2YDWA

Crystal structure of the first bromodomain of human brd2 with the inhibitor gw841819x
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
107
structure length
107
Chain Sequence
TNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKIFLQKVASMPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nuclear protein
molecule keywords BROMODOMAIN-CONTAINING PROTEIN 2
publication title Discovery and Characterization of Small Molecule Inhibitors of the Bet Family Bromodomains.
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 107
sequence length 107
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2ydwA00
4ZW1A 5DX4A 4NUEA 4NR6A 5EP7A 4QUUA 2N9GA 4QNSA 4XY8A 3UVXA 2R0YA 4IOQA 4NS5A 5ETBA 5E0RA 5FG5A 5HEMA 3JVKA 2L85A 5DYAA 5A7CA 5EISA 5EWHA 5F2PA 4LRGA 5L8UA 5ETDA 3P5OA 2OSSA 5CPEA 5D25A 5F1HA 2GRCA 4HBVA 4LZSA 4UIVA 5KHMA 2WP2A 3G0LA 4A9HA 5H1UA 4NQMA 4A9NA 5E7DA 2E7NA 5EPSA 5FFYA 5ENFA 4YK0A 4CFLA 4YYGA 3UVDA 4YY4A 3FKMX 4NYVA 2D9EA 4TU6A 5ENCA 5L99A 4MEQA 5LKTA 5IBNA 5FH6A 5HFQA 4QSVA 5HRXA 5G4SA 5CUAA 5HM0A 4LZ2A 3U5LA 4UYFA 5FDZA 5CRMA 5ENEA 5IGKA 4WHWA 4YYMA 4QC1A 5JWMA 4MEPA 4TZ2A 4NRCA 2YEKA 3UV2A 1E6IA 3G0JA 3O36A 5ENIA 4HXPA 5CUCA 4HBYA 4UYGA 5DBMA 5E3GA 5I7YA 3P1FA 3QZVA 4A9OA 4YYDA 5DW2A 4Z1QA 4BW2A 5L97A 4PTBA 4IR5A 5A82A 4NYXA 4N4IA 4N4FA 5DLXA 5KO4A 5F25A 4NR8A 4O7CA 4QBMA 4BW4A 5CQ3A 5CQ8A 4DONA 5AMFA 5D3RA 2YW5A 2E3KA 3MULA 2I8NA 4J0SA 3O35A 2YYNA 3U5NA 5E9VA 4HBWA 4PS5A 3O33A 4QSSA 2DVQA 4O77A 5EWCA 4BW3A 4QEVA 4Z93A 4KV1A 4HXRA 4QY4A 2H60A 4LYIA 4PKLA 4O7FA 4YYIA 4ZQLA 4NUCA 5ENBA 4BW1A 4QYDA 3D7CA 4O75A 4N4GA 5FE3A 5LKXA 2RFJA 5D7XA 5LJ2A 5AMEA 3ZYUA 3U5JA 5EPRA 5K29A 4CUQA 2YEMA 5ENGA 2OO1A 4A9EA 4KCXA 4QUTA 4Z6HA 4MR4A 4CUPA 4BJXA 2G4AA 5D3JA 4KV4A 1N72A 4NR9A 4O70A 5II2A 4QSTA 4LYSA 4NR5A 5D3PA 4C66A 3SVGA 4XUAA 4UIWA 5FH8A 4NRBA 4MR6A 4N4HA 4YY6A 5FE6A 5I83A 5LKUA 4QB3A 4J3IA 3ONIA 5F62A 4NXJA 4QC3A 3I3JA 4PCIA 3LXJA 3UV4A 3Q2EA 2D82A 3JVMA 5D3LA 5TB6A 5FG6A 5FH7A 4ALGA 5EVAA 1F68A 2L84A 4CLBA 3HMEA 5EU1A 3U5KA 1EQFA 5EWDA 4Z1SA 1JM4B 5L96A 5CRZA 4PY6A 5CUBA 2L5EA 4IR4A 5A85A 5BT5A 4CUTA 4E96A 5EPBA 5FE1A 5ENHA 5HJCA 2DVRA 3K2JA 4GPJA 5C89A 4QSRA 5F61A 4O7BA 5JI8A 5I89A 5AD3A 2R0VA 5HQ6A 4PCEA 5DKHA 5A5OA 3UV5A 5F63A 4WHUA 5EV9A 1JSPB 5HQ7A 5CQAA 5I7XA 5HRWA 3MB3A 5DY7A 3IU6A 5FBXA 4MR5A 5KTWA 4YYKA 2R10A 4FLPA 4YATA 5FB0A 3AADA 5IGMA 4A9LA 5EI4A 4Y03A 5E9IA 2DATA 4QEUA 4UIZA 5I88A 5KTXA 4HXNA 4CURA 4YBSA 5ACYA 5IGNA 5CUDA 3SVHA 2I7KA 4HXMA 4LC2A 5E9KA 2MJVB 3LQHA 5C85A 5D0CA 5A5SA 5LJ0A 4LDFA 1ZS5A 1WUMA 5HCLA 5HQ5A 5D26A 2RO1A 5E74A 4RVRA 2LSPB 3UW9A 3MQMA 3MB4A 5E9LA 4IORA 2DVSA 4NQNA 4LYWA 5F3AA 5FB1A 5LKZA 4ALHA 4Q0NA 3HMHA 5I29A 2FSAA 3GG3A 4O7AA 4AKNA 4QSXA 4TZ8A 2WP1A 5G4RA 5DYUA 3TLPA 4O71A 5A83A 4UIUA 3U5OA 4Z6IA 4QSPA 2RNXA 5HLSA 5L98A 5FE0A 2DKWA 3U5MA 4IR3A 4XYAA 5EWVA 4YABA 4BHWA 4O72A 5LJ1A 5TCMA 2F6NA 4YYHA 5CY9A 2OUOA 5ENJA 5CQTA 5CFWA 4MEOA 4IR6A 5CQ7A 4TT2A 4QSUA 4OGIA 5LVRA 4NRAA 5CUGA 3LQIA 3S91A 4F3IA 2E7OA 4ZC9A 3DAIA 5CQ4A 3HMFA 4OGJA 4OUFA 3U5PA 4TS8A 5A5PA 3AQAA 5F36A 4N3WA 3P1EA 2DVVA 4QR5A 5CZGA 5D3SA 4CUSA 4LR6A 5DKCA 5EWWA 4Q0OA 5FFVA 5D24A 5EGUA 3O37A 2RNWA 5I1QA 3LQJA 5EICA 5HENA 1X0JA 5EQ1A 5FFWA 4C67A 5CQ6A 4YYNA 4A9IA 3UVWA 4A9FA 5COIA 5E9YA 5D3HA 5LUUA 4YAXA 5L8TA 4HXOA 2RNYA 3LJWA 5D3NA 4HXSA 5EM3A 4NYWA 1WUGA 2DWWA 5CQ5A 5H1VA 4O74A 3RCWA 3QZTA 5FE5A 4NR4A 5E3DA 4QSWA 5DFDA 3O34A 4UIYA 4NUDA 5I86A 2R0SA 3UVYA 5HELA 4YBTA 4WIVA 5DLZA 3SVFA 3QZSA 4QSQA 5KTUA 3MXFA 5H85A 4UYHA 3NXBA 4QEWA 2NXBA 2YELA 5AD2A 5FE7A 4MR3A 5CTLA 4J0RA 4QYLA 5A81A 4YH3A 5FE2A 5A5RA 5CUEA 5C4QA 4A9KA 5DW1A 4X2IA 4J1PA 4YADA 5IG6A 3DWYA 4UIXA 5EK9A 4TTEA 5BT4A 5C87A 4CFKA 4QR4A 5CGPA 3MUKA 3IU5A 4QZSA 4UYDA 5F60A 5C8GA 4TT6A 5I80A 4UYFB 2RI7A 5C7NA 4NR7A 4UYEA 4XUBA 5HFRA 5DYCA 4QR3A 5HRVA 4CL9A 3P1CA 3S92A 3P1DA 4O78A 3JVJA 5E73A 5F5ZA 4HXKA 3JVLA 5FE9A 5BT3A 5DKDA 5F1LA 2KTBB 5KU3A 4LZRA 4TYLA 2RS9B 4O76A 2F6JA 5E9MA 5CU8A 5II1A 4IOOA 5I40A 2YQDA 4MENA 5CS8A 4YC9A 5DFBA 5DYXA 5CP5A 3Q2FA 4YH4A 5FG4A 5D3TA 5A5QA 4A9MA 4UITA 4YYJA 5H1TA 4YBMA 5A5NA 4XY9A 5DFCA 4CUUA 5FE8A 4TT4A 5J0DA 4TQNA 4TU4A 5LVQA 5IIDA 4HXLA 5FE4A 5IGLA 4O7EA 2YDWA 4A9JA 4HBXA 5EA1A
chains in the Genus database with same CATH superfamily
4ZW1A 5DX4A 4NUEA 4NR6A 5EP7A 4QUUA 2N9GA 4QNSA 4XY8A 3UVXA 2R0YA 4IOQA 4NS5A 5ETBA 5E0RA 5FG5A 5HEMA 3JVKA 2L85A 5DYAA 5A7CA 5EISA 5EWHA 5F2PA 4LRGA 5L8UA 5ETDA 3P5OA 2OSSA 5CPEA 5D25A 5F1HA 2GRCA 4HBVA 4LZSA 4UIVA 5KHMA 2WP2A 3G0LA 4A9HA 5H1UA 4NQMA 4A9NA 5E7DA 2E7NA 5EPSA 5FFYA 3VKGA 5ENFA 4YK0A 4CFLA 4YYGA 3UVDA 4YY4A 3FKMX 4NYVA 2D9EA 4TU6A 5ENCA 5L99A 4MEQA 1ZKRA 5LKTA 5IBNA 5FH6A 5HFQA 4QSVA 5HRXA 5G4SA 5CUAA 5HM0A 4LZ2A 3U5LA 4UYFA 5FDZA 5CRMA 5ENEA 5IGKA 4WHWA 4YYMA 4QC1A 5JWMA 4MEPA 4TZ2A 4NRCA 2YEKA 3UV2A 1E6IA 3G0JA 3O36A 5ENIA 4HXPA 5CUCA 4HBYA 4UYGA 5DBMA 5E3GA 5I7YA 3P1FA 3QZVA 4A9OA 4YYDA 5DW2A 4Z1QA 4BW2A 5L97A 4PTBA 4IR5A 5A82A 4NYXA 4N4IA 4N4FA 5DLXA 5KO4A 5F25A 4NR8A 4O7CA 4QBMA 3D1BA 4BW4A 5CQ3A 5CQ8A 4DONA 5AMFA 5D3RA 2YW5A 2E3KA 3MULA 2I8NA 4J0SA 3O35A 2YYNA 3U5NA 5E9VA 4HBWA 4PS5A 3O33A 4QSSA 2DVQA 4O77A 5EWCA 4BW3A 4QEVA 4Z93A 4KV1A 4HXRA 4QY4A 2H60A 4LYIA 4PKLA 4O7FA 4YYIA 4ZQLA 4NUCA 5ENBA 4BW1A 4QYDA 3D7CA 4O75A 4N4GA 5FE3A 5LKXA 2RFJA 5D7XA 5LJ2A 5AMEA 3ZYUA 3U5JA 5EPRA 5K29A 4CUQA 2YEMA 5ENGA 2OO1A 4A9EA 4KCXA 4QUTA 4Z6HA 4MR4A 4AKHA 4CUPA 4BJXA 2G4AA 5D3JA 4KV4A 1N72A 4NR9A 4O70A 5II2A 4QSTA 4LYSA 4NR5A 5D3PA 4C66A 3SVGA 1PUOA 4XUAA 4UIWA 5FH8A 4NRBA 4MR6A 4N4HA 4YY6A 5FE6A 5I83A 5LKUA 4QB3A 4J3IA 3ONIA 5F62A 4NXJA 4QC3A 3I3JA 4PCIA 3LXJA 3UV4A 3Q2EA 2D82A 3JVMA 5D3LA 5TB6A 5FG6A 5FH7A 4ALGA 5EVAA 1F68A 2L84A 4CLBA 3HMEA 5EU1A 3U5KA 1EQFA 5EWDA 4Z1SA 1JM4B 5L96A 5CRZA 4PY6A 5CUBA 2L5EA 4IR4A 5A85A 5BT5A 4CUTA 4E96A 5EPBA 5FE1A 5ENHA 5HJCA 2DVRA 3K2JA 4GPJA 5C89A 4QSRA 5F61A 4O7BA 5JI8A 5I89A 5AD3A 2R0VA 5HQ6A 4PCEA 5DKHA 5A5OA 3UV5A 5F63A 4WHUA 5EV9A 1JSPB 5HQ7A 5CQAA 5I7XA 4AKGA 5HRWA 3MB3A 5DY7A 3IU6A 5FBXA 4MR5A 5KTWA 4YYKA 2R10A 4FLPA 4YATA 5FB0A 3AADA 5IGMA 4A9LA 5EI4A 4Y03A 5E9IA 2DATA 4QEUA 4UIZA 5I88A 5KTXA 4HXNA 4CURA 4YBSA 5ACYA 5IGNA 5CUDA 3SVHA 2I7KA 4HXMA 4LC2A 5E9KA 2MJVB 3LQHA 5C85A 5D0CA 5A5SA 5LJ0A 4LDFA 1ZS5A 1WUMA 5HCLA 5HQ5A 5D26A 2RO1A 5E74A 4RVRA 2LSPB 3UW9A 3MQMA 3MB4A 5E9LA 4IORA 2DVSA 4NQNA 4LYWA 5F3AA 5FB1A 5LKZA 4ALHA 4Q0NA 3HMHA 5I29A 2FSAA 3GG3A 4O7AA 4AKNA 4QSXA 4TZ8A 2WP1A 5G4RA 5DYUA 3TLPA 4O71A 5A83A 4UIUA 3U5OA 4Z6IA 4QSPA 2RNXA 5HLSA 5L98A 5FE0A 2DKWA 3U5MA 4IR3A 4XYAA 5EWVA 4YABA 4BHWA 4O72A 5LJ1A 5TCMA 2F6NA 4YYHA 5CY9A 2OUOA 5ENJA 5CQTA 5CFWA 4MEOA 4IR6A 5CQ7A 4TT2A 4QSUA 4OGIA 5LVRA 4NRAA 5CUGA 3LQIA 3S91A 4F3IA 2E7OA 4ZC9A 3DAIA 5CQ4A 3HMFA 4OGJA 4OUFA 3U5PA 4TS8A 4AKIA 5A5PA 3AQAA 5F36A 4N3WA 3P1EA 2DVVA 4QR5A 5CZGA 5D3SA 3D1DA 4CUSA 4LR6A 5DKCA 5EWWA 4Q0OA 5FFVA 5D24A 5EGUA 3O37A 2RNWA 5I1QA 3LQJA 5EICA 5HENA 1X0JA 5EQ1A 5FFWA 4C67A 5CQ6A 4YYNA 4A9IA 3UVWA 4A9FA 4AI6A 5COIA 5E9YA 5D3HA 5LUUA 4YAXA 5L8TA 4HXOA 2RNYA 3LJWA 5D3NA 4HXSA 5EM3A 4NYWA 1WUGA 2DWWA 5CQ5A 5H1VA 4O74A 3RCWA 3QZTA 5FE5A 4NR4A 5E3DA 4QSWA 5DFDA 3O34A 4UIYA 4NUDA 5I86A 2R0SA 3UVYA 5HELA 4YBTA 4WIVA 5DLZA 3SVFA 3QZSA 4QSQA 5KTUA 3MXFA 5H85A 4UYHA 3NXBA 4QEWA 3ERRA 2NXBA 2YELA 5AD2A 5FE7A 4MR3A 5CTLA 4J0RA 4QYLA 5A81A 4YH3A 5FE2A 5A5RA 5CUEA 5C4QA 4A9KA 5DW1A 4X2IA 4J1PA 4YADA 5IG6A 3DWYA 4UIXA 5EK9A 4TTEA 5BT4A 5C87A 4CFKA 4QR4A 5CGPA 3MUKA 3IU5A 4QZSA 4UYDA 5F60A 5C8GA 4TT6A 5I80A 4UYFB 2RI7A 5C7NA 4NR7A 4UYEA 4XUBA 5HFRA 5DYCA 4QR3A 5HRVA 4CL9A 3P1CA 3S92A 3P1DA 4O78A 3JVJA 5E73A 3VKHA 5F5ZA 4HXKA 3JVLA 5FE9A 5BT3A 5DKDA 5F1LA 2KTBB 5KU3A 4LZRA 4TYLA 2RS9B 4O76A 2F6JA 5E9MA 5CU8A 5II1A 4IOOA 5I40A 2YQDA 4MENA 5CS8A 4YC9A 5DFBA 5DYXA 5CP5A 3Q2FA 4YH4A 5FG4A 5D3TA 5A5QA 4A9MA 4UITA 2EJNA 4YYJA 5H1TA 4YBMA 5A5NA 4XY9A 5DFCA 4CUUA 5FE8A 4TT4A 5J0DA 4TQNA 4TU4A 5LVQA 5IIDA 4HXLA 5FE4A 5IGLA 4O7EA 2YDWA 4A9JA 4HBXA 5EA1A
chains in the Genus database with same CATH topology
4ZW1A 5DX4A 4NUEA 4NR6A 5EP7A 4QUUA 2N9GA 4QNSA 4XY8A 3UVXA 2R0YA 4IOQA 4NS5A 5ETBA 5E0RA 5FG5A 5HEMA 3JVKA 2L85A 5DYAA 5A7CA 5EISA 5EWHA 5F2PA 4LRGA 5L8UA 5ETDA 3P5OA 2OSSA 5CPEA 5D25A 5F1HA 2GRCA 4HBVA 4LZSA 4UIVA 5KHMA 2WP2A 3G0LA 4A9HA 5H1UA 4NQMA 4A9NA 5E7DA 2E7NA 5EPSA 5FFYA 5ENFA 4YK0A 4CFLA 4YYGA 3UVDA 4YY4A 3FKMX 4NYVA 2D9EA 4TU6A 5ENCA 5L99A 4MEQA 5LKTA 5IBNA 5FH6A 5HFQA 4QSVA 5HRXA 5G4SA 5CUAA 5HM0A 4LZ2A 3U5LA 4UYFA 5FDZA 5CRMA 5ENEA 5IGKA 4WHWA 4YYMA 4QC1A 5JWMA 4MEPA 4TZ2A 4NRCA 2YEKA 3UV2A 1E6IA 3G0JA 3O36A 5ENIA 4HXPA 5CUCA 4HBYA 4UYGA 5DBMA 5E3GA 5I7YA 3P1FA 3QZVA 4A9OA 4YYDA 5DW2A 4Z1QA 4BW2A 5L97A 4PTBA 4IR5A 5A82A 4NYXA 4N4IA 4N4FA 5DLXA 5KO4A 5F25A 4NR8A 4O7CA 4QBMA 4BW4A 5CQ3A 5CQ8A 4DONA 5AMFA 5D3RA 2YW5A 2E3KA 3MULA 2I8NA 4J0SA 3O35A 2YYNA 3U5NA 5E9VA 4HBWA 4PS5A 3O33A 4QSSA 2DVQA 4O77A 5EWCA 4BW3A 4QEVA 4Z93A 4KV1A 4HXRA 4QY4A 2H60A 4LYIA 4PKLA 4O7FA 4YYIA 4ZQLA 4NUCA 5ENBA 4BW1A 4QYDA 3D7CA 4O75A 4N4GA 5FE3A 5LKXA 2RFJA 5D7XA 5LJ2A 5AMEA 3ZYUA 3U5JA 5EPRA 5K29A 4CUQA 2YEMA 5ENGA 2OO1A 4A9EA 4KCXA 4QUTA 4Z6HA 4MR4A 4CUPA 4BJXA 2G4AA 5D3JA 4KV4A 1N72A 4NR9A 4O70A 5II2A 4QSTA 4LYSA 4NR5A 5D3PA 4C66A 3SVGA 4XUAA 4UIWA 5FH8A 4NRBA 4MR6A 4N4HA 4YY6A 5FE6A 5I83A 5LKUA 4QB3A 4J3IA 3ONIA 5F62A 4NXJA 4QC3A 3I3JA 4PCIA 3LXJA 3UV4A 3Q2EA 2D82A 3JVMA 5D3LA 5TB6A 5FG6A 5FH7A 4ALGA 5EVAA 1F68A 2L84A 4CLBA 3HMEA 5EU1A 3U5KA 1EQFA 5EWDA 4Z1SA 1JM4B 5L96A 5CRZA 4PY6A 5CUBA 2L5EA 4IR4A 5A85A 5BT5A 4CUTA 4E96A 5EPBA 5FE1A 5ENHA 5HJCA 2DVRA 3K2JA 4GPJA 5C89A 4QSRA 5F61A 4O7BA 5JI8A 5I89A 5AD3A 2R0VA 5HQ6A 4PCEA 5DKHA 5A5OA 3UV5A 5F63A 4WHUA 5EV9A 1JSPB 5HQ7A 5CQAA 5I7XA 5HRWA 3MB3A 5DY7A 3IU6A 5FBXA 4MR5A 5KTWA 4YYKA 2R10A 4FLPA 4YATA 5FB0A 3AADA 5IGMA 4A9LA 5EI4A 4Y03A 5E9IA 2DATA 4QEUA 4UIZA 5I88A 5KTXA 4HXNA 4CURA 4YBSA 5ACYA 5IGNA 5CUDA 3SVHA 2I7KA 4HXMA 4LC2A 5E9KA 2MJVB 3LQHA 5C85A 5D0CA 5A5SA 5LJ0A 4LDFA 1ZS5A 1WUMA 5HCLA 5HQ5A 5D26A 2RO1A 5E74A 4RVRA 2LSPB 3UW9A 3MQMA 3MB4A 5E9LA 4IORA 2DVSA 4NQNA 4LYWA 5F3AA 5FB1A 5LKZA 4ALHA 4Q0NA 3HMHA 5I29A 2FSAA 3GG3A 4O7AA 4AKNA 4QSXA 4TZ8A 2WP1A 5G4RA 5DYUA 3TLPA 4O71A 5A83A 4UIUA 3U5OA 4Z6IA 4QSPA 2RNXA 5HLSA 5L98A 5FE0A 2DKWA 3U5MA 4IR3A 4XYAA 5EWVA 4YABA 4BHWA 4O72A 5LJ1A 5TCMA 2F6NA 4YYHA 5CY9A 2OUOA 5ENJA 5CQTA 5CFWA 4MEOA 4IR6A 5CQ7A 4TT2A 4QSUA 4OGIA 5LVRA 4NRAA 5CUGA 3LQIA 3S91A 4F3IA 2E7OA 4ZC9A 3DAIA 5CQ4A 3HMFA 4OGJA 4OUFA 3U5PA 4TS8A 5A5PA 3AQAA 5F36A 4N3WA 3P1EA 2DVVA 4QR5A 5CZGA 5D3SA 4CUSA 4LR6A 5DKCA 5EWWA 4Q0OA 5FFVA 5D24A 5EGUA 3O37A 2RNWA 5I1QA 3LQJA 5EICA 5HENA 1X0JA 5EQ1A 5FFWA 4C67A 5CQ6A 4YYNA 4A9IA 3UVWA 4A9FA 5COIA 5E9YA 5D3HA 5LUUA 4YAXA 5L8TA 4HXOA 2RNYA 3LJWA 5D3NA 4HXSA 5EM3A 4NYWA 1WUGA 2DWWA 5CQ5A 5H1VA 4O74A 3RCWA 3QZTA 5FE5A 4NR4A 5E3DA 4QSWA 5DFDA 3O34A 4UIYA 4NUDA 5I86A 2R0SA 3UVYA 5HELA 4YBTA 4WIVA 5DLZA 3SVFA 3QZSA 4QSQA 5KTUA 3MXFA 5H85A 4UYHA 3NXBA 4QEWA 2NXBA 2YELA 5AD2A 5FE7A 4MR3A 5CTLA 4J0RA 4QYLA 5A81A 4YH3A 5FE2A 5A5RA 5CUEA 5C4QA 4A9KA 5DW1A 4X2IA 4J1PA 4YADA 5IG6A 3DWYA 4UIXA 5EK9A 4TTEA 5BT4A 5C87A 4CFKA 4QR4A 5CGPA 3MUKA 3IU5A 4QZSA 4UYDA 5F60A 5C8GA 4TT6A 5I80A 4UYFB 2RI7A 5C7NA 4NR7A 4UYEA 4XUBA 5HFRA 5DYCA 4QR3A 5HRVA 4CL9A 3P1CA 3S92A 3P1DA 4O78A 3JVJA 5E73A 5F5ZA 4HXKA 3JVLA 5FE9A 5BT3A 5DKDA 5F1LA 2KTBB 5KU3A 4LZRA 4TYLA 2RS9B 4O76A 2F6JA 5E9MA 5CU8A 5II1A 4IOOA 5I40A 2YQDA 4MENA 5CS8A 4YC9A 5DFBA 5DYXA 5CP5A 3Q2FA 4YH4A 5FG4A 5D3TA 5A5QA 4A9MA 4UITA 4YYJA 5H1TA 4YBMA 5A5NA 4XY9A 5DFCA 4CUUA 5FE8A 4TT4A 5J0DA 4TQNA 4TU4A 5LVQA 5IIDA 4HXLA 5FE4A 5IGLA 4O7EA 2YDWA 4A9JA 4HBXA 5EA1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZW1 A;  5DX4 A;  4NUE A;  4NR6 A;  5EP7 A;  4QUU A;  2N9G A;  4QNS A;  4XY8 A;  3UVX A;  2R0Y A;  4IOQ A;  4NS5 A;  5ETB A;  5E0R A;  5FG5 A;  5HEM A;  3JVK A;  2L85 A;  5DYA A;  5A7C A;  5EIS A;  5EWH A;  5F2P A;  4LRG A;  5L8U A;  5ETD A;  3P5O A;  2OSS A;  5CPE A;  5D25 A;  5F1H A;  2GRC A;  4HBV A;  4LZS A;  4UIV A;  5KHM A;  2WP2 A;  3G0L A;  4A9H A;  5H1U A;  4NQM A;  4A9N A;  5E7D A;  2E7N A;  5EPS A;  5FFY A;  5ENF A;  4YK0 A;  4CFL A;  4YYG A;  3UVD A;  4YY4 A;  3FKM X;  4NYV A;  2D9E A;  4TU6 A;  5ENC A;  5L99 A;  4MEQ A;  5LKT A;  5IBN A;  5FH6 A;  5HFQ A;  4QSV A;  5HRX A;  5G4S A;  5CUA A;  5HM0 A;  4LZ2 A;  3U5L A;  4UYF A;  5FDZ A;  5CRM A;  5ENE A;  5IGK A;  4WHW A;  4YYM A;  4QC1 A;  5JWM A;  4MEP A;  4TZ2 A;  4NRC A;  2YEK A;  3UV2 A;  1E6I A;  3G0J A;  3O36 A;  5ENI A;  4HXP A;  5CUC A;  4HBY A;  4UYG A;  5DBM A;  5E3G A;  5I7Y A;  3P1F A;  3QZV A;  4A9O A;  4YYD A;  5DW2 A;  4Z1Q A;  4BW2 A;  5L97 A;  4PTB A;  4IR5 A;  5A82 A;  4NYX A;  4N4I A;  4N4F A;  5DLX A;  5KO4 A;  5F25 A;  4NR8 A;  4O7C A;  4QBM A;  4BW4 A;  5CQ3 A;  5CQ8 A;  4DON A;  5AMF A;  5D3R A;  2YW5 A;  2E3K A;  3MUL A;  2I8N A;  4J0S A;  3O35 A;  2YYN A;  3U5N A;  5E9V A;  4HBW A;  4PS5 A;  3O33 A;  4QSS A;  2DVQ A;  4O77 A;  5EWC A;  4BW3 A;  4QEV A;  4Z93 A;  4KV1 A;  4HXR A;  4QY4 A;  2H60 A;  4LYI A;  4PKL A;  4O7F A;  4YYI A;  4ZQL A;  4NUC A;  5ENB A;  4BW1 A;  4QYD A;  3D7C A;  4O75 A;  4N4G A;  5FE3 A;  5LKX A;  2RFJ A;  5D7X A;  5LJ2 A;  5AME A;  3ZYU A;  3U5J A;  5EPR A;  5K29 A;  4CUQ A;  2YEM A;  5ENG A;  2OO1 A;  4A9E A;  4KCX A;  4QUT A;  4Z6H A;  4MR4 A;  4CUP A;  4BJX A;  2G4A A;  5D3J A;  4KV4 A;  1N72 A;  4NR9 A;  4O70 A;  5II2 A;  4QST A;  4LYS A;  4NR5 A;  5D3P A;  4C66 A;  3SVG A;  4XUA A;  4UIW A;  5FH8 A;  4NRB A;  4MR6 A;  4N4H A;  4YY6 A;  5FE6 A;  5I83 A;  5LKU A;  4QB3 A;  4J3I A;  3ONI A;  5F62 A;  4NXJ A;  4QC3 A;  3I3J A;  4PCI A;  3LXJ A;  3UV4 A;  3Q2E A;  2D82 A;  3JVM A;  5D3L A;  5TB6 A;  5FG6 A;  5FH7 A;  4ALG A;  5EVA A;  1F68 A;  2L84 A;  4CLB A;  3HME A;  5EU1 A;  3U5K A;  1EQF A;  5EWD A;  4Z1S A;  1JM4 B;  5L96 A;  5CRZ A;  4PY6 A;  5CUB A;  2L5E A;  4IR4 A;  5A85 A;  5BT5 A;  4CUT A;  4E96 A;  5EPB A;  5FE1 A;  5ENH A;  5HJC A;  2DVR A;  3K2J A;  4GPJ A;  5C89 A;  4QSR A;  5F61 A;  4O7B A;  5JI8 A;  5I89 A;  5AD3 A;  2R0V A;  5HQ6 A;  4PCE A;  5DKH A;  5A5O A;  3UV5 A;  5F63 A;  4WHU A;  5EV9 A;  1JSP B;  5HQ7 A;  5CQA A;  5I7X A;  5HRW A;  3MB3 A;  5DY7 A;  3IU6 A;  5FBX A;  4MR5 A;  5KTW A;  4YYK A;  2R10 A;  4FLP A;  4YAT A;  5FB0 A;  3AAD A;  5IGM A;  4A9L A;  5EI4 A;  4Y03 A;  5E9I A;  2DAT A;  4QEU A;  4UIZ A;  5I88 A;  5KTX A;  4HXN A;  4CUR A;  4YBS A;  5ACY A;  5IGN A;  5CUD A;  3SVH A;  2I7K A;  4HXM A;  4LC2 A;  5E9K A;  2MJV B;  3LQH A;  5C85 A;  5D0C A;  5A5S A;  5LJ0 A;  4LDF A;  1ZS5 A;  1WUM A;  5HCL A;  5HQ5 A;  5D26 A;  2RO1 A;  5E74 A;  4RVR A;  2LSP B;  3UW9 A;  3MQM A;  3MB4 A;  5E9L A;  4IOR A;  2DVS A;  4NQN A;  4LYW A;  5F3A A;  5FB1 A;  5LKZ A;  4ALH A;  4Q0N A;  3HMH A;  5I29 A;  2FSA A;  3GG3 A;  4O7A A;  4AKN A;  4QSX A;  4TZ8 A;  2WP1 A;  5G4R A;  5DYU A;  3TLP A;  4O71 A;  5A83 A;  4UIU A;  3U5O A;  4Z6I A;  4QSP A;  2RNX A;  5HLS A;  5L98 A;  5FE0 A;  2DKW A;  3U5M A;  4IR3 A;  4XYA A;  5EWV A;  4YAB A;  4BHW A;  4O72 A;  5LJ1 A;  5TCM A;  2F6N A;  4YYH A;  5CY9 A;  2OUO A;  5ENJ A;  5CQT A;  5CFW A;  4MEO A;  4IR6 A;  5CQ7 A;  4TT2 A;  4QSU A;  4OGI A;  5LVR A;  4NRA A;  5CUG A;  3LQI A;  3S91 A;  4F3I A;  2E7O A;  4ZC9 A;  3DAI A;  5CQ4 A;  3HMF A;  4OGJ A;  4OUF A;  3U5P A;  4TS8 A;  5A5P A;  3AQA A;  5F36 A;  4N3W A;  3P1E A;  2DVV A;  4QR5 A;  5CZG A;  5D3S A;  4CUS A;  4LR6 A;  5DKC A;  5EWW A;  4Q0O A;  5FFV A;  5D24 A;  5EGU A;  3O37 A;  2RNW A;  5I1Q A;  3LQJ A;  5EIC A;  5HEN A;  1X0J A;  5EQ1 A;  5FFW A;  4C67 A;  5CQ6 A;  4YYN A;  4A9I A;  3UVW A;  4A9F A;  5COI A;  5E9Y A;  5D3H A;  5LUU A;  4YAX A;  5L8T A;  4HXO A;  2RNY A;  3LJW A;  5D3N A;  4HXS A;  5EM3 A;  4NYW A;  1WUG A;  2DWW A;  5CQ5 A;  5H1V A;  4O74 A;  3RCW A;  3QZT A;  5FE5 A;  4NR4 A;  5E3D A;  4QSW A;  5DFD A;  3O34 A;  4UIY A;  4NUD A;  5I86 A;  2R0S A;  3UVY A;  5HEL A;  4YBT A;  4WIV A;  5DLZ A;  3SVF A;  3QZS A;  4QSQ A;  5KTU A;  3MXF A;  5H85 A;  4UYH A;  3NXB A;  4QEW A;  2NXB A;  2YEL A;  5AD2 A;  5FE7 A;  4MR3 A;  5CTL A;  4J0R A;  4QYL A;  5A81 A;  4YH3 A;  5FE2 A;  5A5R A;  5CUE A;  5C4Q A;  4A9K A;  5DW1 A;  4X2I A;  4J1P A;  4YAD A;  5IG6 A;  3DWY A;  4UIX A;  5EK9 A;  4TTE A;  5BT4 A;  5C87 A;  4CFK A;  4QR4 A;  5CGP A;  3MUK A;  3IU5 A;  4QZS A;  4UYD A;  5F60 A;  5C8G A;  4TT6 A;  5I80 A;  4UYF B;  2RI7 A;  5C7N A;  4NR7 A;  4UYE A;  4XUB A;  5HFR A;  5DYC A;  4QR3 A;  5HRV A;  4CL9 A;  3P1C A;  3S92 A;  3P1D A;  4O78 A;  3JVJ A;  5E73 A;  5F5Z A;  4HXK A;  3JVL A;  5FE9 A;  5BT3 A;  5DKD A;  5F1L A;  2KTB B;  5KU3 A;  4LZR A;  4TYL A;  2RS9 B;  4O76 A;  2F6J A;  5E9M A;  5CU8 A;  5II1 A;  4IOO A;  5I40 A;  2YQD A;  4MEN A;  5CS8 A;  4YC9 A;  5DFB A;  5DYX A;  5CP5 A;  3Q2F A;  4YH4 A;  5FG4 A;  5D3T A;  5A5Q A;  4A9M A;  4UIT A;  4YYJ A;  5H1T A;  4YBM A;  5A5N A;  4XY9 A;  5DFC A;  4CUU A;  5FE8 A;  4TT4 A;  5J0D A;  4TQN A;  4TU4 A;  5LVQ A;  5IID A;  4HXL A;  5FE4 A;  5IGL A;  4O7E A;  2YDW A;  4A9J A;  4HBX A;  5EA1 A; 
#chains in the Genus database with same CATH topology
 4ZW1 A;  5DX4 A;  4NUE A;  4NR6 A;  5EP7 A;  4QUU A;  2N9G A;  4QNS A;  4XY8 A;  3UVX A;  2R0Y A;  4IOQ A;  4NS5 A;  5ETB A;  5E0R A;  5FG5 A;  5HEM A;  3JVK A;  2L85 A;  5DYA A;  5A7C A;  5EIS A;  5EWH A;  5F2P A;  4LRG A;  5L8U A;  5ETD A;  3P5O A;  2OSS A;  5CPE A;  5D25 A;  5F1H A;  2GRC A;  4HBV A;  4LZS A;  4UIV A;  5KHM A;  2WP2 A;  3G0L A;  4A9H A;  5H1U A;  4NQM A;  4A9N A;  5E7D A;  2E7N A;  5EPS A;  5FFY A;  3VKG A;  5ENF A;  4YK0 A;  4CFL A;  4YYG A;  3UVD A;  4YY4 A;  3FKM X;  4NYV A;  2D9E A;  4TU6 A;  5ENC A;  5L99 A;  4MEQ A;  1ZKR A;  5LKT A;  5IBN A;  5FH6 A;  5HFQ A;  4QSV A;  5HRX A;  5G4S A;  5CUA A;  5HM0 A;  4LZ2 A;  3U5L A;  4UYF A;  5FDZ A;  5CRM A;  5ENE A;  5IGK A;  4WHW A;  4YYM A;  4QC1 A;  5JWM A;  4MEP A;  4TZ2 A;  4NRC A;  2YEK A;  3UV2 A;  1E6I A;  3G0J A;  3O36 A;  5ENI A;  4HXP A;  5CUC A;  4HBY A;  4UYG A;  5DBM A;  5E3G A;  5I7Y A;  3P1F A;  3QZV A;  4A9O A;  4YYD A;  5DW2 A;  4Z1Q A;  4BW2 A;  5L97 A;  4PTB A;  4IR5 A;  5A82 A;  4NYX A;  4N4I A;  4N4F A;  5DLX A;  5KO4 A;  5F25 A;  4NR8 A;  4O7C A;  4QBM A;  3D1B A;  4BW4 A;  5CQ3 A;  5CQ8 A;  4DON A;  5AMF A;  5D3R A;  2YW5 A;  2E3K A;  3MUL A;  2I8N A;  4J0S A;  3O35 A;  2YYN A;  3U5N A;  5E9V A;  4HBW A;  4PS5 A;  3O33 A;  4QSS A;  2DVQ A;  4O77 A;  5EWC A;  4BW3 A;  4QEV A;  4Z93 A;  4KV1 A;  4HXR A;  4QY4 A;  2H60 A;  4LYI A;  4PKL A;  4O7F A;  4YYI A;  4ZQL A;  4NUC A;  5ENB A;  4BW1 A;  4QYD A;  3D7C A;  4O75 A;  4N4G A;  5FE3 A;  5LKX A;  2RFJ A;  5D7X A;  5LJ2 A;  5AME A;  3ZYU A;  3U5J A;  5EPR A;  5K29 A;  4CUQ A;  2YEM A;  5ENG A;  2OO1 A;  4A9E A;  4KCX A;  4QUT A;  4Z6H A;  4MR4 A;  4AKH A;  4CUP A;  4BJX A;  2G4A A;  5D3J A;  4KV4 A;  1N72 A;  4NR9 A;  4O70 A;  5II2 A;  4QST A;  4LYS A;  4NR5 A;  5D3P A;  4C66 A;  3SVG A;  1PUO A;  4XUA A;  4UIW A;  5FH8 A;  4NRB A;  4MR6 A;  4N4H A;  4YY6 A;  5FE6 A;  5I83 A;  5LKU A;  4QB3 A;  4J3I A;  3ONI A;  5F62 A;  4NXJ A;  4QC3 A;  3I3J A;  4PCI A;  3LXJ A;  3UV4 A;  3Q2E A;  2D82 A;  3JVM A;  5D3L A;  5TB6 A;  5FG6 A;  5FH7 A;  4ALG A;  5EVA A;  1F68 A;  2L84 A;  4CLB A;  3HME A;  5EU1 A;  3U5K A;  1EQF A;  5EWD A;  4Z1S A;  1JM4 B;  5L96 A;  5CRZ A;  4PY6 A;  5CUB A;  2L5E A;  4IR4 A;  5A85 A;  5BT5 A;  4CUT A;  4E96 A;  5EPB A;  5FE1 A;  5ENH A;  5HJC A;  2DVR A;  3K2J A;  4GPJ A;  5C89 A;  4QSR A;  5F61 A;  4O7B A;  5JI8 A;  5I89 A;  5AD3 A;  2R0V A;  5HQ6 A;  4PCE A;  5DKH A;  5A5O A;  3UV5 A;  5F63 A;  4WHU A;  5EV9 A;  1JSP B;  5HQ7 A;  5CQA A;  5I7X A;  4AKG A;  5HRW A;  3MB3 A;  5DY7 A;  3IU6 A;  5FBX A;  4MR5 A;  5KTW A;  4YYK A;  2R10 A;  4FLP A;  4YAT A;  5FB0 A;  3AAD A;  5IGM A;  4A9L A;  5EI4 A;  4Y03 A;  5E9I A;  2DAT A;  4QEU A;  4UIZ A;  5I88 A;  5KTX A;  4HXN A;  4CUR A;  4YBS A;  5ACY A;  5IGN A;  5CUD A;  3SVH A;  2I7K A;  4HXM A;  4LC2 A;  5E9K A;  2MJV B;  3LQH A;  5C85 A;  5D0C A;  5A5S A;  5LJ0 A;  4LDF A;  1ZS5 A;  1WUM A;  5HCL A;  5HQ5 A;  5D26 A;  2RO1 A;  5E74 A;  4RVR A;  2LSP B;  3UW9 A;  3MQM A;  3MB4 A;  5E9L A;  4IOR A;  2DVS A;  4NQN A;  4LYW A;  5F3A A;  5FB1 A;  5LKZ A;  4ALH A;  4Q0N A;  3HMH A;  5I29 A;  2FSA A;  3GG3 A;  4O7A A;  4AKN A;  4QSX A;  4TZ8 A;  2WP1 A;  5G4R A;  5DYU A;  3TLP A;  4O71 A;  5A83 A;  4UIU A;  3U5O A;  4Z6I A;  4QSP A;  2RNX A;  5HLS A;  5L98 A;  5FE0 A;  2DKW A;  3U5M A;  4IR3 A;  4XYA A;  5EWV A;  4YAB A;  4BHW A;  4O72 A;  5LJ1 A;  5TCM A;  2F6N A;  4YYH A;  5CY9 A;  2OUO A;  5ENJ A;  5CQT A;  5CFW A;  4MEO A;  4IR6 A;  5CQ7 A;  4TT2 A;  4QSU A;  4OGI A;  5LVR A;  4NRA A;  5CUG A;  3LQI A;  3S91 A;  4F3I A;  2E7O A;  4ZC9 A;  3DAI A;  5CQ4 A;  3HMF A;  4OGJ A;  4OUF A;  3U5P A;  4TS8 A;  4AKI A;  5A5P A;  3AQA A;  5F36 A;  4N3W A;  3P1E A;  2DVV A;  4QR5 A;  5CZG A;  5D3S A;  3D1D A;  4CUS A;  4LR6 A;  5DKC A;  5EWW A;  4Q0O A;  5FFV A;  5D24 A;  5EGU A;  3O37 A;  2RNW A;  5I1Q A;  3LQJ A;  5EIC A;  5HEN A;  1X0J A;  5EQ1 A;  5FFW A;  4C67 A;  5CQ6 A;  4YYN A;  4A9I A;  3UVW A;  4A9F A;  4AI6 A;  5COI A;  5E9Y A;  5D3H A;  5LUU A;  4YAX A;  5L8T A;  4HXO A;  2RNY A;  3LJW A;  5D3N A;  4HXS A;  5EM3 A;  4NYW A;  1WUG A;  2DWW A;  5CQ5 A;  5H1V A;  4O74 A;  3RCW A;  3QZT A;  5FE5 A;  4NR4 A;  5E3D A;  4QSW A;  5DFD A;  3O34 A;  4UIY A;  4NUD A;  5I86 A;  2R0S A;  3UVY A;  5HEL A;  4YBT A;  4WIV A;  5DLZ A;  3SVF A;  3QZS A;  4QSQ A;  5KTU A;  3MXF A;  5H85 A;  4UYH A;  3NXB A;  4QEW A;  3ERR A;  2NXB A;  2YEL A;  5AD2 A;  5FE7 A;  4MR3 A;  5CTL A;  4J0R A;  4QYL A;  5A81 A;  4YH3 A;  5FE2 A;  5A5R A;  5CUE A;  5C4Q A;  4A9K A;  5DW1 A;  4X2I A;  4J1P A;  4YAD A;  5IG6 A;  3DWY A;  4UIX A;  5EK9 A;  4TTE A;  5BT4 A;  5C87 A;  4CFK A;  4QR4 A;  5CGP A;  3MUK A;  3IU5 A;  4QZS A;  4UYD A;  5F60 A;  5C8G A;  4TT6 A;  5I80 A;  4UYF B;  2RI7 A;  5C7N A;  4NR7 A;  4UYE A;  4XUB A;  5HFR A;  5DYC A;  4QR3 A;  5HRV A;  4CL9 A;  3P1C A;  3S92 A;  3P1D A;  4O78 A;  3JVJ A;  5E73 A;  3VKH A;  5F5Z A;  4HXK A;  3JVL A;  5FE9 A;  5BT3 A;  5DKD A;  5F1L A;  2KTB B;  5KU3 A;  4LZR A;  4TYL A;  2RS9 B;  4O76 A;  2F6J A;  5E9M A;  5CU8 A;  5II1 A;  4IOO A;  5I40 A;  2YQD A;  4MEN A;  5CS8 A;  4YC9 A;  5DFB A;  5DYX A;  5CP5 A;  3Q2F A;  4YH4 A;  5FG4 A;  5D3T A;  5A5Q A;  4A9M A;  4UIT A;  2EJN A;  4YYJ A;  5H1T A;  4YBM A;  5A5N A;  4XY9 A;  5DFC A;  4CUU A;  5FE8 A;  4TT4 A;  5J0D A;  4TQN A;  4TU4 A;  5LVQ A;  5IID A;  4HXL A;  5FE4 A;  5IGL A;  4O7E A;  2YDW A;  4A9J A;  4HBX A;  5EA1 A; 
#chains in the Genus database with same CATH homology
 4ZW1 A;  5DX4 A;  4NUE A;  4NR6 A;  5EP7 A;  4QUU A;  2N9G A;  4QNS A;  4XY8 A;  3UVX A;  2R0Y A;  4IOQ A;  4NS5 A;  5ETB A;  5E0R A;  5FG5 A;  5HEM A;  3JVK A;  2L85 A;  5DYA A;  5A7C A;  5EIS A;  5EWH A;  5F2P A;  4LRG A;  5L8U A;  5ETD A;  3P5O A;  2OSS A;  5CPE A;  5D25 A;  5F1H A;  2GRC A;  4HBV A;  4LZS A;  4UIV A;  5KHM A;  2WP2 A;  3G0L A;  4A9H A;  5H1U A;  4NQM A;  4A9N A;  5E7D A;  2E7N A;  5EPS A;  5FFY A;  5ENF A;  4YK0 A;  4CFL A;  4YYG A;  3UVD A;  4YY4 A;  3FKM X;  4NYV A;  2D9E A;  4TU6 A;  5ENC A;  5L99 A;  4MEQ A;  5LKT A;  5IBN A;  5FH6 A;  5HFQ A;  4QSV A;  5HRX A;  5G4S A;  5CUA A;  5HM0 A;  4LZ2 A;  3U5L A;  4UYF A;  5FDZ A;  5CRM A;  5ENE A;  5IGK A;  4WHW A;  4YYM A;  4QC1 A;  5JWM A;  4MEP A;  4TZ2 A;  4NRC A;  2YEK A;  3UV2 A;  1E6I A;  3G0J A;  3O36 A;  5ENI A;  4HXP A;  5CUC A;  4HBY A;  4UYG A;  5DBM A;  5E3G A;  5I7Y A;  3P1F A;  3QZV A;  4A9O A;  4YYD A;  5DW2 A;  4Z1Q A;  4BW2 A;  5L97 A;  4PTB A;  4IR5 A;  5A82 A;  4NYX A;  4N4I A;  4N4F A;  5DLX A;  5KO4 A;  5F25 A;  4NR8 A;  4O7C A;  4QBM A;  4BW4 A;  5CQ3 A;  5CQ8 A;  4DON A;  5AMF A;  5D3R A;  2YW5 A;  2E3K A;  3MUL A;  2I8N A;  4J0S A;  3O35 A;  2YYN A;  3U5N A;  5E9V A;  4HBW A;  4PS5 A;  3O33 A;  4QSS A;  2DVQ A;  4O77 A;  5EWC A;  4BW3 A;  4QEV A;  4Z93 A;  4KV1 A;  4HXR A;  4QY4 A;  2H60 A;  4LYI A;  4PKL A;  4O7F A;  4YYI A;  4ZQL A;  4NUC A;  5ENB A;  4BW1 A;  4QYD A;  3D7C A;  4O75 A;  4N4G A;  5FE3 A;  5LKX A;  2RFJ A;  5D7X A;  5LJ2 A;  5AME A;  3ZYU A;  3U5J A;  5EPR A;  5K29 A;  4CUQ A;  2YEM A;  5ENG A;  2OO1 A;  4A9E A;  4KCX A;  4QUT A;  4Z6H A;  4MR4 A;  4CUP A;  4BJX A;  2G4A A;  5D3J A;  4KV4 A;  1N72 A;  4NR9 A;  4O70 A;  5II2 A;  4QST A;  4LYS A;  4NR5 A;  5D3P A;  4C66 A;  3SVG A;  4XUA A;  4UIW A;  5FH8 A;  4NRB A;  4MR6 A;  4N4H A;  4YY6 A;  5FE6 A;  5I83 A;  5LKU A;  4QB3 A;  4J3I A;  3ONI A;  5F62 A;  4NXJ A;  4QC3 A;  3I3J A;  4PCI A;  3LXJ A;  3UV4 A;  3Q2E A;  2D82 A;  3JVM A;  5D3L A;  5TB6 A;  5FG6 A;  5FH7 A;  4ALG A;  5EVA A;  1F68 A;  2L84 A;  4CLB A;  3HME A;  5EU1 A;  3U5K A;  1EQF A;  5EWD A;  4Z1S A;  1JM4 B;  5L96 A;  5CRZ A;  4PY6 A;  5CUB A;  2L5E A;  4IR4 A;  5A85 A;  5BT5 A;  4CUT A;  4E96 A;  5EPB A;  5FE1 A;  5ENH A;  5HJC A;  2DVR A;  3K2J A;  4GPJ A;  5C89 A;  4QSR A;  5F61 A;  4O7B A;  5JI8 A;  5I89 A;  5AD3 A;  2R0V A;  5HQ6 A;  4PCE A;  5DKH A;  5A5O A;  3UV5 A;  5F63 A;  4WHU A;  5EV9 A;  1JSP B;  5HQ7 A;  5CQA A;  5I7X A;  5HRW A;  3MB3 A;  5DY7 A;  3IU6 A;  5FBX A;  4MR5 A;  5KTW A;  4YYK A;  2R10 A;  4FLP A;  4YAT A;  5FB0 A;  3AAD A;  5IGM A;  4A9L A;  5EI4 A;  4Y03 A;  5E9I A;  2DAT A;  4QEU A;  4UIZ A;  5I88 A;  5KTX A;  4HXN A;  4CUR A;  4YBS A;  5ACY A;  5IGN A;  5CUD A;  3SVH A;  2I7K A;  4HXM A;  4LC2 A;  5E9K A;  2MJV B;  3LQH A;  5C85 A;  5D0C A;  5A5S A;  5LJ0 A;  4LDF A;  1ZS5 A;  1WUM A;  5HCL A;  5HQ5 A;  5D26 A;  2RO1 A;  5E74 A;  4RVR A;  2LSP B;  3UW9 A;  3MQM A;  3MB4 A;  5E9L A;  4IOR A;  2DVS A;  4NQN A;  4LYW A;  5F3A A;  5FB1 A;  5LKZ A;  4ALH A;  4Q0N A;  3HMH A;  5I29 A;  2FSA A;  3GG3 A;  4O7A A;  4AKN A;  4QSX A;  4TZ8 A;  2WP1 A;  5G4R A;  5DYU A;  3TLP A;  4O71 A;  5A83 A;  4UIU A;  3U5O A;  4Z6I A;  4QSP A;  2RNX A;  5HLS A;  5L98 A;  5FE0 A;  2DKW A;  3U5M A;  4IR3 A;  4XYA A;  5EWV A;  4YAB A;  4BHW A;  4O72 A;  5LJ1 A;  5TCM A;  2F6N A;  4YYH A;  5CY9 A;  2OUO A;  5ENJ A;  5CQT A;  5CFW A;  4MEO A;  4IR6 A;  5CQ7 A;  4TT2 A;  4QSU A;  4OGI A;  5LVR A;  4NRA A;  5CUG A;  3LQI A;  3S91 A;  4F3I A;  2E7O A;  4ZC9 A;  3DAI A;  5CQ4 A;  3HMF A;  4OGJ A;  4OUF A;  3U5P A;  4TS8 A;  5A5P A;  3AQA A;  5F36 A;  4N3W A;  3P1E A;  2DVV A;  4QR5 A;  5CZG A;  5D3S A;  4CUS A;  4LR6 A;  5DKC A;  5EWW A;  4Q0O A;  5FFV A;  5D24 A;  5EGU A;  3O37 A;  2RNW A;  5I1Q A;  3LQJ A;  5EIC A;  5HEN A;  1X0J A;  5EQ1 A;  5FFW A;  4C67 A;  5CQ6 A;  4YYN A;  4A9I A;  3UVW A;  4A9F A;  5COI A;  5E9Y A;  5D3H A;  5LUU A;  4YAX A;  5L8T A;  4HXO A;  2RNY A;  3LJW A;  5D3N A;  4HXS A;  5EM3 A;  4NYW A;  1WUG A;  2DWW A;  5CQ5 A;  5H1V A;  4O74 A;  3RCW A;  3QZT A;  5FE5 A;  4NR4 A;  5E3D A;  4QSW A;  5DFD A;  3O34 A;  4UIY A;  4NUD A;  5I86 A;  2R0S A;  3UVY A;  5HEL A;  4YBT A;  4WIV A;  5DLZ A;  3SVF A;  3QZS A;  4QSQ A;  5KTU A;  3MXF A;  5H85 A;  4UYH A;  3NXB A;  4QEW A;  2NXB A;  2YEL A;  5AD2 A;  5FE7 A;  4MR3 A;  5CTL A;  4J0R A;  4QYL A;  5A81 A;  4YH3 A;  5FE2 A;  5A5R A;  5CUE A;  5C4Q A;  4A9K A;  5DW1 A;  4X2I A;  4J1P A;  4YAD A;  5IG6 A;  3DWY A;  4UIX A;  5EK9 A;  4TTE A;  5BT4 A;  5C87 A;  4CFK A;  4QR4 A;  5CGP A;  3MUK A;  3IU5 A;  4QZS A;  4UYD A;  5F60 A;  5C8G A;  4TT6 A;  5I80 A;  4UYF B;  2RI7 A;  5C7N A;  4NR7 A;  4UYE A;  4XUB A;  5HFR A;  5DYC A;  4QR3 A;  5HRV A;  4CL9 A;  3P1C A;  3S92 A;  3P1D A;  4O78 A;  3JVJ A;  5E73 A;  5F5Z A;  4HXK A;  3JVL A;  5FE9 A;  5BT3 A;  5DKD A;  5F1L A;  2KTB B;  5KU3 A;  4LZR A;  4TYL A;  2RS9 B;  4O76 A;  2F6J A;  5E9M A;  5CU8 A;  5II1 A;  4IOO A;  5I40 A;  2YQD A;  4MEN A;  5CS8 A;  4YC9 A;  5DFB A;  5DYX A;  5CP5 A;  3Q2F A;  4YH4 A;  5FG4 A;  5D3T A;  5A5Q A;  4A9M A;  4UIT A;  4YYJ A;  5H1T A;  4YBM A;  5A5N A;  4XY9 A;  5DFC A;  4CUU A;  5FE8 A;  4TT4 A;  5J0D A;  4TQN A;  4TU4 A;  5LVQ A;  5IID A;  4HXL A;  5FE4 A;  5IGL A;  4O7E A;  2YDW A;  4A9J A;  4HBX A;  5EA1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...