4N4FA 5EWCA 5D3NA 4TTEA 4O7EA 5A5PA 5FE4A 3D7CA 4A9IA 4YH3A 3DAIA 4TU4A 5TB6A 4NRAA 5CGPA 2E7NA 5CQ8A 4UIXA 2WP1A 4HBVA 4HXMA 4UYFA 3DWYA 5IGLA 3TLPA 3JVJA 4O70A 2F6JA 4KV4A 5D26A 5I7YA 2EJNA 3U5NA 5F62A 5DLZA 5FE9A 5CRZA 4NUCA 5ENIA 5C85A 2DVVA 5ENEA 2WP2A 5LJ2A 5EV9A 2D9EA 5FFWA 5ENFA 4J3IA 3MULA 5DYCA 5C89A 3G0LA 3O36A 4O75A 4Z1SA 4NR5A 5F61A 3JVKA 5DW2A 5JI8A 4YK0A 4QNSA 4QBMA 5BT4A 1ZKRA 4CUQA 4O7CA 4NS5A 5D25A 4NRBA 5FE1A 5CS8A 5D3RA 5EP7A 4UIUA 5ETBA 2YDWA 5DX4A 4N4GA 4LZSA 4UYDA 5HRXA 5FE2A 5CUDA 4A9KA 3HMFA 4CFLA 4NXJA 5D3SA 5E73A 3LQJA 4YAXA 5J0DA 4QYDA 4YATA 3LQIA 4A9HA 4UITA 5HEMA 4QB3A 3ERRA 4GPJA 5I83A 3P1EA 2FSAA 4CUPA 4MEQA 3SVGA 5A81A 5F1LA 5HRVA 3MXFA 4QSTA 5I1QA 5L96A 4BW3A 4PY6A 4NRCA 4NYXA 3AADA 4MEPA 4J0SA 5EPRA 4TYLA 4NYVA 4IOQA 5FB0A 4NR7A 5A7CA 5LVRA 5AMEA 5CU8A 4TU6A 4AKNA 3IU6A 4NR8A 5ENCA 4YYDA 5EWVA 2DVQA 4O71A 4TZ2A 4HXOA 5HLSA 4YH4A 5KU3A 3U5MA 4CUTA 3VKHA 4QSXA 4IR4A 4IR6A 4NUEA 4YYGA 5DYAA 5CP5A 5FDZA 3G0JA 3QZVA 4QSQA 5EWDA 5D0CA 4Z6HA 4HXPA 4N4HA 5CPEA 5E9YA 4TZ8A 4UYHA 4A9JA 5LVQA 3LQHA 1WUGA 5DFDA 4UYEA 4KCXA 4TT6A 5D7XA 5HRWA 5DW1A 4AKHA 4TQNA 5C8GA 5EQ1A 5DBMA 5KHMA 4CUUA 4BHWA 2DATA 4NR6A 2R10A 5E0RA 4OGIA 5KO4A 2YELA 5FH6A 5LUUA 4PCEA 3K2JA 4WHUA 5CZGA 4N3WA 5LKUA 5EICA 4O7FA 4BW2A 3U5PA 4O72A 4LR6A 5F25A 5A82A 4O76A 4BW1A 4YYNA 3QZSA 5L8UA 4A9MA 4UIWA 5CQ3A 5D3LA 5CUCA 4LZ2A 4WHWA 5KTWA 3UV2A 5CTLA 5DLXA 5H85A 4YBMA 4MR6A 1N72A 2E7OA 3LXJA 5A5NA 4NYWA 2KTBB 5I86A 4BW4A 4PS5A 4UIVA 5FE3A 4QR4A 5C87A 5IG6A 2YYNA 4YBSA 4YYHA 4QY4A 4MENA 4QZSA 4HXSA 1PUOA 2N9GA 5CFWA 3JVMA 4OGJA 3HMHA 5FE7A 4PCIA 2F6NA 5IGMA 2R0YA 5EA1A 3AQAA 5A5SA 2R0SA 5C4QA 3GG3A 4ZW1A 4HXKA 5CRMA 5DFCA 3IU5A 4MR4A 5D3PA 2G4AA 3FKMX 5A5RA 5FFYA 2L85A 4UYFB 3JVLA 4XY8A 4UIYA 1ZS5A 4HBXA 3P5OA 2R0VA 1E6IA 4QSVA 2OSSA 4QUTA 4TT2A 4ZQLA 4QSWA 5IBNA 5L98A 5LKZA 5JWMA 4Z1QA 4XY9A 2YW5A 5A85A 4J0RA 2I8NA 5E7DA 5LKTA 4CUSA 4QR5A 5IGKA 4PTBA 5EU1A 5CY9A 5D3JA 5AD3A 5EGUA 3O33A 3D1DA 4NR4A 3UV5A 5HFQA 5ENGA 4J1PA 5CQ4A 2L5EA 1WUMA 3I3JA 4MEOA 2DKWA 4QUUA 5ACYA 5EWWA 4QEVA 2H60A 5I89A 4Z6IA 2RI7A 4IOOA 5EWHA 3UVWA 4YYIA 5EPSA 3U5JA 1JM4B 1F68A 5FE8A 5CUAA 5E9KA 3SVFA 5F3AA 5L99A 3RCWA 4QEUA 5IIDA 5E74A 4TS8A 5FFVA 3Q2EA 2D82A 4LC2A 4LYWA 5EISA 5I7XA 1EQFA 5L97A 5FG4A 5A5QA 5I40A 4AKGA 3QZTA 5CUBA 2RO1A 4YY6A 4QC3A 2DVRA 5II2A 4O74A 5CQ7A 5CUGA 5FG6A 4QR3A 5EK9A 3O37A 4QSRA 5K29A 2RNYA 3O35A 5D3TA 3S92A 5G4SA 4QEWA 5F2PA 5F63A 5HENA 3UVXA 5FE6A 4O7AA 5CQ5A 5HQ7A 4HXNA 5FH7A
chains in the Genus database with same CATH topology
4A9FA 4NQMA 4YYKA 5FG5A 4LYSA 5DY7A 5ETDA 4O7BA 4XUAA 2YQDA 5EPBA 5IGNA 4CL9A 2OUOA 5F5ZA 4QSSA 4RVRA 3Q2FA 5EI4A 4UYGA 5G4RA 5COIA 3MB4A 4Y03A 4A9EA 5A5OA 3U5OA 4XUBA 5FB1A 4HXLA 4CLBA 4C66A 4A9LA 5KTXA 4Q0NA 5LJ1A 4QSPA 5C7NA 5ENHA 4BJXA 4HXRA 4NR9A 5DFBA 2YEKA 2LSPB 2DWWA 4XYAA 3UV4A 4ALHA 5FBXA 5HELA 5CQ6A 5LKXA 3P1CA 4E96A 4LRGA 5F1HA 5H1UA 5HCLA 5HFRA 5CQAA 3U5LA 2RFJA 4KV1A 5E9LA 5H1TA 4O77A 3UVDA 5D24A 4QSUA 4O78A 5E9MA 5AD2A 4YC9A 4IR5A 2RNXA 5EM3A 3ONIA 4F3IA 5I29A 3P1FA 4OUFA 4NUDA 3MQMA 3SVHA 4ZC9A 3UVYA 5DKDA 4TT4A 4YBTA 5DKHA 5HQ6A 5E3DA 5DYXA 5LJ0A 4MR5A 3S91A 5FH8A 3P1DA 5ENJA 5HM0A 4A9OA 4A9NA 5FE0A 5CUEA 4YADA 4LZRA 2I7KA 4WIVA 5I88A 3U5KA 5E3GA 5D3HA 5F36A 4C67A 4NQNA 3UW9A 5TCMA 5CQTA 3LJWA 5H1VA 4X2IA 5HQ5A 3MUKA 2YEMA 2E3KA 2NXBA 5II1A 4QYLA 4Z93A 4YABA 4ALGA 4DONA 4MR3A 4IORA 4FLPA 5DKCA 5HJCA 4LYIA 1JSPB 4YYJA 4YYMA 3O34A 4CURA 5L8TA 4N4IA 2DVSA 4Q0OA 5F60A 5AMFA 5E9VA 4YY4A 4LDFA 4UIZA 5KTUA 2MJVB 4PKLA 5A83A 5ENBA 2OO1A 2RS9B 3NXBA 5E9IA 4IR3A 2GRCA 5DYUA 5BT3A 3HMEA 2L84A 3MB3A 5I80A 2RNWA 5BT5A 5EVAA 4CFKA 4HBWA 5FE5A 1X0JA 4QC1A 4HBYA 3ZYUA 4N4FA 5EWCA 5D3NA 4TTEA 4O7EA 5A5PA 5FE4A 3D7CA 4A9IA 4YH3A 3DAIA 4TU4A 5TB6A 4NRAA 5CGPA 2E7NA 5CQ8A 4UIXA 2WP1A 4HBVA 4HXMA 4UYFA 3DWYA 5IGLA 3TLPA 3JVJA 4O70A 2F6JA 4KV4A 5D26A 5I7YA 3U5NA 5F62A 5DLZA 5FE9A 5CRZA 4NUCA 5ENIA 5C85A 2DVVA 5ENEA 2WP2A 5LJ2A 5EV9A 2D9EA 5FFWA 5ENFA 4J3IA 3MULA 5DYCA 5C89A 3G0LA 3O36A 4O75A 4Z1SA 4NR5A 5F61A 3JVKA 5DW2A 5JI8A 4YK0A 4QNSA 4QBMA 5BT4A 4CUQA 4O7CA 4NS5A 5D25A 4NRBA 5FE1A 5CS8A 5D3RA 5EP7A 4UIUA 5ETBA 2YDWA 5DX4A 4N4GA 4LZSA 4UYDA 5HRXA 5FE2A 5CUDA 4A9KA 3HMFA 4CFLA 4NXJA 5D3SA 5E73A 3LQJA 4YAXA 5J0DA 4QYDA 4YATA 3LQIA 4A9HA 4UITA 5HEMA 4QB3A 4GPJA 5I83A 3P1EA 2FSAA 4CUPA 4MEQA 3SVGA 5A81A 5F1LA 5HRVA 3MXFA 4QSTA 5I1QA 5L96A 4BW3A 4PY6A 4NRCA 4NYXA 3AADA 4MEPA 4J0SA 5EPRA 4TYLA 4NYVA 4IOQA 5FB0A 4NR7A 5A7CA 5LVRA 5AMEA 5CU8A 4TU6A 4AKNA 3IU6A 4NR8A 5ENCA 4YYDA 5EWVA 2DVQA 4O71A 4TZ2A 4HXOA 5HLSA 4YH4A 5KU3A 3U5MA 4CUTA 4QSXA 4IR4A 4IR6A 4NUEA 4YYGA 5DYAA 5CP5A 5FDZA 3G0JA 3QZVA 4QSQA 5EWDA 5D0CA 4Z6HA 4HXPA 4N4HA 5CPEA 5E9YA 4TZ8A 4UYHA 4A9JA 5LVQA 3LQHA 1WUGA 5DFDA 4UYEA 4KCXA 4TT6A 5D7XA 5HRWA 5DW1A 4TQNA 5C8GA 5EQ1A 5DBMA 5KHMA 4CUUA 4BHWA 2DATA 4NR6A 2R10A 5E0RA 4OGIA 5KO4A 2YELA 5FH6A 5LUUA 4PCEA 3K2JA 4WHUA 5CZGA 4N3WA 5LKUA 5EICA 4O7FA 4BW2A 3U5PA 4O72A 4LR6A 5F25A 5A82A 4O76A 4BW1A 4YYNA 3QZSA 5L8UA 4A9MA 4UIWA 5CQ3A 5D3LA 5CUCA 4LZ2A 4WHWA 5KTWA 3UV2A 5CTLA 5DLXA 5H85A 4YBMA 4MR6A 1N72A 2E7OA 3LXJA 5A5NA 4NYWA 2KTBB 5I86A 4BW4A 4PS5A 4UIVA 5FE3A 4QR4A 5C87A 5IG6A 2YYNA 4YBSA 4YYHA 4QY4A 4MENA 4QZSA 4HXSA 2N9GA 5CFWA 3JVMA 4OGJA 3HMHA 5FE7A 4PCIA 2F6NA 5IGMA 2R0YA 5EA1A 3AQAA 5A5SA 2R0SA 5C4QA 3GG3A 4ZW1A 4HXKA 5CRMA 5DFCA 3IU5A 4MR4A 5D3PA 2G4AA 3FKMX 5A5RA 5FFYA 2L85A 4UYFB 3JVLA 4XY8A 4UIYA 1ZS5A 4HBXA 3P5OA 2R0VA 1E6IA 4QSVA 2OSSA 4QUTA 4TT2A 4ZQLA 4QSWA 5IBNA 5L98A 5LKZA 5JWMA 4Z1QA 4XY9A 2YW5A 5A85A 4J0RA 2I8NA 5E7DA 5LKTA 4CUSA 4QR5A 5IGKA 4PTBA 5EU1A 5CY9A 5D3JA 5AD3A 5EGUA 3O33A 4NR4A 3UV5A 5HFQA 5ENGA 4J1PA 5CQ4A 2L5EA 1WUMA 3I3JA 4MEOA 2DKWA 4QUUA 5ACYA 5EWWA 4QEVA 2H60A 5I89A 4Z6IA 2RI7A 4IOOA 5EWHA 3UVWA 4YYIA 5EPSA 3U5JA 1JM4B 1F68A 5FE8A 5CUAA 5E9KA 3SVFA 5F3AA 5L99A 3RCWA 4QEUA 5IIDA 5E74A 4TS8A 5FFVA 3Q2EA 2D82A 4LC2A 4LYWA 5EISA 5I7XA 1EQFA 5L97A 5FG4A 5A5QA 5I40A 3QZTA 5CUBA 2RO1A 4YY6A 4QC3A 2DVRA 5II2A 4O74A 5CQ7A 5CUGA 5FG6A 4QR3A 5EK9A 3O37A 4QSRA 5K29A 2RNYA 3O35A 5D3TA 3S92A 5G4SA 4QEWA 5F2PA 5F63A 5HENA 3UVXA 5FE6A 4O7AA 5CQ5A 5HQ7A 4HXNA 5FH7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A9F A;  4NQM A;  4YYK A;  5FG5 A;  4LYS A;  5DY7 A;  5ETD A;  4O7B A;  4XUA A;  2YQD A;  5EPB A;  5IGN A;  4CL9 A;  2OUO A;  5F5Z A;  4QSS A;  4RVR A;  3Q2F A;  5EI4 A;  4UYG A;  5G4R A;  5COI A;  3MB4 A;  4Y03 A;  4A9E A;  5A5O A;  3U5O A;  4XUB A;  5FB1 A;  4HXL A;  4CLB A;  4C66 A;  4A9L A;  5KTX A;  4Q0N A;  5LJ1 A;  4QSP A;  5C7N A;  5ENH A;  4BJX A;  4HXR A;  4NR9 A;  5DFB A;  2YEK A;  2LSP B;  2DWW A;  4XYA A;  3UV4 A;  4ALH A;  5FBX A;  5HEL A;  5CQ6 A;  5LKX A;  3P1C A;  4E96 A;  4LRG A;  5F1H A;  5H1U A;  5HCL A;  5HFR A;  5CQA A;  3U5L A;  2RFJ A;  4KV1 A;  5E9L A;  5H1T A;  4O77 A;  3UVD A;  5D24 A;  4QSU A;  4O78 A;  5E9M A;  5AD2 A;  4YC9 A;  4IR5 A;  2RNX A;  5EM3 A;  3ONI A;  4F3I A;  5I29 A;  3P1F A;  4OUF A;  4NUD A;  3MQM A;  3SVH A;  4ZC9 A;  3UVY A;  5DKD A;  4TT4 A;  4YBT A;  5DKH A;  5HQ6 A;  5E3D A;  5DYX A;  5LJ0 A;  4MR5 A;  3S91 A;  5FH8 A;  3P1D A;  5ENJ A;  5HM0 A;  4A9O A;  4A9N A;  5FE0 A;  5CUE A;  4YAD A;  4LZR A;  2I7K A;  4WIV A;  5I88 A;  3U5K A;  5E3G A;  5D3H A;  5F36 A;  4C67 A;  4NQN A;  3UW9 A;  5TCM A;  5CQT A;  3LJW A;  5H1V A;  4X2I A;  5HQ5 A;  3MUK A;  2YEM A;  2E3K A;  2NXB A;  5II1 A;  4QYL A;  4Z93 A;  4YAB A;  4ALG A;  4DON A;  4MR3 A;  4IOR A;  4FLP A;  5DKC A;  5HJC A;  4LYI A;  1JSP B;  4YYJ A;  4YYM A;  3O34 A;  4CUR A;  5L8T A;  4N4I A;  2DVS A;  4Q0O A;  5F60 A;  5AMF A;  5E9V A;  4YY4 A;  4LDF A;  4UIZ A;  5KTU A;  2MJV B;  4PKL A;  5A83 A;  5ENB A;  2OO1 A;  2RS9 B;  3NXB A;  5E9I A;  4IR3 A;  2GRC A;  5DYU A;  5BT3 A;  3HME A;  2L84 A;  3MB3 A;  5I80 A;  2RNW A;  5BT5 A;  5EVA A;  4CFK A;  4HBW A;  5FE5 A;  1X0J A;  4QC1 A;  4HBY A;  3ZYU A;  4N4F A;  5EWC A;  5D3N A;  4TTE A;  4O7E A;  5A5P A;  5FE4 A;  3D7C A;  4A9I A;  4YH3 A;  3DAI A;  4TU4 A;  5TB6 A;  4NRA A;  5CGP A;  2E7N A;  5CQ8 A;  4UIX A;  2WP1 A;  4HBV A;  4HXM A;  4UYF A;  3DWY A;  5IGL A;  3TLP A;  3JVJ A;  4O70 A;  2F6J A;  4KV4 A;  5D26 A;  5I7Y A;  3U5N A;  5F62 A;  5DLZ A;  5FE9 A;  5CRZ A;  4NUC A;  5ENI A;  5C85 A;  2DVV A;  5ENE A;  2WP2 A;  5LJ2 A;  5EV9 A;  2D9E A;  5FFW A;  5ENF A;  4J3I A;  3MUL A;  5DYC A;  5C89 A;  3G0L A;  3O36 A;  4O75 A;  4Z1S A;  4NR5 A;  5F61 A;  3JVK A;  5DW2 A;  5JI8 A;  4YK0 A;  4QNS A;  4QBM A;  5BT4 A;  4CUQ A;  4O7C A;  4NS5 A;  5D25 A;  4NRB A;  5FE1 A;  5CS8 A;  5D3R A;  5EP7 A;  4UIU A;  5ETB A;  2YDW A;  5DX4 A;  4N4G A;  4LZS A;  4UYD A;  5HRX A;  5FE2 A;  5CUD A;  4A9K A;  3HMF A;  4CFL A;  4NXJ A;  5D3S A;  5E73 A;  3LQJ A;  4YAX A;  5J0D A;  4QYD A;  4YAT A;  3LQI A;  4A9H A;  4UIT A;  5HEM A;  4QB3 A;  4GPJ A;  5I83 A;  3P1E A;  2FSA A;  4CUP A;  4MEQ A;  3SVG A;  5A81 A;  5F1L A;  5HRV A;  3MXF A;  4QST A;  5I1Q A;  5L96 A;  4BW3 A;  4PY6 A;  4NRC A;  4NYX A;  3AAD A;  4MEP A;  4J0S A;  5EPR A;  4TYL A;  4NYV A;  4IOQ A;  5FB0 A;  4NR7 A;  5A7C A;  5LVR A;  5AME A;  5CU8 A;  4TU6 A;  4AKN A;  3IU6 A;  4NR8 A;  5ENC A;  4YYD A;  5EWV A;  2DVQ A;  4O71 A;  4TZ2 A;  4HXO A;  5HLS A;  4YH4 A;  5KU3 A;  3U5M A;  4CUT A;  4QSX A;  4IR4 A;  4IR6 A;  4NUE A;  4YYG A;  5DYA A;  5CP5 A;  5FDZ A;  3G0J A;  3QZV A;  4QSQ A;  5EWD A;  5D0C A;  4Z6H A;  4HXP A;  4N4H A;  5CPE A;  5E9Y A;  4TZ8 A;  4UYH A;  4A9J A;  5LVQ A;  3LQH A;  1WUG A;  5DFD A;  4UYE A;  4KCX A;  4TT6 A;  5D7X A;  5HRW A;  5DW1 A;  4TQN A;  5C8G A;  5EQ1 A;  5DBM A;  5KHM A;  4CUU A;  4BHW A;  2DAT A;  4NR6 A;  2R10 A;  5E0R A;  4OGI A;  5KO4 A;  2YEL A;  5FH6 A;  5LUU A;  4PCE A;  3K2J A;  4WHU A;  5CZG A;  4N3W A;  5LKU A;  5EIC A;  4O7F A;  4BW2 A;  3U5P A;  4O72 A;  4LR6 A;  5F25 A;  5A82 A;  4O76 A;  4BW1 A;  4YYN A;  3QZS A;  5L8U A;  4A9M A;  4UIW A;  5CQ3 A;  5D3L A;  5CUC A;  4LZ2 A;  4WHW A;  5KTW A;  3UV2 A;  5CTL A;  5DLX A;  5H85 A;  4YBM A;  4MR6 A;  1N72 A;  2E7O A;  3LXJ A;  5A5N A;  4NYW A;  2KTB B;  5I86 A;  4BW4 A;  4PS5 A;  4UIV A;  5FE3 A;  4QR4 A;  5C87 A;  5IG6 A;  2YYN A;  4YBS A;  4YYH A;  4QY4 A;  4MEN A;  4QZS A;  4HXS A;  2N9G A;  5CFW A;  3JVM A;  4OGJ A;  3HMH A;  5FE7 A;  4PCI A;  2F6N A;  5IGM A;  2R0Y A;  5EA1 A;  3AQA A;  5A5S A;  2R0S A;  5C4Q A;  3GG3 A;  4ZW1 A;  4HXK A;  5CRM A;  5DFC A;  3IU5 A;  4MR4 A;  5D3P A;  2G4A A;  3FKM X;  5A5R A;  5FFY A;  2L85 A;  4UYF B;  3JVL A;  4XY8 A;  4UIY A;  1ZS5 A;  4HBX A;  3P5O A;  2R0V A;  1E6I A;  4QSV A;  2OSS A;  4QUT A;  4TT2 A;  4ZQL A;  4QSW A;  5IBN A;  5L98 A;  5LKZ A;  5JWM A;  4Z1Q A;  4XY9 A;  2YW5 A;  5A85 A;  4J0R A;  2I8N A;  5E7D A;  5LKT A;  4CUS A;  4QR5 A;  5IGK A;  4PTB A;  5EU1 A;  5CY9 A;  5D3J A;  5AD3 A;  5EGU A;  3O33 A;  4NR4 A;  3UV5 A;  5HFQ A;  5ENG A;  4J1P A;  5CQ4 A;  2L5E A;  1WUM A;  3I3J A;  4MEO A;  2DKW A;  4QUU A;  5ACY A;  5EWW A;  4QEV A;  2H60 A;  5I89 A;  4Z6I A;  2RI7 A;  4IOO A;  5EWH A;  3UVW A;  4YYI A;  5EPS A;  3U5J A;  1JM4 B;  1F68 A;  5FE8 A;  5CUA A;  5E9K A;  3SVF A;  5F3A A;  5L99 A;  3RCW A;  4QEU A;  5IID A;  5E74 A;  4TS8 A;  5FFV A;  3Q2E A;  2D82 A;  4LC2 A;  4LYW A;  5EIS A;  5I7X A;  1EQF A;  5L97 A;  5FG4 A;  5A5Q A;  5I40 A;  3QZT A;  5CUB A;  2RO1 A;  4YY6 A;  4QC3 A;  2DVR A;  5II2 A;  4O74 A;  5CQ7 A;  5CUG A;  5FG6 A;  4QR3 A;  5EK9 A;  3O37 A;  4QSR A;  5K29 A;  2RNY A;  3O35 A;  5D3T A;  3S92 A;  5G4S A;  4QEW A;  5F2P A;  5F63 A;  5HEN A;  3UVX A;  5FE6 A;  4O7A A;  5CQ5 A;  5HQ7 A;  4HXN A;  5FH7 A; 
#chains in the Genus database with same CATH topology
 4A9F A;  4AKI A;  4NQM A;  4YYK A;  5FG5 A;  4LYS A;  5DY7 A;  5ETD A;  4O7B A;  4XUA A;  2YQD A;  5EPB A;  5IGN A;  4CL9 A;  2OUO A;  5F5Z A;  4QSS A;  4RVR A;  3Q2F A;  5EI4 A;  4UYG A;  5G4R A;  5COI A;  3MB4 A;  4Y03 A;  4A9E A;  5A5O A;  3U5O A;  4XUB A;  5FB1 A;  4HXL A;  4CLB A;  4C66 A;  4A9L A;  5KTX A;  4Q0N A;  5LJ1 A;  4AI6 A;  4QSP A;  5C7N A;  5ENH A;  4BJX A;  4HXR A;  4NR9 A;  5DFB A;  2YEK A;  2LSP B;  2DWW A;  4XYA A;  3UV4 A;  4ALH A;  5FBX A;  5HEL A;  5CQ6 A;  5LKX A;  3P1C A;  4E96 A;  4LRG A;  5F1H A;  5H1U A;  5HCL A;  5HFR A;  5CQA A;  3U5L A;  2RFJ A;  4KV1 A;  5E9L A;  5H1T A;  4O77 A;  3UVD A;  5D24 A;  4QSU A;  4O78 A;  5E9M A;  5AD2 A;  4YC9 A;  4IR5 A;  3D1B A;  2RNX A;  5EM3 A;  3ONI A;  4F3I A;  5I29 A;  3P1F A;  4OUF A;  4NUD A;  3MQM A;  3SVH A;  4ZC9 A;  3UVY A;  5DKD A;  4TT4 A;  4YBT A;  5DKH A;  5HQ6 A;  5E3D A;  5DYX A;  5LJ0 A;  4MR5 A;  3S91 A;  5FH8 A;  3P1D A;  5ENJ A;  5HM0 A;  4A9O A;  4A9N A;  5FE0 A;  5CUE A;  4YAD A;  4LZR A;  2I7K A;  4WIV A;  5I88 A;  3U5K A;  5E3G A;  5D3H A;  5F36 A;  4C67 A;  4NQN A;  3UW9 A;  5TCM A;  5CQT A;  3LJW A;  5H1V A;  4X2I A;  5HQ5 A;  3MUK A;  2YEM A;  2E3K A;  2NXB A;  5II1 A;  4QYL A;  3VKG A;  4Z93 A;  4YAB A;  4ALG A;  4DON A;  4MR3 A;  4IOR A;  4FLP A;  5DKC A;  5HJC A;  4LYI A;  1JSP B;  4YYJ A;  4YYM A;  3O34 A;  4CUR A;  5L8T A;  4N4I A;  2DVS A;  4Q0O A;  5F60 A;  5AMF A;  5E9V A;  4YY4 A;  4LDF A;  4UIZ A;  5KTU A;  2MJV B;  4PKL A;  5A83 A;  5ENB A;  2OO1 A;  2RS9 B;  3NXB A;  5E9I A;  4IR3 A;  2GRC A;  5DYU A;  5BT3 A;  3HME A;  2L84 A;  3MB3 A;  5I80 A;  2RNW A;  5BT5 A;  5EVA A;  4CFK A;  4HBW A;  5FE5 A;  1X0J A;  4QC1 A;  4HBY A;  3ZYU A;  4N4F A;  5EWC A;  5D3N A;  4TTE A;  4O7E A;  5A5P A;  5FE4 A;  3D7C A;  4A9I A;  4YH3 A;  3DAI A;  4TU4 A;  5TB6 A;  4NRA A;  5CGP A;  2E7N A;  5CQ8 A;  4UIX A;  2WP1 A;  4HBV A;  4HXM A;  4UYF A;  3DWY A;  5IGL A;  3TLP A;  3JVJ A;  4O70 A;  2F6J A;  4KV4 A;  5D26 A;  5I7Y A;  2EJN A;  3U5N A;  5F62 A;  5DLZ A;  5FE9 A;  5CRZ A;  4NUC A;  5ENI A;  5C85 A;  2DVV A;  5ENE A;  2WP2 A;  5LJ2 A;  5EV9 A;  2D9E A;  5FFW A;  5ENF A;  4J3I A;  3MUL A;  5DYC A;  5C89 A;  3G0L A;  3O36 A;  4O75 A;  4Z1S A;  4NR5 A;  5F61 A;  3JVK A;  5DW2 A;  5JI8 A;  4YK0 A;  4QNS A;  4QBM A;  5BT4 A;  1ZKR A;  4CUQ A;  4O7C A;  4NS5 A;  5D25 A;  4NRB A;  5FE1 A;  5CS8 A;  5D3R A;  5EP7 A;  4UIU A;  5ETB A;  2YDW A;  5DX4 A;  4N4G A;  4LZS A;  4UYD A;  5HRX A;  5FE2 A;  5CUD A;  4A9K A;  3HMF A;  4CFL A;  4NXJ A;  5D3S A;  5E73 A;  3LQJ A;  4YAX A;  5J0D A;  4QYD A;  4YAT A;  3LQI A;  4A9H A;  4UIT A;  5HEM A;  4QB3 A;  3ERR A;  4GPJ A;  5I83 A;  3P1E A;  2FSA A;  4CUP A;  4MEQ A;  3SVG A;  5A81 A;  5F1L A;  5HRV A;  3MXF A;  4QST A;  5I1Q A;  5L96 A;  4BW3 A;  4PY6 A;  4NRC A;  4NYX A;  3AAD A;  4MEP A;  4J0S A;  5EPR A;  4TYL A;  4NYV A;  4IOQ A;  5FB0 A;  4NR7 A;  5A7C A;  5LVR A;  5AME A;  5CU8 A;  4TU6 A;  4AKN A;  3IU6 A;  4NR8 A;  5ENC A;  4YYD A;  5EWV A;  2DVQ A;  4O71 A;  4TZ2 A;  4HXO A;  5HLS A;  4YH4 A;  5KU3 A;  3U5M A;  4CUT A;  3VKH A;  4QSX A;  4IR4 A;  4IR6 A;  4NUE A;  4YYG A;  5DYA A;  5CP5 A;  5FDZ A;  3G0J A;  3QZV A;  4QSQ A;  5EWD A;  5D0C A;  4Z6H A;  4HXP A;  4N4H A;  5CPE A;  5E9Y A;  4TZ8 A;  4UYH A;  4A9J A;  5LVQ A;  3LQH A;  1WUG A;  5DFD A;  4UYE A;  4KCX A;  4TT6 A;  5D7X A;  5HRW A;  5DW1 A;  4AKH A;  4TQN A;  5C8G A;  5EQ1 A;  5DBM A;  5KHM A;  4CUU A;  4BHW A;  2DAT A;  4NR6 A;  2R10 A;  5E0R A;  4OGI A;  5KO4 A;  2YEL A;  5FH6 A;  5LUU A;  4PCE A;  3K2J A;  4WHU A;  5CZG A;  4N3W A;  5LKU A;  5EIC A;  4O7F A;  4BW2 A;  3U5P A;  4O72 A;  4LR6 A;  5F25 A;  5A82 A;  4O76 A;  4BW1 A;  4YYN A;  3QZS A;  5L8U A;  4A9M A;  4UIW A;  5CQ3 A;  5D3L A;  5CUC A;  4LZ2 A;  4WHW A;  5KTW A;  3UV2 A;  5CTL A;  5DLX A;  5H85 A;  4YBM A;  4MR6 A;  1N72 A;  2E7O A;  3LXJ A;  5A5N A;  4NYW A;  2KTB B;  5I86 A;  4BW4 A;  4PS5 A;  4UIV A;  5FE3 A;  4QR4 A;  5C87 A;  5IG6 A;  2YYN A;  4YBS A;  4YYH A;  4QY4 A;  4MEN A;  4QZS A;  4HXS A;  1PUO A;  2N9G A;  5CFW A;  3JVM A;  4OGJ A;  3HMH A;  5FE7 A;  4PCI A;  2F6N A;  5IGM A;  2R0Y A;  5EA1 A;  3AQA A;  5A5S A;  2R0S A;  5C4Q A;  3GG3 A;  4ZW1 A;  4HXK A;  5CRM A;  5DFC A;  3IU5 A;  4MR4 A;  5D3P A;  2G4A A;  3FKM X;  5A5R A;  5FFY A;  2L85 A;  4UYF B;  3JVL A;  4XY8 A;  4UIY A;  1ZS5 A;  4HBX A;  3P5O A;  2R0V A;  1E6I A;  4QSV A;  2OSS A;  4QUT A;  4TT2 A;  4ZQL A;  4QSW A;  5IBN A;  5L98 A;  5LKZ A;  5JWM A;  4Z1Q A;  4XY9 A;  2YW5 A;  5A85 A;  4J0R A;  2I8N A;  5E7D A;  5LKT A;  4CUS A;  4QR5 A;  5IGK A;  4PTB A;  5EU1 A;  5CY9 A;  5D3J A;  5AD3 A;  5EGU A;  3O33 A;  3D1D A;  4NR4 A;  3UV5 A;  5HFQ A;  5ENG A;  4J1P A;  5CQ4 A;  2L5E A;  1WUM A;  3I3J A;  4MEO A;  2DKW A;  4QUU A;  5ACY A;  5EWW A;  4QEV A;  2H60 A;  5I89 A;  4Z6I A;  2RI7 A;  4IOO A;  5EWH A;  3UVW A;  4YYI A;  5EPS A;  3U5J A;  1JM4 B;  1F68 A;  5FE8 A;  5CUA A;  5E9K A;  3SVF A;  5F3A A;  5L99 A;  3RCW A;  4QEU A;  5IID A;  5E74 A;  4TS8 A;  5FFV A;  3Q2E A;  2D82 A;  4LC2 A;  4LYW A;  5EIS A;  5I7X A;  1EQF A;  5L97 A;  5FG4 A;  5A5Q A;  5I40 A;  4AKG A;  3QZT A;  5CUB A;  2RO1 A;  4YY6 A;  4QC3 A;  2DVR A;  5II2 A;  4O74 A;  5CQ7 A;  5CUG A;  5FG6 A;  4QR3 A;  5EK9 A;  3O37 A;  4QSR A;  5K29 A;  2RNY A;  3O35 A;  5D3T A;  3S92 A;  5G4S A;  4QEW A;  5F2P A;  5F63 A;  5HEN A;  3UVX A;  5FE6 A;  4O7A A;  5CQ5 A;  5HQ7 A;  4HXN A;  5FH7 A; 
#chains in the Genus database with same CATH homology
 4A9F A;  4NQM A;  4YYK A;  5FG5 A;  4LYS A;  5DY7 A;  5ETD A;  4O7B A;  4XUA A;  2YQD A;  5EPB A;  5IGN A;  4CL9 A;  2OUO A;  5F5Z A;  4QSS A;  4RVR A;  3Q2F A;  5EI4 A;  4UYG A;  5G4R A;  5COI A;  3MB4 A;  4Y03 A;  4A9E A;  5A5O A;  3U5O A;  4XUB A;  5FB1 A;  4HXL A;  4CLB A;  4C66 A;  4A9L A;  5KTX A;  4Q0N A;  5LJ1 A;  4QSP A;  5C7N A;  5ENH A;  4BJX A;  4HXR A;  4NR9 A;  5DFB A;  2YEK A;  2LSP B;  2DWW A;  4XYA A;  3UV4 A;  4ALH A;  5FBX A;  5HEL A;  5CQ6 A;  5LKX A;  3P1C A;  4E96 A;  4LRG A;  5F1H A;  5H1U A;  5HCL A;  5HFR A;  5CQA A;  3U5L A;  2RFJ A;  4KV1 A;  5E9L A;  5H1T A;  4O77 A;  3UVD A;  5D24 A;  4QSU A;  4O78 A;  5E9M A;  5AD2 A;  4YC9 A;  4IR5 A;  2RNX A;  5EM3 A;  3ONI A;  4F3I A;  5I29 A;  3P1F A;  4OUF A;  4NUD A;  3MQM A;  3SVH A;  4ZC9 A;  3UVY A;  5DKD A;  4TT4 A;  4YBT A;  5DKH A;  5HQ6 A;  5E3D A;  5DYX A;  5LJ0 A;  4MR5 A;  3S91 A;  5FH8 A;  3P1D A;  5ENJ A;  5HM0 A;  4A9O A;  4A9N A;  5FE0 A;  5CUE A;  4YAD A;  4LZR A;  2I7K A;  4WIV A;  5I88 A;  3U5K A;  5E3G A;  5D3H A;  5F36 A;  4C67 A;  4NQN A;  3UW9 A;  5TCM A;  5CQT A;  3LJW A;  5H1V A;  4X2I A;  5HQ5 A;  3MUK A;  2YEM A;  2E3K A;  2NXB A;  5II1 A;  4QYL A;  4Z93 A;  4YAB A;  4ALG A;  4DON A;  4MR3 A;  4IOR A;  4FLP A;  5DKC A;  5HJC A;  4LYI A;  1JSP B;  4YYJ A;  4YYM A;  3O34 A;  4CUR A;  5L8T A;  4N4I A;  2DVS A;  4Q0O A;  5F60 A;  5AMF A;  5E9V A;  4YY4 A;  4LDF A;  4UIZ A;  5KTU A;  2MJV B;  4PKL A;  5A83 A;  5ENB A;  2OO1 A;  2RS9 B;  3NXB A;  5E9I A;  4IR3 A;  2GRC A;  5DYU A;  5BT3 A;  3HME A;  2L84 A;  3MB3 A;  5I80 A;  2RNW A;  5BT5 A;  5EVA A;  4CFK A;  4HBW A;  5FE5 A;  1X0J A;  4QC1 A;  4HBY A;  3ZYU A;  4N4F A;  5EWC A;  5D3N A;  4TTE A;  4O7E A;  5A5P A;  5FE4 A;  3D7C A;  4A9I A;  4YH3 A;  3DAI A;  4TU4 A;  5TB6 A;  4NRA A;  5CGP A;  2E7N A;  5CQ8 A;  4UIX A;  2WP1 A;  4HBV A;  4HXM A;  4UYF A;  3DWY A;  5IGL A;  3TLP A;  3JVJ A;  4O70 A;  2F6J A;  4KV4 A;  5D26 A;  5I7Y A;  3U5N A;  5F62 A;  5DLZ A;  5FE9 A;  5CRZ A;  4NUC A;  5ENI A;  5C85 A;  2DVV A;  5ENE A;  2WP2 A;  5LJ2 A;  5EV9 A;  2D9E A;  5FFW A;  5ENF A;  4J3I A;  3MUL A;  5DYC A;  5C89 A;  3G0L A;  3O36 A;  4O75 A;  4Z1S A;  4NR5 A;  5F61 A;  3JVK A;  5DW2 A;  5JI8 A;  4YK0 A;  4QNS A;  4QBM A;  5BT4 A;  4CUQ A;  4O7C A;  4NS5 A;  5D25 A;  4NRB A;  5FE1 A;  5CS8 A;  5D3R A;  5EP7 A;  4UIU A;  5ETB A;  2YDW A;  5DX4 A;  4N4G A;  4LZS A;  4UYD A;  5HRX A;  5FE2 A;  5CUD A;  4A9K A;  3HMF A;  4CFL A;  4NXJ A;  5D3S A;  5E73 A;  3LQJ A;  4YAX A;  5J0D A;  4QYD A;  4YAT A;  3LQI A;  4A9H A;  4UIT A;  5HEM A;  4QB3 A;  4GPJ A;  5I83 A;  3P1E A;  2FSA A;  4CUP A;  4MEQ A;  3SVG A;  5A81 A;  5F1L A;  5HRV A;  3MXF A;  4QST A;  5I1Q A;  5L96 A;  4BW3 A;  4PY6 A;  4NRC A;  4NYX A;  3AAD A;  4MEP A;  4J0S A;  5EPR A;  4TYL A;  4NYV A;  4IOQ A;  5FB0 A;  4NR7 A;  5A7C A;  5LVR A;  5AME A;  5CU8 A;  4TU6 A;  4AKN A;  3IU6 A;  4NR8 A;  5ENC A;  4YYD A;  5EWV A;  2DVQ A;  4O71 A;  4TZ2 A;  4HXO A;  5HLS A;  4YH4 A;  5KU3 A;  3U5M A;  4CUT A;  4QSX A;  4IR4 A;  4IR6 A;  4NUE A;  4YYG A;  5DYA A;  5CP5 A;  5FDZ A;  3G0J A;  3QZV A;  4QSQ A;  5EWD A;  5D0C A;  4Z6H A;  4HXP A;  4N4H A;  5CPE A;  5E9Y A;  4TZ8 A;  4UYH A;  4A9J A;  5LVQ A;  3LQH A;  1WUG A;  5DFD A;  4UYE A;  4KCX A;  4TT6 A;  5D7X A;  5HRW A;  5DW1 A;  4TQN A;  5C8G A;  5EQ1 A;  5DBM A;  5KHM A;  4CUU A;  4BHW A;  2DAT A;  4NR6 A;  2R10 A;  5E0R A;  4OGI A;  5KO4 A;  2YEL A;  5FH6 A;  5LUU A;  4PCE A;  3K2J A;  4WHU A;  5CZG A;  4N3W A;  5LKU A;  5EIC A;  4O7F A;  4BW2 A;  3U5P A;  4O72 A;  4LR6 A;  5F25 A;  5A82 A;  4O76 A;  4BW1 A;  4YYN A;  3QZS A;  5L8U A;  4A9M A;  4UIW A;  5CQ3 A;  5D3L A;  5CUC A;  4LZ2 A;  4WHW A;  5KTW A;  3UV2 A;  5CTL A;  5DLX A;  5H85 A;  4YBM A;  4MR6 A;  1N72 A;  2E7O A;  3LXJ A;  5A5N A;  4NYW A;  2KTB B;  5I86 A;  4BW4 A;  4PS5 A;  4UIV A;  5FE3 A;  4QR4 A;  5C87 A;  5IG6 A;  2YYN A;  4YBS A;  4YYH A;  4QY4 A;  4MEN A;  4QZS A;  4HXS A;  2N9G A;  5CFW A;  3JVM A;  4OGJ A;  3HMH A;  5FE7 A;  4PCI A;  2F6N A;  5IGM A;  2R0Y A;  5EA1 A;  3AQA A;  5A5S A;  2R0S A;  5C4Q A;  3GG3 A;  4ZW1 A;  4HXK A;  5CRM A;  5DFC A;  3IU5 A;  4MR4 A;  5D3P A;  2G4A A;  3FKM X;  5A5R A;  5FFY A;  2L85 A;  4UYF B;  3JVL A;  4XY8 A;  4UIY A;  1ZS5 A;  4HBX A;  3P5O A;  2R0V A;  1E6I A;  4QSV A;  2OSS A;  4QUT A;  4TT2 A;  4ZQL A;  4QSW A;  5IBN A;  5L98 A;  5LKZ A;  5JWM A;  4Z1Q A;  4XY9 A;  2YW5 A;  5A85 A;  4J0R A;  2I8N A;  5E7D A;  5LKT A;  4CUS A;  4QR5 A;  5IGK A;  4PTB A;  5EU1 A;  5CY9 A;  5D3J A;  5AD3 A;  5EGU A;  3O33 A;  4NR4 A;  3UV5 A;  5HFQ A;  5ENG A;  4J1P A;  5CQ4 A;  2L5E A;  1WUM A;  3I3J A;  4MEO A;  2DKW A;  4QUU A;  5ACY A;  5EWW A;  4QEV A;  2H60 A;  5I89 A;  4Z6I A;  2RI7 A;  4IOO A;  5EWH A;  3UVW A;  4YYI A;  5EPS A;  3U5J A;  1JM4 B;  1F68 A;  5FE8 A;  5CUA A;  5E9K A;  3SVF A;  5F3A A;  5L99 A;  3RCW A;  4QEU A;  5IID A;  5E74 A;  4TS8 A;  5FFV A;  3Q2E A;  2D82 A;  4LC2 A;  4LYW A;  5EIS A;  5I7X A;  1EQF A;  5L97 A;  5FG4 A;  5A5Q A;  5I40 A;  3QZT A;  5CUB A;  2RO1 A;  4YY6 A;  4QC3 A;  2DVR A;  5II2 A;  4O74 A;  5CQ7 A;  5CUG A;  5FG6 A;  4QR3 A;  5EK9 A;  3O37 A;  4QSR A;  5K29 A;  2RNY A;  3O35 A;  5D3T A;  3S92 A;  5G4S A;  4QEW A;  5F2P A;  5F63 A;  5HEN A;  3UVX A;  5FE6 A;  4O7A A;  5CQ5 A;  5HQ7 A;  4HXN A;  5FH7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...