5HEMA

Crystal structure of the n-terminus d161y bromodomain mutant of human brd2
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
121
structure length
121
Chain Sequence
MKPGRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDYIVLMAQTLEKIFLQKVASMPQEEQELVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bromodomain-containing protein 2
publication title Crystal structure of the N-terminus D161Y bromodomain mutant of human BRD2
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 40
structure length 121
sequence length 121
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5hemA00
4MENA 4TQNA 4YY6A 5HRWA 4A9EA 4NXJA 2NXBA 3RCWA 4IR3A 2FSAA 3JVKA 5E9VA 5A5PA 3MB4A 5CTLA 4N4HA 4QSPA 5D24A 5DLXA 5FE9A 2L85A 5JI8A 5D3PA 5F5ZA 4QSSA 4HBWA 5ETDA 5ENFA 5EP7A 4A9MA 4J3IA 4QY4A 3UVWA 4MEOA 5L99A 3G0JA 5CQ3A 4XY9A 5CQ5A 5DYAA 3G0LA 4BW2A 5F25A 4C66A 4LR6A 2DVQA 2RS9B 5D3JA 2F6JA 5FE6A 4FLPA 5KTWA 5IBNA 4YYMA 3NXBA 2RI7A 5C87A 5LVRA 5BT3A 4NYXA 5CUAA 4A9JA 4A9OA 5HQ5A 5KU3A 2YW5A 4UIZA 5EK9A 4YBSA 3MB3A 4PKLA 5EGUA 4WHWA 4O74A 5D26A 4X2IA 2DVVA 4QYLA 2D82A 5A5OA 5FE8A 3UV4A 4HXLA 4CUTA 2WP1A 5EPRA 4A9FA 4ZC9A 4DONA 4NUCA 5IGMA 5E3GA 5BT5A 5A5SA 4KV1A 4CUPA 4XYAA 3QZSA 4O7AA 4A9HA 5H1TA 5EQ1A 4QSWA 5II1A 4QR4A 4RVRA 4TS8A 5CY9A 3HMEA 4LZSA 4CURA 5DLZA 4NYWA 4XY8A 3AADA 3SVGA 3UW9A 4MR3A 5E0RA 5F63A 5IGLA 5IG6A 3UVDA 3LQHA 3UV2A 5CP5A 2R0YA 5DYUA 5CQTA 4MR6A 4QEUA 4HXPA 4Z1SA 4UYFB 5I88A 4YAXA 2F6NA 5FE2A 4UIXA 4CLBA 4PY6A 5DW2A 5II2A 4NR6A 4CUSA 5LKTA 5TB6A 5D3TA 4PCEA 4HXOA 5HRXA 3K2JA 5E9MA 4N4GA 5FBXA 5A5NA 4YYGA 5FFYA 5AMEA 5ACYA 4BJXA 5FE3A 4Z6IA 4OGIA 4QR5A 5HEMA 5A7CA 3GG3A 5EWWA 5E9LA 4IOOA 5IGNA 5AD2A 5FB0A 5EWVA 4YBMA 3S91A 4J0SA 2E7NA 4ALGA 5EWCA 5CRZA 2N9GA 4UIUA 5C85A 3U5PA 5CU8A 4O78A 5I1QA 4O7BA 4MR4A 4LDFA 4TZ2A 4YYIA 5TCMA 2R0SA 2G4AA 4WHUA 5C7NA 5FE0A 4NR4A 5H1UA 2I8NA 3MQMA 5CUCA 5EM3A 4YH3A 3P1DA 5C8GA 4NS5A 5A5QA 4UIVA 4XUBA 3I3JA 1WUMA 4CFKA 5LKXA 5FG5A 5FE7A 5LUUA 4A9NA 4HBXA 1JSPB 5EPBA 3JVJA 3O36A 4O71A 4IORA 5A83A 3U5OA 1WUGA 5ENCA 2YYNA 5FG6A 5DYXA 4GPJA 5CQ8A 3IU6A 5H85A 3O35A 4BW3A 4UIYA 3MULA 5HFRA 4O7EA 2YDWA 3AQAA 3LQIA 3HMFA 5D3LA 5ETBA 4NQMA 4A9LA 5C4QA 4UYEA 4QYDA 5A81A 4ALHA 4NR5A 3S92A 2DKWA 4MEQA 4UYHA 3U5MA 4YH4A 3UVXA 3JVMA 4QBMA 5EV9A 5IGKA 3ZYUA 4A9IA 5HQ6A 2H60A 4Q0NA 5H1VA 4O7CA 5KHMA 4BW1A 5CUBA 5FE4A 4UIWA 4YYJA 5EWHA 4BW4A 5ENHA 4YABA 4E96A 4LYIA 2RO1A 4QEWA 3IU5A 4TT6A 2I7KA 4HXSA 5HELA 5DFDA 4Z1QA 2L5EA 2RNYA 5C89A 4AKNA 2MJVB 5I7YA 5JWMA 2RNWA 3P5OA 5FFWA 4YYDA 5CFWA 5AD3A 4ZQLA 3HMHA 4UYDA 5CZGA 5KTXA 5G4RA 5FH6A 4QEVA 4O76A 3O37A 3Q2FA 3P1CA 5LJ0A 5LKZA 4C67A 4QUUA 1ZS5A 5CRMA 5ENEA 3P1EA 3QZTA 4QSRA 5CUGA 5EICA 4YYKA 5EPSA 4J1PA 5E73A 5DFCA 4LRGA 5FB1A 4Q0OA 4MR5A 4HBVA 5EI4A 5D3SA 4TU4A 5EVAA 4N4FA 5CPEA 5HQ7A 5HRVA 4QSXA 5E9IA 5EWDA 4Y03A 4KCXA 4TYLA 5L97A 5E9YA 4LZRA 5CUEA 5COIA 3DWYA 5FFVA 5L8UA 4HXRA 5EA1A 5CQAA 5EU1A 4CFLA 5CS8A 4XUAA 5A5RA 5DY7A 4N3WA 5F2PA 5ENJA 3SVFA 2DVRA 2L84A 5CQ6A 3MXFA 4HBYA 4O70A 5G4SA 5DX4A 4QSVA 4MEPA 5HM0A 5KO4A 1X0JA 5L8TA 4A9KA 5CUDA 5F36A 2OO1A 5DW1A 4TT4A 4QSQA 5F60A 5DFBA 5DKDA 3U5LA 4PCIA 5IIDA 5ENBA 4KV4A 5HLSA 3UV5A 5FE1A 5FH8A 5K29A 3ONIA 3U5KA 5DBMA 3JVLA 5FH7A 5F1HA 4CL9A 3LXJA 4NRAA 5J0DA 5LVQA 5CGPA 2YQDA 5DKCA 5HCLA 5F3AA 4HXKA 4WIVA 5D0CA 4Z6HA 5I83A 2YELA 5L98A 3DAIA 4QC3A 5AMFA 4NQNA 3MUKA 2OSSA 3U5JA 5DKHA 5I40A 2WP2A 4TTEA 3FKMX 4IR5A 4TZ8A 4O7FA 5CQ7A 4NRBA 5I89A 5F62A 5LKUA 2YEKA 4QNSA 4YATA 5FG4A 3D7CA 2DATA 5D7XA 5A85A 4TU6A 5HENA 5D3RA 2OUOA 4NUDA 3LQJA 4LYSA 3U5NA 4TT2A 4LZ2A 5EISA 5HJCA 2D9EA 4YC9A 5E7DA 5I86A 2E7OA 3O34A 2GRCA 1N72A 5I80A 4HXNA 4PS5A 5I29A 1F68A 4QB3A 4YBTA 4IR4A 5D3HA 4O72A 4O77A 4QZSA 4N4IA 5HFQA 4O75A 4NR8A 5DYCA 4UITA 5A82A 3QZVA 4BHWA 2KTBB 5D25A 4YYHA 4QSUA 4CUQA 4YY4A 2DWWA 4F3IA 5E3DA 5E74A 5CQ4A 1JM4B 2E3KA 4NRCA 4J0RA 4NR7A 5E9KA 2RNXA 5ENIA 4QC1A 4OUFA 4HXMA 4QSTA 4Z93A 4OGJA 5F61A 2LSPB 5LJ1A 4LYWA 4IR6A 4ZW1A 5F1LA 5I7XA 1EQFA 5BT4A 2R0VA 4NR9A 4QR3A 3UVYA 3TLPA 5LJ2A 3P1FA 4PTBA 5L96A 3LJWA 2RFJA 1E6IA 5KTUA 4YK0A 4NYVA 4UYFA 4LC2A 5FE5A 2DVSA 5D3NA 4YYNA 4NUEA 2YEMA 3O33A 5FDZA 5ENGA 2R10A 4IOQA 4UYGA 4CUUA 3SVHA 4QUTA 3Q2EA 4YADA
chains in the Genus database with same CATH superfamily
4MENA 4TQNA 4YY6A 5HRWA 4A9EA 4NXJA 2NXBA 3RCWA 4IR3A 2FSAA 3JVKA 5E9VA 5A5PA 3MB4A 5CTLA 4AI6A 4N4HA 4QSPA 5D24A 5DLXA 5FE9A 2L85A 5JI8A 5D3PA 5F5ZA 4QSSA 4HBWA 5ETDA 5ENFA 5EP7A 4A9MA 4J3IA 4QY4A 3UVWA 4MEOA 5L99A 3G0JA 5CQ3A 4XY9A 5CQ5A 5DYAA 3G0LA 4BW2A 5F25A 4C66A 4LR6A 2DVQA 2RS9B 5D3JA 2F6JA 5FE6A 4FLPA 5KTWA 1PUOA 5IBNA 4YYMA 3NXBA 2RI7A 5C87A 5LVRA 5BT3A 4NYXA 5CUAA 4A9JA 4A9OA 5HQ5A 5KU3A 2YW5A 4UIZA 5EK9A 4YBSA 3MB3A 4PKLA 5EGUA 4WHWA 4O74A 5D26A 4X2IA 2DVVA 4QYLA 2D82A 5A5OA 5FE8A 3UV4A 4HXLA 4CUTA 2WP1A 5EPRA 4A9FA 4ZC9A 4DONA 4NUCA 5IGMA 5E3GA 5BT5A 5A5SA 4KV1A 4CUPA 4XYAA 3QZSA 4O7AA 4A9HA 5H1TA 5EQ1A 4QSWA 5II1A 4QR4A 4RVRA 4TS8A 5CY9A 3HMEA 4LZSA 4CURA 5DLZA 4NYWA 4XY8A 3AADA 3SVGA 3UW9A 4MR3A 5E0RA 5F63A 5IGLA 5IG6A 3UVDA 3LQHA 3UV2A 5CP5A 2R0YA 5DYUA 5CQTA 4MR6A 4QEUA 4HXPA 4Z1SA 4UYFB 5I88A 4YAXA 2F6NA 5FE2A 4UIXA 4CLBA 4PY6A 5DW2A 5II2A 4NR6A 4CUSA 5LKTA 5TB6A 5D3TA 4PCEA 4HXOA 5HRXA 3K2JA 5E9MA 4N4GA 5FBXA 5A5NA 4YYGA 5FFYA 5AMEA 5ACYA 4BJXA 5FE3A 4Z6IA 4OGIA 4QR5A 5HEMA 5A7CA 3GG3A 5EWWA 5E9LA 4IOOA 5IGNA 5AD2A 5FB0A 5EWVA 4YBMA 3S91A 4J0SA 2E7NA 4ALGA 5EWCA 5CRZA 2N9GA 4UIUA 5C85A 3U5PA 5CU8A 4O78A 5I1QA 4O7BA 4MR4A 4LDFA 4TZ2A 4YYIA 5TCMA 2R0SA 2G4AA 4WHUA 5C7NA 5FE0A 4NR4A 5H1UA 2I8NA 3MQMA 5CUCA 3D1BA 5EM3A 4YH3A 3P1DA 5C8GA 4NS5A 5A5QA 4UIVA 4XUBA 3I3JA 1WUMA 4CFKA 5LKXA 5FG5A 5FE7A 5LUUA 4A9NA 4HBXA 1JSPB 5EPBA 3JVJA 3O36A 4AKHA 4O71A 4IORA 5A83A 3U5OA 1WUGA 5ENCA 2YYNA 5FG6A 5DYXA 4GPJA 5CQ8A 3IU6A 5H85A 3O35A 4BW3A 4UIYA 3MULA 5HFRA 4O7EA 2YDWA 3AQAA 3LQIA 3HMFA 5D3LA 5ETBA 3ERRA 4NQMA 4A9LA 5C4QA 4UYEA 4QYDA 5A81A 4ALHA 4NR5A 3S92A 2DKWA 4MEQA 4UYHA 3U5MA 4YH4A 3UVXA 3JVMA 4QBMA 5EV9A 5IGKA 3VKGA 3ZYUA 4A9IA 5HQ6A 2H60A 4Q0NA 5H1VA 4O7CA 5KHMA 4BW1A 5CUBA 5FE4A 4UIWA 4YYJA 5EWHA 4BW4A 5ENHA 4YABA 4E96A 4LYIA 2RO1A 4QEWA 3IU5A 4TT6A 2I7KA 4HXSA 5HELA 5DFDA 4Z1QA 2L5EA 2RNYA 5C89A 4AKNA 2MJVB 5I7YA 5JWMA 2RNWA 3P5OA 5FFWA 4YYDA 5CFWA 5AD3A 4ZQLA 3HMHA 4UYDA 5CZGA 5KTXA 5G4RA 5FH6A 4QEVA 4O76A 3O37A 3Q2FA 3P1CA 5LJ0A 5LKZA 4C67A 4QUUA 1ZS5A 5CRMA 5ENEA 3P1EA 3QZTA 4QSRA 5CUGA 5EICA 4YYKA 5EPSA 4J1PA 5E73A 5DFCA 4LRGA 5FB1A 4Q0OA 4MR5A 4HBVA 5EI4A 2EJNA 5D3SA 4TU4A 5EVAA 4N4FA 5CPEA 5HQ7A 5HRVA 4QSXA 5E9IA 4AKIA 5EWDA 4AKGA 4Y03A 4KCXA 4TYLA 5L97A 5E9YA 4LZRA 5CUEA 5COIA 3DWYA 5FFVA 5L8UA 4HXRA 5EA1A 5CQAA 5EU1A 4CFLA 5CS8A 4XUAA 5A5RA 5DY7A 4N3WA 5F2PA 5ENJA 3SVFA 2DVRA 2L84A 5CQ6A 3MXFA 4HBYA 4O70A 5G4SA 5DX4A 4QSVA 3D1DA 4MEPA 5HM0A 5KO4A 1X0JA 5L8TA 4A9KA 5CUDA 5F36A 2OO1A 3VKHA 5DW1A 4TT4A 4QSQA 5F60A 5DFBA 5DKDA 3U5LA 4PCIA 5IIDA 5ENBA 4KV4A 5HLSA 3UV5A 5FE1A 5FH8A 5K29A 3ONIA 3U5KA 5DBMA 3JVLA 5FH7A 5F1HA 4CL9A 3LXJA 4NRAA 5J0DA 5LVQA 5CGPA 1ZKRA 2YQDA 5DKCA 5HCLA 5F3AA 4HXKA 4WIVA 5D0CA 4Z6HA 5I83A 2YELA 5L98A 3DAIA 4QC3A 5AMFA 4NQNA 3MUKA 2OSSA 3U5JA 5DKHA 5I40A 2WP2A 4TTEA 3FKMX 4IR5A 4TZ8A 4O7FA 5CQ7A 4NRBA 5I89A 5F62A 5LKUA 2YEKA 4QNSA 4YATA 5FG4A 3D7CA 2DATA 5D7XA 5A85A 4TU6A 5HENA 5D3RA 2OUOA 4NUDA 3LQJA 4LYSA 3U5NA 4TT2A 4LZ2A 5EISA 5HJCA 2D9EA 4YC9A 5E7DA 5I86A 2E7OA 3O34A 2GRCA 1N72A 5I80A 4HXNA 4PS5A 5I29A 1F68A 4QB3A 4YBTA 4IR4A 5D3HA 4O72A 4O77A 4QZSA 4N4IA 5HFQA 4O75A 4NR8A 5DYCA 4UITA 5A82A 3QZVA 4BHWA 2KTBB 5D25A 4YYHA 4QSUA 4CUQA 4YY4A 2DWWA 4F3IA 5E3DA 5E74A 5CQ4A 1JM4B 2E3KA 4NRCA 4J0RA 4NR7A 5E9KA 2RNXA 5ENIA 4QC1A 4OUFA 4HXMA 4QSTA 4Z93A 4OGJA 5F61A 2LSPB 5LJ1A 4LYWA 4IR6A 4ZW1A 5F1LA 5I7XA 1EQFA 5BT4A 2R0VA 4NR9A 4QR3A 3UVYA 3TLPA 5LJ2A 3P1FA 4PTBA 5L96A 3LJWA 2RFJA 1E6IA 5KTUA 4YK0A 4NYVA 4UYFA 4LC2A 5FE5A 2DVSA 5D3NA 4YYNA 4NUEA 2YEMA 3O33A 5FDZA 5ENGA 2R10A 4IOQA 4UYGA 4CUUA 3SVHA 4QUTA 3Q2EA 4YADA
chains in the Genus database with same CATH topology
4MENA 4TQNA 4YY6A 5HRWA 4A9EA 4NXJA 2NXBA 3RCWA 4IR3A 2FSAA 3JVKA 5E9VA 5A5PA 3MB4A 5CTLA 4N4HA 4QSPA 5D24A 5DLXA 5FE9A 2L85A 5JI8A 5D3PA 5F5ZA 4QSSA 4HBWA 5ETDA 5ENFA 5EP7A 4A9MA 4J3IA 4QY4A 3UVWA 4MEOA 5L99A 3G0JA 5CQ3A 4XY9A 5CQ5A 5DYAA 3G0LA 4BW2A 5F25A 4C66A 4LR6A 2DVQA 2RS9B 5D3JA 2F6JA 5FE6A 4FLPA 5KTWA 5IBNA 4YYMA 3NXBA 2RI7A 5C87A 5LVRA 5BT3A 4NYXA 5CUAA 4A9JA 4A9OA 5HQ5A 5KU3A 2YW5A 4UIZA 5EK9A 4YBSA 3MB3A 4PKLA 5EGUA 4WHWA 4O74A 5D26A 4X2IA 2DVVA 4QYLA 2D82A 5A5OA 5FE8A 3UV4A 4HXLA 4CUTA 2WP1A 5EPRA 4A9FA 4ZC9A 4DONA 4NUCA 5IGMA 5E3GA 5BT5A 5A5SA 4KV1A 4CUPA 4XYAA 3QZSA 4O7AA 4A9HA 5H1TA 5EQ1A 4QSWA 5II1A 4QR4A 4RVRA 4TS8A 5CY9A 3HMEA 4LZSA 4CURA 5DLZA 4NYWA 4XY8A 3AADA 3SVGA 3UW9A 4MR3A 5E0RA 5F63A 5IGLA 5IG6A 3UVDA 3LQHA 3UV2A 5CP5A 2R0YA 5DYUA 5CQTA 4MR6A 4QEUA 4HXPA 4Z1SA 4UYFB 5I88A 4YAXA 2F6NA 5FE2A 4UIXA 4CLBA 4PY6A 5DW2A 5II2A 4NR6A 4CUSA 5LKTA 5TB6A 5D3TA 4PCEA 4HXOA 5HRXA 3K2JA 5E9MA 4N4GA 5FBXA 5A5NA 4YYGA 5FFYA 5AMEA 5ACYA 4BJXA 5FE3A 4Z6IA 4OGIA 4QR5A 5HEMA 5A7CA 3GG3A 5EWWA 5E9LA 4IOOA 5IGNA 5AD2A 5FB0A 5EWVA 4YBMA 3S91A 4J0SA 2E7NA 4ALGA 5EWCA 5CRZA 2N9GA 4UIUA 5C85A 3U5PA 5CU8A 4O78A 5I1QA 4O7BA 4MR4A 4LDFA 4TZ2A 4YYIA 5TCMA 2R0SA 2G4AA 4WHUA 5C7NA 5FE0A 4NR4A 5H1UA 2I8NA 3MQMA 5CUCA 5EM3A 4YH3A 3P1DA 5C8GA 4NS5A 5A5QA 4UIVA 4XUBA 3I3JA 1WUMA 4CFKA 5LKXA 5FG5A 5FE7A 5LUUA 4A9NA 4HBXA 1JSPB 5EPBA 3JVJA 3O36A 4O71A 4IORA 5A83A 3U5OA 1WUGA 5ENCA 2YYNA 5FG6A 5DYXA 4GPJA 5CQ8A 3IU6A 5H85A 3O35A 4BW3A 4UIYA 3MULA 5HFRA 4O7EA 2YDWA 3AQAA 3LQIA 3HMFA 5D3LA 5ETBA 4NQMA 4A9LA 5C4QA 4UYEA 4QYDA 5A81A 4ALHA 4NR5A 3S92A 2DKWA 4MEQA 4UYHA 3U5MA 4YH4A 3UVXA 3JVMA 4QBMA 5EV9A 5IGKA 3ZYUA 4A9IA 5HQ6A 2H60A 4Q0NA 5H1VA 4O7CA 5KHMA 4BW1A 5CUBA 5FE4A 4UIWA 4YYJA 5EWHA 4BW4A 5ENHA 4YABA 4E96A 4LYIA 2RO1A 4QEWA 3IU5A 4TT6A 2I7KA 4HXSA 5HELA 5DFDA 4Z1QA 2L5EA 2RNYA 5C89A 4AKNA 2MJVB 5I7YA 5JWMA 2RNWA 3P5OA 5FFWA 4YYDA 5CFWA 5AD3A 4ZQLA 3HMHA 4UYDA 5CZGA 5KTXA 5G4RA 5FH6A 4QEVA 4O76A 3O37A 3Q2FA 3P1CA 5LJ0A 5LKZA 4C67A 4QUUA 1ZS5A 5CRMA 5ENEA 3P1EA 3QZTA 4QSRA 5CUGA 5EICA 4YYKA 5EPSA 4J1PA 5E73A 5DFCA 4LRGA 5FB1A 4Q0OA 4MR5A 4HBVA 5EI4A 5D3SA 4TU4A 5EVAA 4N4FA 5CPEA 5HQ7A 5HRVA 4QSXA 5E9IA 5EWDA 4Y03A 4KCXA 4TYLA 5L97A 5E9YA 4LZRA 5CUEA 5COIA 3DWYA 5FFVA 5L8UA 4HXRA 5EA1A 5CQAA 5EU1A 4CFLA 5CS8A 4XUAA 5A5RA 5DY7A 4N3WA 5F2PA 5ENJA 3SVFA 2DVRA 2L84A 5CQ6A 3MXFA 4HBYA 4O70A 5G4SA 5DX4A 4QSVA 4MEPA 5HM0A 5KO4A 1X0JA 5L8TA 4A9KA 5CUDA 5F36A 2OO1A 5DW1A 4TT4A 4QSQA 5F60A 5DFBA 5DKDA 3U5LA 4PCIA 5IIDA 5ENBA 4KV4A 5HLSA 3UV5A 5FE1A 5FH8A 5K29A 3ONIA 3U5KA 5DBMA 3JVLA 5FH7A 5F1HA 4CL9A 3LXJA 4NRAA 5J0DA 5LVQA 5CGPA 2YQDA 5DKCA 5HCLA 5F3AA 4HXKA 4WIVA 5D0CA 4Z6HA 5I83A 2YELA 5L98A 3DAIA 4QC3A 5AMFA 4NQNA 3MUKA 2OSSA 3U5JA 5DKHA 5I40A 2WP2A 4TTEA 3FKMX 4IR5A 4TZ8A 4O7FA 5CQ7A 4NRBA 5I89A 5F62A 5LKUA 2YEKA 4QNSA 4YATA 5FG4A 3D7CA 2DATA 5D7XA 5A85A 4TU6A 5HENA 5D3RA 2OUOA 4NUDA 3LQJA 4LYSA 3U5NA 4TT2A 4LZ2A 5EISA 5HJCA 2D9EA 4YC9A 5E7DA 5I86A 2E7OA 3O34A 2GRCA 1N72A 5I80A 4HXNA 4PS5A 5I29A 1F68A 4QB3A 4YBTA 4IR4A 5D3HA 4O72A 4O77A 4QZSA 4N4IA 5HFQA 4O75A 4NR8A 5DYCA 4UITA 5A82A 3QZVA 4BHWA 2KTBB 5D25A 4YYHA 4QSUA 4CUQA 4YY4A 2DWWA 4F3IA 5E3DA 5E74A 5CQ4A 1JM4B 2E3KA 4NRCA 4J0RA 4NR7A 5E9KA 2RNXA 5ENIA 4QC1A 4OUFA 4HXMA 4QSTA 4Z93A 4OGJA 5F61A 2LSPB 5LJ1A 4LYWA 4IR6A 4ZW1A 5F1LA 5I7XA 1EQFA 5BT4A 2R0VA 4NR9A 4QR3A 3UVYA 3TLPA 5LJ2A 3P1FA 4PTBA 5L96A 3LJWA 2RFJA 1E6IA 5KTUA 4YK0A 4NYVA 4UYFA 4LC2A 5FE5A 2DVSA 5D3NA 4YYNA 4NUEA 2YEMA 3O33A 5FDZA 5ENGA 2R10A 4IOQA 4UYGA 4CUUA 3SVHA 4QUTA 3Q2EA 4YADA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MEN A;  4TQN A;  4YY6 A;  5HRW A;  4A9E A;  4NXJ A;  2NXB A;  3RCW A;  4IR3 A;  2FSA A;  3JVK A;  5E9V A;  5A5P A;  3MB4 A;  5CTL A;  4N4H A;  4QSP A;  5D24 A;  5DLX A;  5FE9 A;  2L85 A;  5JI8 A;  5D3P A;  5F5Z A;  4QSS A;  4HBW A;  5ETD A;  5ENF A;  5EP7 A;  4A9M A;  4J3I A;  4QY4 A;  3UVW A;  4MEO A;  5L99 A;  3G0J A;  5CQ3 A;  4XY9 A;  5CQ5 A;  5DYA A;  3G0L A;  4BW2 A;  5F25 A;  4C66 A;  4LR6 A;  2DVQ A;  2RS9 B;  5D3J A;  2F6J A;  5FE6 A;  4FLP A;  5KTW A;  5IBN A;  4YYM A;  3NXB A;  2RI7 A;  5C87 A;  5LVR A;  5BT3 A;  4NYX A;  5CUA A;  4A9J A;  4A9O A;  5HQ5 A;  5KU3 A;  2YW5 A;  4UIZ A;  5EK9 A;  4YBS A;  3MB3 A;  4PKL A;  5EGU A;  4WHW A;  4O74 A;  5D26 A;  4X2I A;  2DVV A;  4QYL A;  2D82 A;  5A5O A;  5FE8 A;  3UV4 A;  4HXL A;  4CUT A;  2WP1 A;  5EPR A;  4A9F A;  4ZC9 A;  4DON A;  4NUC A;  5IGM A;  5E3G A;  5BT5 A;  5A5S A;  4KV1 A;  4CUP A;  4XYA A;  3QZS A;  4O7A A;  4A9H A;  5H1T A;  5EQ1 A;  4QSW A;  5II1 A;  4QR4 A;  4RVR A;  4TS8 A;  5CY9 A;  3HME A;  4LZS A;  4CUR A;  5DLZ A;  4NYW A;  4XY8 A;  3AAD A;  3SVG A;  3UW9 A;  4MR3 A;  5E0R A;  5F63 A;  5IGL A;  5IG6 A;  3UVD A;  3LQH A;  3UV2 A;  5CP5 A;  2R0Y A;  5DYU A;  5CQT A;  4MR6 A;  4QEU A;  4HXP A;  4Z1S A;  4UYF B;  5I88 A;  4YAX A;  2F6N A;  5FE2 A;  4UIX A;  4CLB A;  4PY6 A;  5DW2 A;  5II2 A;  4NR6 A;  4CUS A;  5LKT A;  5TB6 A;  5D3T A;  4PCE A;  4HXO A;  5HRX A;  3K2J A;  5E9M A;  4N4G A;  5FBX A;  5A5N A;  4YYG A;  5FFY A;  5AME A;  5ACY A;  4BJX A;  5FE3 A;  4Z6I A;  4OGI A;  4QR5 A;  5HEM A;  5A7C A;  3GG3 A;  5EWW A;  5E9L A;  4IOO A;  5IGN A;  5AD2 A;  5FB0 A;  5EWV A;  4YBM A;  3S91 A;  4J0S A;  2E7N A;  4ALG A;  5EWC A;  5CRZ A;  2N9G A;  4UIU A;  5C85 A;  3U5P A;  5CU8 A;  4O78 A;  5I1Q A;  4O7B A;  4MR4 A;  4LDF A;  4TZ2 A;  4YYI A;  5TCM A;  2R0S A;  2G4A A;  4WHU A;  5C7N A;  5FE0 A;  4NR4 A;  5H1U A;  2I8N A;  3MQM A;  5CUC A;  5EM3 A;  4YH3 A;  3P1D A;  5C8G A;  4NS5 A;  5A5Q A;  4UIV A;  4XUB A;  3I3J A;  1WUM A;  4CFK A;  5LKX A;  5FG5 A;  5FE7 A;  5LUU A;  4A9N A;  4HBX A;  1JSP B;  5EPB A;  3JVJ A;  3O36 A;  4O71 A;  4IOR A;  5A83 A;  3U5O A;  1WUG A;  5ENC A;  2YYN A;  5FG6 A;  5DYX A;  4GPJ A;  5CQ8 A;  3IU6 A;  5H85 A;  3O35 A;  4BW3 A;  4UIY A;  3MUL A;  5HFR A;  4O7E A;  2YDW A;  3AQA A;  3LQI A;  3HMF A;  5D3L A;  5ETB A;  4NQM A;  4A9L A;  5C4Q A;  4UYE A;  4QYD A;  5A81 A;  4ALH A;  4NR5 A;  3S92 A;  2DKW A;  4MEQ A;  4UYH A;  3U5M A;  4YH4 A;  3UVX A;  3JVM A;  4QBM A;  5EV9 A;  5IGK A;  3ZYU A;  4A9I A;  5HQ6 A;  2H60 A;  4Q0N A;  5H1V A;  4O7C A;  5KHM A;  4BW1 A;  5CUB A;  5FE4 A;  4UIW A;  4YYJ A;  5EWH A;  4BW4 A;  5ENH A;  4YAB A;  4E96 A;  4LYI A;  2RO1 A;  4QEW A;  3IU5 A;  4TT6 A;  2I7K A;  4HXS A;  5HEL A;  5DFD A;  4Z1Q A;  2L5E A;  2RNY A;  5C89 A;  4AKN A;  2MJV B;  5I7Y A;  5JWM A;  2RNW A;  3P5O A;  5FFW A;  4YYD A;  5CFW A;  5AD3 A;  4ZQL A;  3HMH A;  4UYD A;  5CZG A;  5KTX A;  5G4R A;  5FH6 A;  4QEV A;  4O76 A;  3O37 A;  3Q2F A;  3P1C A;  5LJ0 A;  5LKZ A;  4C67 A;  4QUU A;  1ZS5 A;  5CRM A;  5ENE A;  3P1E A;  3QZT A;  4QSR A;  5CUG A;  5EIC A;  4YYK A;  5EPS A;  4J1P A;  5E73 A;  5DFC A;  4LRG A;  5FB1 A;  4Q0O A;  4MR5 A;  4HBV A;  5EI4 A;  5D3S A;  4TU4 A;  5EVA A;  4N4F A;  5CPE A;  5HQ7 A;  5HRV A;  4QSX A;  5E9I A;  5EWD A;  4Y03 A;  4KCX A;  4TYL A;  5L97 A;  5E9Y A;  4LZR A;  5CUE A;  5COI A;  3DWY A;  5FFV A;  5L8U A;  4HXR A;  5EA1 A;  5CQA A;  5EU1 A;  4CFL A;  5CS8 A;  4XUA A;  5A5R A;  5DY7 A;  4N3W A;  5F2P A;  5ENJ A;  3SVF A;  2DVR A;  2L84 A;  5CQ6 A;  3MXF A;  4HBY A;  4O70 A;  5G4S A;  5DX4 A;  4QSV A;  4MEP A;  5HM0 A;  5KO4 A;  1X0J A;  5L8T A;  4A9K A;  5CUD A;  5F36 A;  2OO1 A;  5DW1 A;  4TT4 A;  4QSQ A;  5F60 A;  5DFB A;  5DKD A;  3U5L A;  4PCI A;  5IID A;  5ENB A;  4KV4 A;  5HLS A;  3UV5 A;  5FE1 A;  5FH8 A;  5K29 A;  3ONI A;  3U5K A;  5DBM A;  3JVL A;  5FH7 A;  5F1H A;  4CL9 A;  3LXJ A;  4NRA A;  5J0D A;  5LVQ A;  5CGP A;  2YQD A;  5DKC A;  5HCL A;  5F3A A;  4HXK A;  4WIV A;  5D0C A;  4Z6H A;  5I83 A;  2YEL A;  5L98 A;  3DAI A;  4QC3 A;  5AMF A;  4NQN A;  3MUK A;  2OSS A;  3U5J A;  5DKH A;  5I40 A;  2WP2 A;  4TTE A;  3FKM X;  4IR5 A;  4TZ8 A;  4O7F A;  5CQ7 A;  4NRB A;  5I89 A;  5F62 A;  5LKU A;  2YEK A;  4QNS A;  4YAT A;  5FG4 A;  3D7C A;  2DAT A;  5D7X A;  5A85 A;  4TU6 A;  5HEN A;  5D3R A;  2OUO A;  4NUD A;  3LQJ A;  4LYS A;  3U5N A;  4TT2 A;  4LZ2 A;  5EIS A;  5HJC A;  2D9E A;  4YC9 A;  5E7D A;  5I86 A;  2E7O A;  3O34 A;  2GRC A;  1N72 A;  5I80 A;  4HXN A;  4PS5 A;  5I29 A;  1F68 A;  4QB3 A;  4YBT A;  4IR4 A;  5D3H A;  4O72 A;  4O77 A;  4QZS A;  4N4I A;  5HFQ A;  4O75 A;  4NR8 A;  5DYC A;  4UIT A;  5A82 A;  3QZV A;  4BHW A;  2KTB B;  5D25 A;  4YYH A;  4QSU A;  4CUQ A;  4YY4 A;  2DWW A;  4F3I A;  5E3D A;  5E74 A;  5CQ4 A;  1JM4 B;  2E3K A;  4NRC A;  4J0R A;  4NR7 A;  5E9K A;  2RNX A;  5ENI A;  4QC1 A;  4OUF A;  4HXM A;  4QST A;  4Z93 A;  4OGJ A;  5F61 A;  2LSP B;  5LJ1 A;  4LYW A;  4IR6 A;  4ZW1 A;  5F1L A;  5I7X A;  1EQF A;  5BT4 A;  2R0V A;  4NR9 A;  4QR3 A;  3UVY A;  3TLP A;  5LJ2 A;  3P1F A;  4PTB A;  5L96 A;  3LJW A;  2RFJ A;  1E6I A;  5KTU A;  4YK0 A;  4NYV A;  4UYF A;  4LC2 A;  5FE5 A;  2DVS A;  5D3N A;  4YYN A;  4NUE A;  2YEM A;  3O33 A;  5FDZ A;  5ENG A;  2R10 A;  4IOQ A;  4UYG A;  4CUU A;  3SVH A;  4QUT A;  3Q2E A;  4YAD A; 
#chains in the Genus database with same CATH topology
 4MEN A;  4TQN A;  4YY6 A;  5HRW A;  4A9E A;  4NXJ A;  2NXB A;  3RCW A;  4IR3 A;  2FSA A;  3JVK A;  5E9V A;  5A5P A;  3MB4 A;  5CTL A;  4AI6 A;  4N4H A;  4QSP A;  5D24 A;  5DLX A;  5FE9 A;  2L85 A;  5JI8 A;  5D3P A;  5F5Z A;  4QSS A;  4HBW A;  5ETD A;  5ENF A;  5EP7 A;  4A9M A;  4J3I A;  4QY4 A;  3UVW A;  4MEO A;  5L99 A;  3G0J A;  5CQ3 A;  4XY9 A;  5CQ5 A;  5DYA A;  3G0L A;  4BW2 A;  5F25 A;  4C66 A;  4LR6 A;  2DVQ A;  2RS9 B;  5D3J A;  2F6J A;  5FE6 A;  4FLP A;  5KTW A;  1PUO A;  5IBN A;  4YYM A;  3NXB A;  2RI7 A;  5C87 A;  5LVR A;  5BT3 A;  4NYX A;  5CUA A;  4A9J A;  4A9O A;  5HQ5 A;  5KU3 A;  2YW5 A;  4UIZ A;  5EK9 A;  4YBS A;  3MB3 A;  4PKL A;  5EGU A;  4WHW A;  4O74 A;  5D26 A;  4X2I A;  2DVV A;  4QYL A;  2D82 A;  5A5O A;  5FE8 A;  3UV4 A;  4HXL A;  4CUT A;  2WP1 A;  5EPR A;  4A9F A;  4ZC9 A;  4DON A;  4NUC A;  5IGM A;  5E3G A;  5BT5 A;  5A5S A;  4KV1 A;  4CUP A;  4XYA A;  3QZS A;  4O7A A;  4A9H A;  5H1T A;  5EQ1 A;  4QSW A;  5II1 A;  4QR4 A;  4RVR A;  4TS8 A;  5CY9 A;  3HME A;  4LZS A;  4CUR A;  5DLZ A;  4NYW A;  4XY8 A;  3AAD A;  3SVG A;  3UW9 A;  4MR3 A;  5E0R A;  5F63 A;  5IGL A;  5IG6 A;  3UVD A;  3LQH A;  3UV2 A;  5CP5 A;  2R0Y A;  5DYU A;  5CQT A;  4MR6 A;  4QEU A;  4HXP A;  4Z1S A;  4UYF B;  5I88 A;  4YAX A;  2F6N A;  5FE2 A;  4UIX A;  4CLB A;  4PY6 A;  5DW2 A;  5II2 A;  4NR6 A;  4CUS A;  5LKT A;  5TB6 A;  5D3T A;  4PCE A;  4HXO A;  5HRX A;  3K2J A;  5E9M A;  4N4G A;  5FBX A;  5A5N A;  4YYG A;  5FFY A;  5AME A;  5ACY A;  4BJX A;  5FE3 A;  4Z6I A;  4OGI A;  4QR5 A;  5HEM A;  5A7C A;  3GG3 A;  5EWW A;  5E9L A;  4IOO A;  5IGN A;  5AD2 A;  5FB0 A;  5EWV A;  4YBM A;  3S91 A;  4J0S A;  2E7N A;  4ALG A;  5EWC A;  5CRZ A;  2N9G A;  4UIU A;  5C85 A;  3U5P A;  5CU8 A;  4O78 A;  5I1Q A;  4O7B A;  4MR4 A;  4LDF A;  4TZ2 A;  4YYI A;  5TCM A;  2R0S A;  2G4A A;  4WHU A;  5C7N A;  5FE0 A;  4NR4 A;  5H1U A;  2I8N A;  3MQM A;  5CUC A;  3D1B A;  5EM3 A;  4YH3 A;  3P1D A;  5C8G A;  4NS5 A;  5A5Q A;  4UIV A;  4XUB A;  3I3J A;  1WUM A;  4CFK A;  5LKX A;  5FG5 A;  5FE7 A;  5LUU A;  4A9N A;  4HBX A;  1JSP B;  5EPB A;  3JVJ A;  3O36 A;  4AKH A;  4O71 A;  4IOR A;  5A83 A;  3U5O A;  1WUG A;  5ENC A;  2YYN A;  5FG6 A;  5DYX A;  4GPJ A;  5CQ8 A;  3IU6 A;  5H85 A;  3O35 A;  4BW3 A;  4UIY A;  3MUL A;  5HFR A;  4O7E A;  2YDW A;  3AQA A;  3LQI A;  3HMF A;  5D3L A;  5ETB A;  3ERR A;  4NQM A;  4A9L A;  5C4Q A;  4UYE A;  4QYD A;  5A81 A;  4ALH A;  4NR5 A;  3S92 A;  2DKW A;  4MEQ A;  4UYH A;  3U5M A;  4YH4 A;  3UVX A;  3JVM A;  4QBM A;  5EV9 A;  5IGK A;  3VKG A;  3ZYU A;  4A9I A;  5HQ6 A;  2H60 A;  4Q0N A;  5H1V A;  4O7C A;  5KHM A;  4BW1 A;  5CUB A;  5FE4 A;  4UIW A;  4YYJ A;  5EWH A;  4BW4 A;  5ENH A;  4YAB A;  4E96 A;  4LYI A;  2RO1 A;  4QEW A;  3IU5 A;  4TT6 A;  2I7K A;  4HXS A;  5HEL A;  5DFD A;  4Z1Q A;  2L5E A;  2RNY A;  5C89 A;  4AKN A;  2MJV B;  5I7Y A;  5JWM A;  2RNW A;  3P5O A;  5FFW A;  4YYD A;  5CFW A;  5AD3 A;  4ZQL A;  3HMH A;  4UYD A;  5CZG A;  5KTX A;  5G4R A;  5FH6 A;  4QEV A;  4O76 A;  3O37 A;  3Q2F A;  3P1C A;  5LJ0 A;  5LKZ A;  4C67 A;  4QUU A;  1ZS5 A;  5CRM A;  5ENE A;  3P1E A;  3QZT A;  4QSR A;  5CUG A;  5EIC A;  4YYK A;  5EPS A;  4J1P A;  5E73 A;  5DFC A;  4LRG A;  5FB1 A;  4Q0O A;  4MR5 A;  4HBV A;  5EI4 A;  2EJN A;  5D3S A;  4TU4 A;  5EVA A;  4N4F A;  5CPE A;  5HQ7 A;  5HRV A;  4QSX A;  5E9I A;  4AKI A;  5EWD A;  4AKG A;  4Y03 A;  4KCX A;  4TYL A;  5L97 A;  5E9Y A;  4LZR A;  5CUE A;  5COI A;  3DWY A;  5FFV A;  5L8U A;  4HXR A;  5EA1 A;  5CQA A;  5EU1 A;  4CFL A;  5CS8 A;  4XUA A;  5A5R A;  5DY7 A;  4N3W A;  5F2P A;  5ENJ A;  3SVF A;  2DVR A;  2L84 A;  5CQ6 A;  3MXF A;  4HBY A;  4O70 A;  5G4S A;  5DX4 A;  4QSV A;  3D1D A;  4MEP A;  5HM0 A;  5KO4 A;  1X0J A;  5L8T A;  4A9K A;  5CUD A;  5F36 A;  2OO1 A;  3VKH A;  5DW1 A;  4TT4 A;  4QSQ A;  5F60 A;  5DFB A;  5DKD A;  3U5L A;  4PCI A;  5IID A;  5ENB A;  4KV4 A;  5HLS A;  3UV5 A;  5FE1 A;  5FH8 A;  5K29 A;  3ONI A;  3U5K A;  5DBM A;  3JVL A;  5FH7 A;  5F1H A;  4CL9 A;  3LXJ A;  4NRA A;  5J0D A;  5LVQ A;  5CGP A;  1ZKR A;  2YQD A;  5DKC A;  5HCL A;  5F3A A;  4HXK A;  4WIV A;  5D0C A;  4Z6H A;  5I83 A;  2YEL A;  5L98 A;  3DAI A;  4QC3 A;  5AMF A;  4NQN A;  3MUK A;  2OSS A;  3U5J A;  5DKH A;  5I40 A;  2WP2 A;  4TTE A;  3FKM X;  4IR5 A;  4TZ8 A;  4O7F A;  5CQ7 A;  4NRB A;  5I89 A;  5F62 A;  5LKU A;  2YEK A;  4QNS A;  4YAT A;  5FG4 A;  3D7C A;  2DAT A;  5D7X A;  5A85 A;  4TU6 A;  5HEN A;  5D3R A;  2OUO A;  4NUD A;  3LQJ A;  4LYS A;  3U5N A;  4TT2 A;  4LZ2 A;  5EIS A;  5HJC A;  2D9E A;  4YC9 A;  5E7D A;  5I86 A;  2E7O A;  3O34 A;  2GRC A;  1N72 A;  5I80 A;  4HXN A;  4PS5 A;  5I29 A;  1F68 A;  4QB3 A;  4YBT A;  4IR4 A;  5D3H A;  4O72 A;  4O77 A;  4QZS A;  4N4I A;  5HFQ A;  4O75 A;  4NR8 A;  5DYC A;  4UIT A;  5A82 A;  3QZV A;  4BHW A;  2KTB B;  5D25 A;  4YYH A;  4QSU A;  4CUQ A;  4YY4 A;  2DWW A;  4F3I A;  5E3D A;  5E74 A;  5CQ4 A;  1JM4 B;  2E3K A;  4NRC A;  4J0R A;  4NR7 A;  5E9K A;  2RNX A;  5ENI A;  4QC1 A;  4OUF A;  4HXM A;  4QST A;  4Z93 A;  4OGJ A;  5F61 A;  2LSP B;  5LJ1 A;  4LYW A;  4IR6 A;  4ZW1 A;  5F1L A;  5I7X A;  1EQF A;  5BT4 A;  2R0V A;  4NR9 A;  4QR3 A;  3UVY A;  3TLP A;  5LJ2 A;  3P1F A;  4PTB A;  5L96 A;  3LJW A;  2RFJ A;  1E6I A;  5KTU A;  4YK0 A;  4NYV A;  4UYF A;  4LC2 A;  5FE5 A;  2DVS A;  5D3N A;  4YYN A;  4NUE A;  2YEM A;  3O33 A;  5FDZ A;  5ENG A;  2R10 A;  4IOQ A;  4UYG A;  4CUU A;  3SVH A;  4QUT A;  3Q2E A;  4YAD A; 
#chains in the Genus database with same CATH homology
 4MEN A;  4TQN A;  4YY6 A;  5HRW A;  4A9E A;  4NXJ A;  2NXB A;  3RCW A;  4IR3 A;  2FSA A;  3JVK A;  5E9V A;  5A5P A;  3MB4 A;  5CTL A;  4N4H A;  4QSP A;  5D24 A;  5DLX A;  5FE9 A;  2L85 A;  5JI8 A;  5D3P A;  5F5Z A;  4QSS A;  4HBW A;  5ETD A;  5ENF A;  5EP7 A;  4A9M A;  4J3I A;  4QY4 A;  3UVW A;  4MEO A;  5L99 A;  3G0J A;  5CQ3 A;  4XY9 A;  5CQ5 A;  5DYA A;  3G0L A;  4BW2 A;  5F25 A;  4C66 A;  4LR6 A;  2DVQ A;  2RS9 B;  5D3J A;  2F6J A;  5FE6 A;  4FLP A;  5KTW A;  5IBN A;  4YYM A;  3NXB A;  2RI7 A;  5C87 A;  5LVR A;  5BT3 A;  4NYX A;  5CUA A;  4A9J A;  4A9O A;  5HQ5 A;  5KU3 A;  2YW5 A;  4UIZ A;  5EK9 A;  4YBS A;  3MB3 A;  4PKL A;  5EGU A;  4WHW A;  4O74 A;  5D26 A;  4X2I A;  2DVV A;  4QYL A;  2D82 A;  5A5O A;  5FE8 A;  3UV4 A;  4HXL A;  4CUT A;  2WP1 A;  5EPR A;  4A9F A;  4ZC9 A;  4DON A;  4NUC A;  5IGM A;  5E3G A;  5BT5 A;  5A5S A;  4KV1 A;  4CUP A;  4XYA A;  3QZS A;  4O7A A;  4A9H A;  5H1T A;  5EQ1 A;  4QSW A;  5II1 A;  4QR4 A;  4RVR A;  4TS8 A;  5CY9 A;  3HME A;  4LZS A;  4CUR A;  5DLZ A;  4NYW A;  4XY8 A;  3AAD A;  3SVG A;  3UW9 A;  4MR3 A;  5E0R A;  5F63 A;  5IGL A;  5IG6 A;  3UVD A;  3LQH A;  3UV2 A;  5CP5 A;  2R0Y A;  5DYU A;  5CQT A;  4MR6 A;  4QEU A;  4HXP A;  4Z1S A;  4UYF B;  5I88 A;  4YAX A;  2F6N A;  5FE2 A;  4UIX A;  4CLB A;  4PY6 A;  5DW2 A;  5II2 A;  4NR6 A;  4CUS A;  5LKT A;  5TB6 A;  5D3T A;  4PCE A;  4HXO A;  5HRX A;  3K2J A;  5E9M A;  4N4G A;  5FBX A;  5A5N A;  4YYG A;  5FFY A;  5AME A;  5ACY A;  4BJX A;  5FE3 A;  4Z6I A;  4OGI A;  4QR5 A;  5HEM A;  5A7C A;  3GG3 A;  5EWW A;  5E9L A;  4IOO A;  5IGN A;  5AD2 A;  5FB0 A;  5EWV A;  4YBM A;  3S91 A;  4J0S A;  2E7N A;  4ALG A;  5EWC A;  5CRZ A;  2N9G A;  4UIU A;  5C85 A;  3U5P A;  5CU8 A;  4O78 A;  5I1Q A;  4O7B A;  4MR4 A;  4LDF A;  4TZ2 A;  4YYI A;  5TCM A;  2R0S A;  2G4A A;  4WHU A;  5C7N A;  5FE0 A;  4NR4 A;  5H1U A;  2I8N A;  3MQM A;  5CUC A;  5EM3 A;  4YH3 A;  3P1D A;  5C8G A;  4NS5 A;  5A5Q A;  4UIV A;  4XUB A;  3I3J A;  1WUM A;  4CFK A;  5LKX A;  5FG5 A;  5FE7 A;  5LUU A;  4A9N A;  4HBX A;  1JSP B;  5EPB A;  3JVJ A;  3O36 A;  4O71 A;  4IOR A;  5A83 A;  3U5O A;  1WUG A;  5ENC A;  2YYN A;  5FG6 A;  5DYX A;  4GPJ A;  5CQ8 A;  3IU6 A;  5H85 A;  3O35 A;  4BW3 A;  4UIY A;  3MUL A;  5HFR A;  4O7E A;  2YDW A;  3AQA A;  3LQI A;  3HMF A;  5D3L A;  5ETB A;  4NQM A;  4A9L A;  5C4Q A;  4UYE A;  4QYD A;  5A81 A;  4ALH A;  4NR5 A;  3S92 A;  2DKW A;  4MEQ A;  4UYH A;  3U5M A;  4YH4 A;  3UVX A;  3JVM A;  4QBM A;  5EV9 A;  5IGK A;  3ZYU A;  4A9I A;  5HQ6 A;  2H60 A;  4Q0N A;  5H1V A;  4O7C A;  5KHM A;  4BW1 A;  5CUB A;  5FE4 A;  4UIW A;  4YYJ A;  5EWH A;  4BW4 A;  5ENH A;  4YAB A;  4E96 A;  4LYI A;  2RO1 A;  4QEW A;  3IU5 A;  4TT6 A;  2I7K A;  4HXS A;  5HEL A;  5DFD A;  4Z1Q A;  2L5E A;  2RNY A;  5C89 A;  4AKN A;  2MJV B;  5I7Y A;  5JWM A;  2RNW A;  3P5O A;  5FFW A;  4YYD A;  5CFW A;  5AD3 A;  4ZQL A;  3HMH A;  4UYD A;  5CZG A;  5KTX A;  5G4R A;  5FH6 A;  4QEV A;  4O76 A;  3O37 A;  3Q2F A;  3P1C A;  5LJ0 A;  5LKZ A;  4C67 A;  4QUU A;  1ZS5 A;  5CRM A;  5ENE A;  3P1E A;  3QZT A;  4QSR A;  5CUG A;  5EIC A;  4YYK A;  5EPS A;  4J1P A;  5E73 A;  5DFC A;  4LRG A;  5FB1 A;  4Q0O A;  4MR5 A;  4HBV A;  5EI4 A;  5D3S A;  4TU4 A;  5EVA A;  4N4F A;  5CPE A;  5HQ7 A;  5HRV A;  4QSX A;  5E9I A;  5EWD A;  4Y03 A;  4KCX A;  4TYL A;  5L97 A;  5E9Y A;  4LZR A;  5CUE A;  5COI A;  3DWY A;  5FFV A;  5L8U A;  4HXR A;  5EA1 A;  5CQA A;  5EU1 A;  4CFL A;  5CS8 A;  4XUA A;  5A5R A;  5DY7 A;  4N3W A;  5F2P A;  5ENJ A;  3SVF A;  2DVR A;  2L84 A;  5CQ6 A;  3MXF A;  4HBY A;  4O70 A;  5G4S A;  5DX4 A;  4QSV A;  4MEP A;  5HM0 A;  5KO4 A;  1X0J A;  5L8T A;  4A9K A;  5CUD A;  5F36 A;  2OO1 A;  5DW1 A;  4TT4 A;  4QSQ A;  5F60 A;  5DFB A;  5DKD A;  3U5L A;  4PCI A;  5IID A;  5ENB A;  4KV4 A;  5HLS A;  3UV5 A;  5FE1 A;  5FH8 A;  5K29 A;  3ONI A;  3U5K A;  5DBM A;  3JVL A;  5FH7 A;  5F1H A;  4CL9 A;  3LXJ A;  4NRA A;  5J0D A;  5LVQ A;  5CGP A;  2YQD A;  5DKC A;  5HCL A;  5F3A A;  4HXK A;  4WIV A;  5D0C A;  4Z6H A;  5I83 A;  2YEL A;  5L98 A;  3DAI A;  4QC3 A;  5AMF A;  4NQN A;  3MUK A;  2OSS A;  3U5J A;  5DKH A;  5I40 A;  2WP2 A;  4TTE A;  3FKM X;  4IR5 A;  4TZ8 A;  4O7F A;  5CQ7 A;  4NRB A;  5I89 A;  5F62 A;  5LKU A;  2YEK A;  4QNS A;  4YAT A;  5FG4 A;  3D7C A;  2DAT A;  5D7X A;  5A85 A;  4TU6 A;  5HEN A;  5D3R A;  2OUO A;  4NUD A;  3LQJ A;  4LYS A;  3U5N A;  4TT2 A;  4LZ2 A;  5EIS A;  5HJC A;  2D9E A;  4YC9 A;  5E7D A;  5I86 A;  2E7O A;  3O34 A;  2GRC A;  1N72 A;  5I80 A;  4HXN A;  4PS5 A;  5I29 A;  1F68 A;  4QB3 A;  4YBT A;  4IR4 A;  5D3H A;  4O72 A;  4O77 A;  4QZS A;  4N4I A;  5HFQ A;  4O75 A;  4NR8 A;  5DYC A;  4UIT A;  5A82 A;  3QZV A;  4BHW A;  2KTB B;  5D25 A;  4YYH A;  4QSU A;  4CUQ A;  4YY4 A;  2DWW A;  4F3I A;  5E3D A;  5E74 A;  5CQ4 A;  1JM4 B;  2E3K A;  4NRC A;  4J0R A;  4NR7 A;  5E9K A;  2RNX A;  5ENI A;  4QC1 A;  4OUF A;  4HXM A;  4QST A;  4Z93 A;  4OGJ A;  5F61 A;  2LSP B;  5LJ1 A;  4LYW A;  4IR6 A;  4ZW1 A;  5F1L A;  5I7X A;  1EQF A;  5BT4 A;  2R0V A;  4NR9 A;  4QR3 A;  3UVY A;  3TLP A;  5LJ2 A;  3P1F A;  4PTB A;  5L96 A;  3LJW A;  2RFJ A;  1E6I A;  5KTU A;  4YK0 A;  4NYV A;  4UYF A;  4LC2 A;  5FE5 A;  2DVS A;  5D3N A;  4YYN A;  4NUE A;  2YEM A;  3O33 A;  5FDZ A;  5ENG A;  2R10 A;  4IOQ A;  4UYG A;  4CUU A;  3SVH A;  4QUT A;  3Q2E A;  4YAD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...