2G4AA

Solution structure of a bromodomain from ring3 protein
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
108
structure length
108
Chain Sequence
EQLKHCNVILKELLSKKHAAYAWPFYKPVDASALGLHDYHDIIKHPMDLSTVKRKMENRDYRDAQEFAADVRLMFSNCYKYNPPDHDVVAMARKLQDVFEFRYAKMPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation
molecule keywords Bromodomain-containing protein 2
publication title Solution structure of a Bromodomain from RING3
rcsb
source organism Homo sapiens
total genus 28
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2006-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2g4aA00
4NUEA 5CUGA 4F3IA 4PS5A 4PCIA 4A9KA 5CUAA 4O7EA 4MR5A 4HXLA 4BW4A 5DFCA 5F1HA 5LUUA 2RS9B 5AMEA 4TZ2A 4UIYA 4NYWA 2N9GA 5C85A 4MR4A 4XUAA 5EWVA 3U5PA 5DFBA 3QZVA 4UYDA 5CFWA 4YADA 5ENJA 5FFWA 5AD3A 5A85A 5EPRA 5BT4A 5CQ4A 5EPBA 2YEKA 5CS8A 1WUMA 4PTBA 5D7XA 2DVQA 2RI7A 5HRWA 4NRBA 5IBNA 3QZSA 5D3RA 2NXBA 4UIZA 4IR5A 5E9VA 3G0JA 5I7XA 5KTXA 3O37A 5E9IA 4QR3A 4ZC9A 5EV9A 4TU6A 4MEQA 5CGPA 5DLZA 5L98A 5ENFA 4CFLA 5A82A 4MEPA 5FG6A 5I83A 3JVLA 4C67A 4O7AA 5F1LA 2R10A 5I89A 4OGIA 5F36A 3SVGA 5CY9A 5DBMA 5I80A 3AQAA 2YQDA 5ENBA 3IU5A 5H1VA 3O35A 4TT4A 4N3WA 1WUGA 2OO1A 3Q2EA 2F6JA 3P5OA 3TLPA 3UV2A 4A9NA 3O33A 5IGKA 4QR5A 5A5NA 3LQHA 5H1UA 4LRGA 3HMHA 2DATA 5D3SA 5DYXA 4C66A 5A5OA 5KO4A 4J0SA 5CUCA 3JVMA 5LJ1A 5L96A 5CU8A 5H85A 5IIDA 4J0RA 2MJVB 4YH3A 5DW1A 2KTBB 5AMFA 5E9MA 5DKHA 4LC2A 4YYDA 5CUEA 5FDZA 2RNYA 5A83A 4ZW1A 5EWCA 4CURA 5CQ3A 5I40A 2R0YA 5EU1A 4X2IA 4A9FA 5C89A 4O78A 5CUDA 2L5EA 5HQ6A 4HBXA 4LZSA 4A9JA 5J0DA 3S92A 4IR3A 2I7KA 4O75A 4TZ8A 4HXMA 4N4IA 2YW5A 4MEOA 4MR3A 4YY6A 4HXSA 3GG3A 5HEMA 2WP1A 5D3NA 4Z6HA 2YELA 4XYAA 4NQMA 4QSSA 5ETBA 4TS8A 2R0SA 5LVQA 2RO1A 4QYDA 4J3IA 4OGJA 4UYEA 5CQ6A 3QZTA 4QR4A 4Z1SA 2E3KA 5TCMA 5KTWA 5FG5A 5EWHA 4YYGA 4A9LA 3MB3A 5EGUA 5D3JA 5HM0A 4NUCA 5FB0A 4NR5A 4BW2A 4UYHA 4YYMA 4IOOA 4YYIA 4WIVA 5L8UA 3ZYUA 5DKDA 4LYWA 5D3HA 4XY9A 4IR4A 4RVRA 4NR6A 5F2PA 4YBMA 5HFQA 4ALGA 3SVHA 4CUUA 3JVKA 4LZRA 4O72A 5CTLA 5G4RA 4QSTA 4O76A 5ENEA 2GRCA 5C4QA 5COIA 4HXPA 5C87A 2F6NA 5E0RA 3P1CA 4NR7A 3UVYA 5FE5A 5E3GA 1ZS5A 5LJ0A 3U5MA 4HBYA 4QSUA 4E96A 5I1QA 4Q0NA 4CUTA 5C8GA 5IGLA 5EWWA 4Z1QA 5LJ2A 5E9YA 5HRVA 5HCLA 5D3PA 4NR9A 4AKNA 5D3LA 4KCXA 4YABA 1N72A 4HBVA 4YBTA 4QSWA 5KTUA 5JWMA 3P1FA 4QC1A 3LXJA 4QNSA 5KU3A 5LKZA 4TQNA 4QSXA 5DFDA 5D26A 4O7BA 5A81A 1EQFA 3MULA 4PKLA 5FH8A 3U5NA 3I3JA 5DX4A 4QSPA 4O77A 5EWDA 5F61A 4DONA 4QEVA 3O36A 4LYSA 3MB4A 4HBWA 4QEWA 5I29A 4A9OA 3RCWA 2RFJA 5EPSA 5ACYA 3HMEA 3UV5A 4YH4A 4UIXA 2L84A 4O70A 5H1TA 3DWYA 4NXJA 5CQ8A 5FE4A 5ETDA 4YBSA 5BT3A 2DVRA 5EM3A 4ZQLA 3P1DA 5FG4A 3Q2FA 4Z6IA 5EP7A 3UVWA 5EQ1A 2YDWA 4A9EA 4QEUA 4Y03A 4YYKA 5HENA 2R0VA 3P1EA 4IORA 2YYNA 4Z93A 4QUTA 5F63A 4YYJA 5FB1A 4QC3A 5F62A 1JSPB 4A9MA 5DYUA 3U5JA 4O71A 4YAXA 5L8TA 4BW3A 3MXFA 5C7NA 5CRMA 3UVXA 5HQ7A 5FE0A 5L99A 5EK9A 5F25A 4ALHA 4BJXA 5II1A 5FE1A 5E74A 4YY4A 4PCEA 5LKUA 4N4GA 5HLSA 4N4FA 5KHMA 3SVFA 3G0LA 4NRAA 5DW2A 5E3DA 4UYFB 5D3TA 2D9EA 4BHWA 5EISA 4QSRA 4WHWA 4YYNA 4UYGA 2DVVA 2OSSA 5L97A 3K2JA 5D24A 5FFYA 5FFVA 4TYLA 3O34A 2I8NA 5DLXA 5ENHA 4MR6A 4QYLA 4XY8A 5IGNA 2G4AA 4KV4A 4A9HA 5TB6A 4IR6A 2OUOA 4QBMA 4YK0A 4LR6A 4NR4A 5HFRA 5FE8A 4TT2A 4NS5A 4UIWA 5HJCA 5CUBA 4HXKA 5DY7A 5EI4A 4CFKA 5A7CA 4CUQA 5IGMA 5I88A 4CUPA 5FE6A 4LYIA 3LJWA 4QSVA 5BT5A 4YC9A 5A5PA 3AADA 5FE2A 2RNWA 5G4SA 4XUBA 5A5SA 5HRXA 5LKXA 4IOQA 4QUUA 4O74A 3MUKA 3S91A 4UIVA 5FE9A 5F5ZA 3U5KA 3U5LA 4NRCA 4PY6A 1X0JA 4CLBA 4NUDA 5IG6A 4N4HA 5E9LA 2DVSA 4CUSA 3LQJA 5D25A 5FE3A 5FBXA 5E7DA 3JVJA 4TU4A 4LZ2A 5CZGA 4NYVA 4UYFA 5F3AA 5CRZA 3MQMA 5FH7A 3ONIA 4UITA 4A9IA 2LSPB 5HQ5A 4MENA 3D7CA 4HXRA 5A5QA 5FH6A 4QSQA 4FLPA 5II2A 3U5OA 5I7YA 5CQ5A 4O7FA 3DAIA 5CPEA 5CQAA 5DYCA 5LVRA 5CQ7A 4HXOA 5CQTA 4CL9A 5ENGA 5I86A 5K29A 2FSAA 3NXBA 4YATA 4LDFA 1F68A 4OUFA 4KV1A 5E73A 5F60A 3UV4A 5D0CA 4O7CA 1E6IA 5FE7A 4Q0OA 4WHUA 5DYAA 5A5RA 4J1PA 2L85A 5DKCA 5LKTA 2WP2A 5ENCA 4TTEA 4UIUA 5AD2A 1JM4B 3LQIA 5HELA 2D82A 5EVAA 4BW1A 2DKWA 4YYHA 4NQNA 2YEMA 4HXNA 2H60A 4QZSA 5ENIA 4QY4A 3UVDA 5CP5A 4GPJA 4NYXA 4QB3A 3HMFA 2E7NA 4NR8A 5JI8A 5EICA 5EA1A 5E9KA 3UW9A 3IU6A 4TT6A 2E7OA 3FKMX 2RNXA 2DWWA
chains in the Genus database with same CATH superfamily
4NUEA 5CUGA 4F3IA 4PS5A 4PCIA 4A9KA 5CUAA 4O7EA 4MR5A 4HXLA 4BW4A 5DFCA 5F1HA 5LUUA 2RS9B 5AMEA 4TZ2A 4UIYA 4NYWA 2N9GA 5C85A 4MR4A 4XUAA 5EWVA 3U5PA 5DFBA 3QZVA 4UYDA 5CFWA 4YADA 5ENJA 5FFWA 5AD3A 5A85A 5EPRA 5BT4A 5CQ4A 5EPBA 2YEKA 5CS8A 1WUMA 4PTBA 5D7XA 2DVQA 2RI7A 5HRWA 4NRBA 5IBNA 3QZSA 5D3RA 2NXBA 4UIZA 4IR5A 5E9VA 3G0JA 5I7XA 5KTXA 3O37A 5E9IA 4QR3A 4ZC9A 5EV9A 4TU6A 4MEQA 5CGPA 5DLZA 5L98A 4AKGA 5ENFA 4CFLA 5A82A 4MEPA 5FG6A 5I83A 3JVLA 4C67A 4O7AA 5F1LA 2R10A 5I89A 4OGIA 5F36A 3SVGA 5CY9A 2EJNA 5DBMA 5I80A 3AQAA 2YQDA 5ENBA 3IU5A 5H1VA 3O35A 4TT4A 4N3WA 1WUGA 2OO1A 3Q2EA 2F6JA 3P5OA 3TLPA 3UV2A 4A9NA 4AI6A 3O33A 5IGKA 4QR5A 5A5NA 3LQHA 5H1UA 4LRGA 3HMHA 2DATA 5D3SA 5DYXA 4C66A 5A5OA 5KO4A 4J0SA 5CUCA 3JVMA 5LJ1A 5L96A 5CU8A 5H85A 5IIDA 4J0RA 2MJVB 4YH3A 5DW1A 2KTBB 5AMFA 5E9MA 5DKHA 4LC2A 4YYDA 5CUEA 5FDZA 2RNYA 5A83A 4ZW1A 5EWCA 4CURA 5CQ3A 5I40A 2R0YA 5EU1A 4X2IA 4A9FA 5C89A 4O78A 5CUDA 2L5EA 5HQ6A 4HBXA 4LZSA 4A9JA 5J0DA 3S92A 4IR3A 2I7KA 4O75A 4TZ8A 4HXMA 4N4IA 2YW5A 4MEOA 4MR3A 4YY6A 4HXSA 3GG3A 5HEMA 2WP1A 1ZKRA 5D3NA 4Z6HA 2YELA 4XYAA 4NQMA 4QSSA 5ETBA 4TS8A 2R0SA 5LVQA 2RO1A 4QYDA 4J3IA 4OGJA 4UYEA 5CQ6A 3QZTA 4QR4A 4Z1SA 2E3KA 5TCMA 5KTWA 5FG5A 5EWHA 4YYGA 4A9LA 3MB3A 5EGUA 5D3JA 5HM0A 4NUCA 5FB0A 4NR5A 4BW2A 4UYHA 4YYMA 4IOOA 4YYIA 4WIVA 5L8UA 3ZYUA 5DKDA 4LYWA 5D3HA 4XY9A 4IR4A 4RVRA 4NR6A 5F2PA 4YBMA 5HFQA 4ALGA 3SVHA 4CUUA 3JVKA 4LZRA 4O72A 5CTLA 5G4RA 4QSTA 4O76A 3D1BA 5ENEA 2GRCA 5C4QA 5COIA 4HXPA 5C87A 2F6NA 5E0RA 3P1CA 4NR7A 3UVYA 5FE5A 5E3GA 1ZS5A 5LJ0A 3U5MA 4HBYA 4QSUA 4E96A 5I1QA 4Q0NA 4CUTA 5C8GA 5IGLA 5EWWA 4Z1QA 5LJ2A 3VKHA 5E9YA 5HRVA 5HCLA 5D3PA 4NR9A 4AKNA 5D3LA 4KCXA 4AKIA 4YABA 1N72A 4HBVA 4YBTA 4QSWA 5KTUA 5JWMA 3P1FA 4QC1A 3LXJA 4QNSA 5KU3A 5LKZA 4TQNA 4QSXA 5DFDA 5D26A 4O7BA 5A81A 1EQFA 3MULA 4PKLA 5FH8A 3U5NA 3I3JA 5DX4A 4QSPA 4O77A 5EWDA 5F61A 4DONA 4QEVA 3O36A 4LYSA 3MB4A 4HBWA 4QEWA 5I29A 4AKHA 4A9OA 3RCWA 2RFJA 5EPSA 5ACYA 3HMEA 3UV5A 4YH4A 4UIXA 2L84A 4O70A 5H1TA 3DWYA 4NXJA 5CQ8A 5FE4A 5ETDA 4YBSA 5BT3A 2DVRA 5EM3A 4ZQLA 3P1DA 5FG4A 3Q2FA 4Z6IA 5EP7A 3UVWA 5EQ1A 2YDWA 4A9EA 4QEUA 4Y03A 4YYKA 5HENA 2R0VA 3P1EA 4IORA 2YYNA 4Z93A 4QUTA 5F63A 4YYJA 5FB1A 4QC3A 5F62A 1JSPB 4A9MA 5DYUA 3U5JA 4O71A 4YAXA 5L8TA 4BW3A 3MXFA 5C7NA 5CRMA 3UVXA 5HQ7A 5FE0A 5L99A 5EK9A 5F25A 4ALHA 4BJXA 5II1A 5FE1A 3ERRA 5E74A 4YY4A 4PCEA 5LKUA 4N4GA 5HLSA 4N4FA 5KHMA 3SVFA 3G0LA 4NRAA 5DW2A 5E3DA 4UYFB 5D3TA 2D9EA 4BHWA 5EISA 4QSRA 4WHWA 4YYNA 4UYGA 2DVVA 2OSSA 5L97A 3K2JA 5D24A 5FFYA 5FFVA 4TYLA 3O34A 2I8NA 5DLXA 5ENHA 4MR6A 4QYLA 4XY8A 5IGNA 2G4AA 4KV4A 4A9HA 5TB6A 4IR6A 2OUOA 4QBMA 4YK0A 4LR6A 4NR4A 5HFRA 5FE8A 4TT2A 4NS5A 4UIWA 5HJCA 5CUBA 4HXKA 5DY7A 5EI4A 4CFKA 5A7CA 4CUQA 5IGMA 5I88A 4CUPA 5FE6A 4LYIA 3LJWA 4QSVA 5BT5A 4YC9A 5A5PA 3AADA 5FE2A 2RNWA 5G4SA 4XUBA 5A5SA 5HRXA 5LKXA 4IOQA 4QUUA 4O74A 3MUKA 3S91A 4UIVA 5FE9A 5F5ZA 3U5KA 3U5LA 4NRCA 4PY6A 1X0JA 4CLBA 4NUDA 5IG6A 4N4HA 5E9LA 2DVSA 4CUSA 3LQJA 5D25A 5FE3A 5FBXA 5E7DA 3JVJA 4TU4A 4LZ2A 5CZGA 4NYVA 4UYFA 5F3AA 5CRZA 3MQMA 5FH7A 3ONIA 4UITA 4A9IA 2LSPB 5HQ5A 4MENA 3D7CA 4HXRA 5A5QA 5FH6A 4QSQA 1PUOA 4FLPA 5II2A 3U5OA 5I7YA 5CQ5A 4O7FA 3DAIA 5CPEA 5CQAA 5DYCA 5LVRA 5CQ7A 4HXOA 5CQTA 4CL9A 5ENGA 5I86A 5K29A 2FSAA 3NXBA 4YATA 4LDFA 1F68A 4OUFA 4KV1A 5E73A 5F60A 3UV4A 5D0CA 4O7CA 1E6IA 5FE7A 4Q0OA 4WHUA 5DYAA 5A5RA 4J1PA 2L85A 5DKCA 5LKTA 3D1DA 2WP2A 5ENCA 4TTEA 4UIUA 5AD2A 1JM4B 3LQIA 5HELA 2D82A 5EVAA 4BW1A 2DKWA 4YYHA 4NQNA 2YEMA 4HXNA 2H60A 4QZSA 5ENIA 4QY4A 3UVDA 5CP5A 4GPJA 4NYXA 4QB3A 3HMFA 2E7NA 4NR8A 5JI8A 5EICA 5EA1A 5E9KA 3UW9A 3IU6A 4TT6A 2E7OA 3FKMX 2RNXA 2DWWA 3VKGA
chains in the Genus database with same CATH topology
4NUEA 5CUGA 4F3IA 4PS5A 4PCIA 4A9KA 5CUAA 4O7EA 4MR5A 4HXLA 4BW4A 5DFCA 5F1HA 5LUUA 2RS9B 5AMEA 4TZ2A 4UIYA 4NYWA 2N9GA 5C85A 4MR4A 4XUAA 5EWVA 3U5PA 5DFBA 3QZVA 4UYDA 5CFWA 4YADA 5ENJA 5FFWA 5AD3A 5A85A 5EPRA 5BT4A 5CQ4A 5EPBA 2YEKA 5CS8A 1WUMA 4PTBA 5D7XA 2DVQA 2RI7A 5HRWA 4NRBA 5IBNA 3QZSA 5D3RA 2NXBA 4UIZA 4IR5A 5E9VA 3G0JA 5I7XA 5KTXA 3O37A 5E9IA 4QR3A 4ZC9A 5EV9A 4TU6A 4MEQA 5CGPA 5DLZA 5L98A 5ENFA 4CFLA 5A82A 4MEPA 5FG6A 5I83A 3JVLA 4C67A 4O7AA 5F1LA 2R10A 5I89A 4OGIA 5F36A 3SVGA 5CY9A 5DBMA 5I80A 3AQAA 2YQDA 5ENBA 3IU5A 5H1VA 3O35A 4TT4A 4N3WA 1WUGA 2OO1A 3Q2EA 2F6JA 3P5OA 3TLPA 3UV2A 4A9NA 3O33A 5IGKA 4QR5A 5A5NA 3LQHA 5H1UA 4LRGA 3HMHA 2DATA 5D3SA 5DYXA 4C66A 5A5OA 5KO4A 4J0SA 5CUCA 3JVMA 5LJ1A 5L96A 5CU8A 5H85A 5IIDA 4J0RA 2MJVB 4YH3A 5DW1A 2KTBB 5AMFA 5E9MA 5DKHA 4LC2A 4YYDA 5CUEA 5FDZA 2RNYA 5A83A 4ZW1A 5EWCA 4CURA 5CQ3A 5I40A 2R0YA 5EU1A 4X2IA 4A9FA 5C89A 4O78A 5CUDA 2L5EA 5HQ6A 4HBXA 4LZSA 4A9JA 5J0DA 3S92A 4IR3A 2I7KA 4O75A 4TZ8A 4HXMA 4N4IA 2YW5A 4MEOA 4MR3A 4YY6A 4HXSA 3GG3A 5HEMA 2WP1A 5D3NA 4Z6HA 2YELA 4XYAA 4NQMA 4QSSA 5ETBA 4TS8A 2R0SA 5LVQA 2RO1A 4QYDA 4J3IA 4OGJA 4UYEA 5CQ6A 3QZTA 4QR4A 4Z1SA 2E3KA 5TCMA 5KTWA 5FG5A 5EWHA 4YYGA 4A9LA 3MB3A 5EGUA 5D3JA 5HM0A 4NUCA 5FB0A 4NR5A 4BW2A 4UYHA 4YYMA 4IOOA 4YYIA 4WIVA 5L8UA 3ZYUA 5DKDA 4LYWA 5D3HA 4XY9A 4IR4A 4RVRA 4NR6A 5F2PA 4YBMA 5HFQA 4ALGA 3SVHA 4CUUA 3JVKA 4LZRA 4O72A 5CTLA 5G4RA 4QSTA 4O76A 5ENEA 2GRCA 5C4QA 5COIA 4HXPA 5C87A 2F6NA 5E0RA 3P1CA 4NR7A 3UVYA 5FE5A 5E3GA 1ZS5A 5LJ0A 3U5MA 4HBYA 4QSUA 4E96A 5I1QA 4Q0NA 4CUTA 5C8GA 5IGLA 5EWWA 4Z1QA 5LJ2A 5E9YA 5HRVA 5HCLA 5D3PA 4NR9A 4AKNA 5D3LA 4KCXA 4YABA 1N72A 4HBVA 4YBTA 4QSWA 5KTUA 5JWMA 3P1FA 4QC1A 3LXJA 4QNSA 5KU3A 5LKZA 4TQNA 4QSXA 5DFDA 5D26A 4O7BA 5A81A 1EQFA 3MULA 4PKLA 5FH8A 3U5NA 3I3JA 5DX4A 4QSPA 4O77A 5EWDA 5F61A 4DONA 4QEVA 3O36A 4LYSA 3MB4A 4HBWA 4QEWA 5I29A 4A9OA 3RCWA 2RFJA 5EPSA 5ACYA 3HMEA 3UV5A 4YH4A 4UIXA 2L84A 4O70A 5H1TA 3DWYA 4NXJA 5CQ8A 5FE4A 5ETDA 4YBSA 5BT3A 2DVRA 5EM3A 4ZQLA 3P1DA 5FG4A 3Q2FA 4Z6IA 5EP7A 3UVWA 5EQ1A 2YDWA 4A9EA 4QEUA 4Y03A 4YYKA 5HENA 2R0VA 3P1EA 4IORA 2YYNA 4Z93A 4QUTA 5F63A 4YYJA 5FB1A 4QC3A 5F62A 1JSPB 4A9MA 5DYUA 3U5JA 4O71A 4YAXA 5L8TA 4BW3A 3MXFA 5C7NA 5CRMA 3UVXA 5HQ7A 5FE0A 5L99A 5EK9A 5F25A 4ALHA 4BJXA 5II1A 5FE1A 5E74A 4YY4A 4PCEA 5LKUA 4N4GA 5HLSA 4N4FA 5KHMA 3SVFA 3G0LA 4NRAA 5DW2A 5E3DA 4UYFB 5D3TA 2D9EA 4BHWA 5EISA 4QSRA 4WHWA 4YYNA 4UYGA 2DVVA 2OSSA 5L97A 3K2JA 5D24A 5FFYA 5FFVA 4TYLA 3O34A 2I8NA 5DLXA 5ENHA 4MR6A 4QYLA 4XY8A 5IGNA 2G4AA 4KV4A 4A9HA 5TB6A 4IR6A 2OUOA 4QBMA 4YK0A 4LR6A 4NR4A 5HFRA 5FE8A 4TT2A 4NS5A 4UIWA 5HJCA 5CUBA 4HXKA 5DY7A 5EI4A 4CFKA 5A7CA 4CUQA 5IGMA 5I88A 4CUPA 5FE6A 4LYIA 3LJWA 4QSVA 5BT5A 4YC9A 5A5PA 3AADA 5FE2A 2RNWA 5G4SA 4XUBA 5A5SA 5HRXA 5LKXA 4IOQA 4QUUA 4O74A 3MUKA 3S91A 4UIVA 5FE9A 5F5ZA 3U5KA 3U5LA 4NRCA 4PY6A 1X0JA 4CLBA 4NUDA 5IG6A 4N4HA 5E9LA 2DVSA 4CUSA 3LQJA 5D25A 5FE3A 5FBXA 5E7DA 3JVJA 4TU4A 4LZ2A 5CZGA 4NYVA 4UYFA 5F3AA 5CRZA 3MQMA 5FH7A 3ONIA 4UITA 4A9IA 2LSPB 5HQ5A 4MENA 3D7CA 4HXRA 5A5QA 5FH6A 4QSQA 4FLPA 5II2A 3U5OA 5I7YA 5CQ5A 4O7FA 3DAIA 5CPEA 5CQAA 5DYCA 5LVRA 5CQ7A 4HXOA 5CQTA 4CL9A 5ENGA 5I86A 5K29A 2FSAA 3NXBA 4YATA 4LDFA 1F68A 4OUFA 4KV1A 5E73A 5F60A 3UV4A 5D0CA 4O7CA 1E6IA 5FE7A 4Q0OA 4WHUA 5DYAA 5A5RA 4J1PA 2L85A 5DKCA 5LKTA 2WP2A 5ENCA 4TTEA 4UIUA 5AD2A 1JM4B 3LQIA 5HELA 2D82A 5EVAA 4BW1A 2DKWA 4YYHA 4NQNA 2YEMA 4HXNA 2H60A 4QZSA 5ENIA 4QY4A 3UVDA 5CP5A 4GPJA 4NYXA 4QB3A 3HMFA 2E7NA 4NR8A 5JI8A 5EICA 5EA1A 5E9KA 3UW9A 3IU6A 4TT6A 2E7OA 3FKMX 2RNXA 2DWWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NUE A;  5CUG A;  4F3I A;  4PS5 A;  4PCI A;  4A9K A;  5CUA A;  4O7E A;  4MR5 A;  4HXL A;  4BW4 A;  5DFC A;  5F1H A;  5LUU A;  2RS9 B;  5AME A;  4TZ2 A;  4UIY A;  4NYW A;  2N9G A;  5C85 A;  4MR4 A;  4XUA A;  5EWV A;  3U5P A;  5DFB A;  3QZV A;  4UYD A;  5CFW A;  4YAD A;  5ENJ A;  5FFW A;  5AD3 A;  5A85 A;  5EPR A;  5BT4 A;  5CQ4 A;  5EPB A;  2YEK A;  5CS8 A;  1WUM A;  4PTB A;  5D7X A;  2DVQ A;  2RI7 A;  5HRW A;  4NRB A;  5IBN A;  3QZS A;  5D3R A;  2NXB A;  4UIZ A;  4IR5 A;  5E9V A;  3G0J A;  5I7X A;  5KTX A;  3O37 A;  5E9I A;  4QR3 A;  4ZC9 A;  5EV9 A;  4TU6 A;  4MEQ A;  5CGP A;  5DLZ A;  5L98 A;  5ENF A;  4CFL A;  5A82 A;  4MEP A;  5FG6 A;  5I83 A;  3JVL A;  4C67 A;  4O7A A;  5F1L A;  2R10 A;  5I89 A;  4OGI A;  5F36 A;  3SVG A;  5CY9 A;  5DBM A;  5I80 A;  3AQA A;  2YQD A;  5ENB A;  3IU5 A;  5H1V A;  3O35 A;  4TT4 A;  4N3W A;  1WUG A;  2OO1 A;  3Q2E A;  2F6J A;  3P5O A;  3TLP A;  3UV2 A;  4A9N A;  3O33 A;  5IGK A;  4QR5 A;  5A5N A;  3LQH A;  5H1U A;  4LRG A;  3HMH A;  2DAT A;  5D3S A;  5DYX A;  4C66 A;  5A5O A;  5KO4 A;  4J0S A;  5CUC A;  3JVM A;  5LJ1 A;  5L96 A;  5CU8 A;  5H85 A;  5IID A;  4J0R A;  2MJV B;  4YH3 A;  5DW1 A;  2KTB B;  5AMF A;  5E9M A;  5DKH A;  4LC2 A;  4YYD A;  5CUE A;  5FDZ A;  2RNY A;  5A83 A;  4ZW1 A;  5EWC A;  4CUR A;  5CQ3 A;  5I40 A;  2R0Y A;  5EU1 A;  4X2I A;  4A9F A;  5C89 A;  4O78 A;  5CUD A;  2L5E A;  5HQ6 A;  4HBX A;  4LZS A;  4A9J A;  5J0D A;  3S92 A;  4IR3 A;  2I7K A;  4O75 A;  4TZ8 A;  4HXM A;  4N4I A;  2YW5 A;  4MEO A;  4MR3 A;  4YY6 A;  4HXS A;  3GG3 A;  5HEM A;  2WP1 A;  5D3N A;  4Z6H A;  2YEL A;  4XYA A;  4NQM A;  4QSS A;  5ETB A;  4TS8 A;  2R0S A;  5LVQ A;  2RO1 A;  4QYD A;  4J3I A;  4OGJ A;  4UYE A;  5CQ6 A;  3QZT A;  4QR4 A;  4Z1S A;  2E3K A;  5TCM A;  5KTW A;  5FG5 A;  5EWH A;  4YYG A;  4A9L A;  3MB3 A;  5EGU A;  5D3J A;  5HM0 A;  4NUC A;  5FB0 A;  4NR5 A;  4BW2 A;  4UYH A;  4YYM A;  4IOO A;  4YYI A;  4WIV A;  5L8U A;  3ZYU A;  5DKD A;  4LYW A;  5D3H A;  4XY9 A;  4IR4 A;  4RVR A;  4NR6 A;  5F2P A;  4YBM A;  5HFQ A;  4ALG A;  3SVH A;  4CUU A;  3JVK A;  4LZR A;  4O72 A;  5CTL A;  5G4R A;  4QST A;  4O76 A;  5ENE A;  2GRC A;  5C4Q A;  5COI A;  4HXP A;  5C87 A;  2F6N A;  5E0R A;  3P1C A;  4NR7 A;  3UVY A;  5FE5 A;  5E3G A;  1ZS5 A;  5LJ0 A;  3U5M A;  4HBY A;  4QSU A;  4E96 A;  5I1Q A;  4Q0N A;  4CUT A;  5C8G A;  5IGL A;  5EWW A;  4Z1Q A;  5LJ2 A;  5E9Y A;  5HRV A;  5HCL A;  5D3P A;  4NR9 A;  4AKN A;  5D3L A;  4KCX A;  4YAB A;  1N72 A;  4HBV A;  4YBT A;  4QSW A;  5KTU A;  5JWM A;  3P1F A;  4QC1 A;  3LXJ A;  4QNS A;  5KU3 A;  5LKZ A;  4TQN A;  4QSX A;  5DFD A;  5D26 A;  4O7B A;  5A81 A;  1EQF A;  3MUL A;  4PKL A;  5FH8 A;  3U5N A;  3I3J A;  5DX4 A;  4QSP A;  4O77 A;  5EWD A;  5F61 A;  4DON A;  4QEV A;  3O36 A;  4LYS A;  3MB4 A;  4HBW A;  4QEW A;  5I29 A;  4A9O A;  3RCW A;  2RFJ A;  5EPS A;  5ACY A;  3HME A;  3UV5 A;  4YH4 A;  4UIX A;  2L84 A;  4O70 A;  5H1T A;  3DWY A;  4NXJ A;  5CQ8 A;  5FE4 A;  5ETD A;  4YBS A;  5BT3 A;  2DVR A;  5EM3 A;  4ZQL A;  3P1D A;  5FG4 A;  3Q2F A;  4Z6I A;  5EP7 A;  3UVW A;  5EQ1 A;  2YDW A;  4A9E A;  4QEU A;  4Y03 A;  4YYK A;  5HEN A;  2R0V A;  3P1E A;  4IOR A;  2YYN A;  4Z93 A;  4QUT A;  5F63 A;  4YYJ A;  5FB1 A;  4QC3 A;  5F62 A;  1JSP B;  4A9M A;  5DYU A;  3U5J A;  4O71 A;  4YAX A;  5L8T A;  4BW3 A;  3MXF A;  5C7N A;  5CRM A;  3UVX A;  5HQ7 A;  5FE0 A;  5L99 A;  5EK9 A;  5F25 A;  4ALH A;  4BJX A;  5II1 A;  5FE1 A;  5E74 A;  4YY4 A;  4PCE A;  5LKU A;  4N4G A;  5HLS A;  4N4F A;  5KHM A;  3SVF A;  3G0L A;  4NRA A;  5DW2 A;  5E3D A;  4UYF B;  5D3T A;  2D9E A;  4BHW A;  5EIS A;  4QSR A;  4WHW A;  4YYN A;  4UYG A;  2DVV A;  2OSS A;  5L97 A;  3K2J A;  5D24 A;  5FFY A;  5FFV A;  4TYL A;  3O34 A;  2I8N A;  5DLX A;  5ENH A;  4MR6 A;  4QYL A;  4XY8 A;  5IGN A;  2G4A A;  4KV4 A;  4A9H A;  5TB6 A;  4IR6 A;  2OUO A;  4QBM A;  4YK0 A;  4LR6 A;  4NR4 A;  5HFR A;  5FE8 A;  4TT2 A;  4NS5 A;  4UIW A;  5HJC A;  5CUB A;  4HXK A;  5DY7 A;  5EI4 A;  4CFK A;  5A7C A;  4CUQ A;  5IGM A;  5I88 A;  4CUP A;  5FE6 A;  4LYI A;  3LJW A;  4QSV A;  5BT5 A;  4YC9 A;  5A5P A;  3AAD A;  5FE2 A;  2RNW A;  5G4S A;  4XUB A;  5A5S A;  5HRX A;  5LKX A;  4IOQ A;  4QUU A;  4O74 A;  3MUK A;  3S91 A;  4UIV A;  5FE9 A;  5F5Z A;  3U5K A;  3U5L A;  4NRC A;  4PY6 A;  1X0J A;  4CLB A;  4NUD A;  5IG6 A;  4N4H A;  5E9L A;  2DVS A;  4CUS A;  3LQJ A;  5D25 A;  5FE3 A;  5FBX A;  5E7D A;  3JVJ A;  4TU4 A;  4LZ2 A;  5CZG A;  4NYV A;  4UYF A;  5F3A A;  5CRZ A;  3MQM A;  5FH7 A;  3ONI A;  4UIT A;  4A9I A;  2LSP B;  5HQ5 A;  4MEN A;  3D7C A;  4HXR A;  5A5Q A;  5FH6 A;  4QSQ A;  4FLP A;  5II2 A;  3U5O A;  5I7Y A;  5CQ5 A;  4O7F A;  3DAI A;  5CPE A;  5CQA A;  5DYC A;  5LVR A;  5CQ7 A;  4HXO A;  5CQT A;  4CL9 A;  5ENG A;  5I86 A;  5K29 A;  2FSA A;  3NXB A;  4YAT A;  4LDF A;  1F68 A;  4OUF A;  4KV1 A;  5E73 A;  5F60 A;  3UV4 A;  5D0C A;  4O7C A;  1E6I A;  5FE7 A;  4Q0O A;  4WHU A;  5DYA A;  5A5R A;  4J1P A;  2L85 A;  5DKC A;  5LKT A;  2WP2 A;  5ENC A;  4TTE A;  4UIU A;  5AD2 A;  1JM4 B;  3LQI A;  5HEL A;  2D82 A;  5EVA A;  4BW1 A;  2DKW A;  4YYH A;  4NQN A;  2YEM A;  4HXN A;  2H60 A;  4QZS A;  5ENI A;  4QY4 A;  3UVD A;  5CP5 A;  4GPJ A;  4NYX A;  4QB3 A;  3HMF A;  2E7N A;  4NR8 A;  5JI8 A;  5EIC A;  5EA1 A;  5E9K A;  3UW9 A;  3IU6 A;  4TT6 A;  2E7O A;  3FKM X;  2RNX A;  2DWW A; 
#chains in the Genus database with same CATH topology
 4NUE A;  5CUG A;  4F3I A;  4PS5 A;  4PCI A;  4A9K A;  5CUA A;  4O7E A;  4MR5 A;  4HXL A;  4BW4 A;  5DFC A;  5F1H A;  5LUU A;  2RS9 B;  5AME A;  4TZ2 A;  4UIY A;  4NYW A;  2N9G A;  5C85 A;  4MR4 A;  4XUA A;  5EWV A;  3U5P A;  5DFB A;  3QZV A;  4UYD A;  5CFW A;  4YAD A;  5ENJ A;  5FFW A;  5AD3 A;  5A85 A;  5EPR A;  5BT4 A;  5CQ4 A;  5EPB A;  2YEK A;  5CS8 A;  1WUM A;  4PTB A;  5D7X A;  2DVQ A;  2RI7 A;  5HRW A;  4NRB A;  5IBN A;  3QZS A;  5D3R A;  2NXB A;  4UIZ A;  4IR5 A;  5E9V A;  3G0J A;  5I7X A;  5KTX A;  3O37 A;  5E9I A;  4QR3 A;  4ZC9 A;  5EV9 A;  4TU6 A;  4MEQ A;  5CGP A;  5DLZ A;  5L98 A;  4AKG A;  5ENF A;  4CFL A;  5A82 A;  4MEP A;  5FG6 A;  5I83 A;  3JVL A;  4C67 A;  4O7A A;  5F1L A;  2R10 A;  5I89 A;  4OGI A;  5F36 A;  3SVG A;  5CY9 A;  2EJN A;  5DBM A;  5I80 A;  3AQA A;  2YQD A;  5ENB A;  3IU5 A;  5H1V A;  3O35 A;  4TT4 A;  4N3W A;  1WUG A;  2OO1 A;  3Q2E A;  2F6J A;  3P5O A;  3TLP A;  3UV2 A;  4A9N A;  4AI6 A;  3O33 A;  5IGK A;  4QR5 A;  5A5N A;  3LQH A;  5H1U A;  4LRG A;  3HMH A;  2DAT A;  5D3S A;  5DYX A;  4C66 A;  5A5O A;  5KO4 A;  4J0S A;  5CUC A;  3JVM A;  5LJ1 A;  5L96 A;  5CU8 A;  5H85 A;  5IID A;  4J0R A;  2MJV B;  4YH3 A;  5DW1 A;  2KTB B;  5AMF A;  5E9M A;  5DKH A;  4LC2 A;  4YYD A;  5CUE A;  5FDZ A;  2RNY A;  5A83 A;  4ZW1 A;  5EWC A;  4CUR A;  5CQ3 A;  5I40 A;  2R0Y A;  5EU1 A;  4X2I A;  4A9F A;  5C89 A;  4O78 A;  5CUD A;  2L5E A;  5HQ6 A;  4HBX A;  4LZS A;  4A9J A;  5J0D A;  3S92 A;  4IR3 A;  2I7K A;  4O75 A;  4TZ8 A;  4HXM A;  4N4I A;  2YW5 A;  4MEO A;  4MR3 A;  4YY6 A;  4HXS A;  3GG3 A;  5HEM A;  2WP1 A;  1ZKR A;  5D3N A;  4Z6H A;  2YEL A;  4XYA A;  4NQM A;  4QSS A;  5ETB A;  4TS8 A;  2R0S A;  5LVQ A;  2RO1 A;  4QYD A;  4J3I A;  4OGJ A;  4UYE A;  5CQ6 A;  3QZT A;  4QR4 A;  4Z1S A;  2E3K A;  5TCM A;  5KTW A;  5FG5 A;  5EWH A;  4YYG A;  4A9L A;  3MB3 A;  5EGU A;  5D3J A;  5HM0 A;  4NUC A;  5FB0 A;  4NR5 A;  4BW2 A;  4UYH A;  4YYM A;  4IOO A;  4YYI A;  4WIV A;  5L8U A;  3ZYU A;  5DKD A;  4LYW A;  5D3H A;  4XY9 A;  4IR4 A;  4RVR A;  4NR6 A;  5F2P A;  4YBM A;  5HFQ A;  4ALG A;  3SVH A;  4CUU A;  3JVK A;  4LZR A;  4O72 A;  5CTL A;  5G4R A;  4QST A;  4O76 A;  3D1B A;  5ENE A;  2GRC A;  5C4Q A;  5COI A;  4HXP A;  5C87 A;  2F6N A;  5E0R A;  3P1C A;  4NR7 A;  3UVY A;  5FE5 A;  5E3G A;  1ZS5 A;  5LJ0 A;  3U5M A;  4HBY A;  4QSU A;  4E96 A;  5I1Q A;  4Q0N A;  4CUT A;  5C8G A;  5IGL A;  5EWW A;  4Z1Q A;  5LJ2 A;  3VKH A;  5E9Y A;  5HRV A;  5HCL A;  5D3P A;  4NR9 A;  4AKN A;  5D3L A;  4KCX A;  4AKI A;  4YAB A;  1N72 A;  4HBV A;  4YBT A;  4QSW A;  5KTU A;  5JWM A;  3P1F A;  4QC1 A;  3LXJ A;  4QNS A;  5KU3 A;  5LKZ A;  4TQN A;  4QSX A;  5DFD A;  5D26 A;  4O7B A;  5A81 A;  1EQF A;  3MUL A;  4PKL A;  5FH8 A;  3U5N A;  3I3J A;  5DX4 A;  4QSP A;  4O77 A;  5EWD A;  5F61 A;  4DON A;  4QEV A;  3O36 A;  4LYS A;  3MB4 A;  4HBW A;  4QEW A;  5I29 A;  4AKH A;  4A9O A;  3RCW A;  2RFJ A;  5EPS A;  5ACY A;  3HME A;  3UV5 A;  4YH4 A;  4UIX A;  2L84 A;  4O70 A;  5H1T A;  3DWY A;  4NXJ A;  5CQ8 A;  5FE4 A;  5ETD A;  4YBS A;  5BT3 A;  2DVR A;  5EM3 A;  4ZQL A;  3P1D A;  5FG4 A;  3Q2F A;  4Z6I A;  5EP7 A;  3UVW A;  5EQ1 A;  2YDW A;  4A9E A;  4QEU A;  4Y03 A;  4YYK A;  5HEN A;  2R0V A;  3P1E A;  4IOR A;  2YYN A;  4Z93 A;  4QUT A;  5F63 A;  4YYJ A;  5FB1 A;  4QC3 A;  5F62 A;  1JSP B;  4A9M A;  5DYU A;  3U5J A;  4O71 A;  4YAX A;  5L8T A;  4BW3 A;  3MXF A;  5C7N A;  5CRM A;  3UVX A;  5HQ7 A;  5FE0 A;  5L99 A;  5EK9 A;  5F25 A;  4ALH A;  4BJX A;  5II1 A;  5FE1 A;  3ERR A;  5E74 A;  4YY4 A;  4PCE A;  5LKU A;  4N4G A;  5HLS A;  4N4F A;  5KHM A;  3SVF A;  3G0L A;  4NRA A;  5DW2 A;  5E3D A;  4UYF B;  5D3T A;  2D9E A;  4BHW A;  5EIS A;  4QSR A;  4WHW A;  4YYN A;  4UYG A;  2DVV A;  2OSS A;  5L97 A;  3K2J A;  5D24 A;  5FFY A;  5FFV A;  4TYL A;  3O34 A;  2I8N A;  5DLX A;  5ENH A;  4MR6 A;  4QYL A;  4XY8 A;  5IGN A;  2G4A A;  4KV4 A;  4A9H A;  5TB6 A;  4IR6 A;  2OUO A;  4QBM A;  4YK0 A;  4LR6 A;  4NR4 A;  5HFR A;  5FE8 A;  4TT2 A;  4NS5 A;  4UIW A;  5HJC A;  5CUB A;  4HXK A;  5DY7 A;  5EI4 A;  4CFK A;  5A7C A;  4CUQ A;  5IGM A;  5I88 A;  4CUP A;  5FE6 A;  4LYI A;  3LJW A;  4QSV A;  5BT5 A;  4YC9 A;  5A5P A;  3AAD A;  5FE2 A;  2RNW A;  5G4S A;  4XUB A;  5A5S A;  5HRX A;  5LKX A;  4IOQ A;  4QUU A;  4O74 A;  3MUK A;  3S91 A;  4UIV A;  5FE9 A;  5F5Z A;  3U5K A;  3U5L A;  4NRC A;  4PY6 A;  1X0J A;  4CLB A;  4NUD A;  5IG6 A;  4N4H A;  5E9L A;  2DVS A;  4CUS A;  3LQJ A;  5D25 A;  5FE3 A;  5FBX A;  5E7D A;  3JVJ A;  4TU4 A;  4LZ2 A;  5CZG A;  4NYV A;  4UYF A;  5F3A A;  5CRZ A;  3MQM A;  5FH7 A;  3ONI A;  4UIT A;  4A9I A;  2LSP B;  5HQ5 A;  4MEN A;  3D7C A;  4HXR A;  5A5Q A;  5FH6 A;  4QSQ A;  1PUO A;  4FLP A;  5II2 A;  3U5O A;  5I7Y A;  5CQ5 A;  4O7F A;  3DAI A;  5CPE A;  5CQA A;  5DYC A;  5LVR A;  5CQ7 A;  4HXO A;  5CQT A;  4CL9 A;  5ENG A;  5I86 A;  5K29 A;  2FSA A;  3NXB A;  4YAT A;  4LDF A;  1F68 A;  4OUF A;  4KV1 A;  5E73 A;  5F60 A;  3UV4 A;  5D0C A;  4O7C A;  1E6I A;  5FE7 A;  4Q0O A;  4WHU A;  5DYA A;  5A5R A;  4J1P A;  2L85 A;  5DKC A;  5LKT A;  3D1D A;  2WP2 A;  5ENC A;  4TTE A;  4UIU A;  5AD2 A;  1JM4 B;  3LQI A;  5HEL A;  2D82 A;  5EVA A;  4BW1 A;  2DKW A;  4YYH A;  4NQN A;  2YEM A;  4HXN A;  2H60 A;  4QZS A;  5ENI A;  4QY4 A;  3UVD A;  5CP5 A;  4GPJ A;  4NYX A;  4QB3 A;  3HMF A;  2E7N A;  4NR8 A;  5JI8 A;  5EIC A;  5EA1 A;  5E9K A;  3UW9 A;  3IU6 A;  4TT6 A;  2E7O A;  3FKM X;  2RNX A;  2DWW A;  3VKG A; 
#chains in the Genus database with same CATH homology
 4NUE A;  5CUG A;  4F3I A;  4PS5 A;  4PCI A;  4A9K A;  5CUA A;  4O7E A;  4MR5 A;  4HXL A;  4BW4 A;  5DFC A;  5F1H A;  5LUU A;  2RS9 B;  5AME A;  4TZ2 A;  4UIY A;  4NYW A;  2N9G A;  5C85 A;  4MR4 A;  4XUA A;  5EWV A;  3U5P A;  5DFB A;  3QZV A;  4UYD A;  5CFW A;  4YAD A;  5ENJ A;  5FFW A;  5AD3 A;  5A85 A;  5EPR A;  5BT4 A;  5CQ4 A;  5EPB A;  2YEK A;  5CS8 A;  1WUM A;  4PTB A;  5D7X A;  2DVQ A;  2RI7 A;  5HRW A;  4NRB A;  5IBN A;  3QZS A;  5D3R A;  2NXB A;  4UIZ A;  4IR5 A;  5E9V A;  3G0J A;  5I7X A;  5KTX A;  3O37 A;  5E9I A;  4QR3 A;  4ZC9 A;  5EV9 A;  4TU6 A;  4MEQ A;  5CGP A;  5DLZ A;  5L98 A;  5ENF A;  4CFL A;  5A82 A;  4MEP A;  5FG6 A;  5I83 A;  3JVL A;  4C67 A;  4O7A A;  5F1L A;  2R10 A;  5I89 A;  4OGI A;  5F36 A;  3SVG A;  5CY9 A;  5DBM A;  5I80 A;  3AQA A;  2YQD A;  5ENB A;  3IU5 A;  5H1V A;  3O35 A;  4TT4 A;  4N3W A;  1WUG A;  2OO1 A;  3Q2E A;  2F6J A;  3P5O A;  3TLP A;  3UV2 A;  4A9N A;  3O33 A;  5IGK A;  4QR5 A;  5A5N A;  3LQH A;  5H1U A;  4LRG A;  3HMH A;  2DAT A;  5D3S A;  5DYX A;  4C66 A;  5A5O A;  5KO4 A;  4J0S A;  5CUC A;  3JVM A;  5LJ1 A;  5L96 A;  5CU8 A;  5H85 A;  5IID A;  4J0R A;  2MJV B;  4YH3 A;  5DW1 A;  2KTB B;  5AMF A;  5E9M A;  5DKH A;  4LC2 A;  4YYD A;  5CUE A;  5FDZ A;  2RNY A;  5A83 A;  4ZW1 A;  5EWC A;  4CUR A;  5CQ3 A;  5I40 A;  2R0Y A;  5EU1 A;  4X2I A;  4A9F A;  5C89 A;  4O78 A;  5CUD A;  2L5E A;  5HQ6 A;  4HBX A;  4LZS A;  4A9J A;  5J0D A;  3S92 A;  4IR3 A;  2I7K A;  4O75 A;  4TZ8 A;  4HXM A;  4N4I A;  2YW5 A;  4MEO A;  4MR3 A;  4YY6 A;  4HXS A;  3GG3 A;  5HEM A;  2WP1 A;  5D3N A;  4Z6H A;  2YEL A;  4XYA A;  4NQM A;  4QSS A;  5ETB A;  4TS8 A;  2R0S A;  5LVQ A;  2RO1 A;  4QYD A;  4J3I A;  4OGJ A;  4UYE A;  5CQ6 A;  3QZT A;  4QR4 A;  4Z1S A;  2E3K A;  5TCM A;  5KTW A;  5FG5 A;  5EWH A;  4YYG A;  4A9L A;  3MB3 A;  5EGU A;  5D3J A;  5HM0 A;  4NUC A;  5FB0 A;  4NR5 A;  4BW2 A;  4UYH A;  4YYM A;  4IOO A;  4YYI A;  4WIV A;  5L8U A;  3ZYU A;  5DKD A;  4LYW A;  5D3H A;  4XY9 A;  4IR4 A;  4RVR A;  4NR6 A;  5F2P A;  4YBM A;  5HFQ A;  4ALG A;  3SVH A;  4CUU A;  3JVK A;  4LZR A;  4O72 A;  5CTL A;  5G4R A;  4QST A;  4O76 A;  5ENE A;  2GRC A;  5C4Q A;  5COI A;  4HXP A;  5C87 A;  2F6N A;  5E0R A;  3P1C A;  4NR7 A;  3UVY A;  5FE5 A;  5E3G A;  1ZS5 A;  5LJ0 A;  3U5M A;  4HBY A;  4QSU A;  4E96 A;  5I1Q A;  4Q0N A;  4CUT A;  5C8G A;  5IGL A;  5EWW A;  4Z1Q A;  5LJ2 A;  5E9Y A;  5HRV A;  5HCL A;  5D3P A;  4NR9 A;  4AKN A;  5D3L A;  4KCX A;  4YAB A;  1N72 A;  4HBV A;  4YBT A;  4QSW A;  5KTU A;  5JWM A;  3P1F A;  4QC1 A;  3LXJ A;  4QNS A;  5KU3 A;  5LKZ A;  4TQN A;  4QSX A;  5DFD A;  5D26 A;  4O7B A;  5A81 A;  1EQF A;  3MUL A;  4PKL A;  5FH8 A;  3U5N A;  3I3J A;  5DX4 A;  4QSP A;  4O77 A;  5EWD A;  5F61 A;  4DON A;  4QEV A;  3O36 A;  4LYS A;  3MB4 A;  4HBW A;  4QEW A;  5I29 A;  4A9O A;  3RCW A;  2RFJ A;  5EPS A;  5ACY A;  3HME A;  3UV5 A;  4YH4 A;  4UIX A;  2L84 A;  4O70 A;  5H1T A;  3DWY A;  4NXJ A;  5CQ8 A;  5FE4 A;  5ETD A;  4YBS A;  5BT3 A;  2DVR A;  5EM3 A;  4ZQL A;  3P1D A;  5FG4 A;  3Q2F A;  4Z6I A;  5EP7 A;  3UVW A;  5EQ1 A;  2YDW A;  4A9E A;  4QEU A;  4Y03 A;  4YYK A;  5HEN A;  2R0V A;  3P1E A;  4IOR A;  2YYN A;  4Z93 A;  4QUT A;  5F63 A;  4YYJ A;  5FB1 A;  4QC3 A;  5F62 A;  1JSP B;  4A9M A;  5DYU A;  3U5J A;  4O71 A;  4YAX A;  5L8T A;  4BW3 A;  3MXF A;  5C7N A;  5CRM A;  3UVX A;  5HQ7 A;  5FE0 A;  5L99 A;  5EK9 A;  5F25 A;  4ALH A;  4BJX A;  5II1 A;  5FE1 A;  5E74 A;  4YY4 A;  4PCE A;  5LKU A;  4N4G A;  5HLS A;  4N4F A;  5KHM A;  3SVF A;  3G0L A;  4NRA A;  5DW2 A;  5E3D A;  4UYF B;  5D3T A;  2D9E A;  4BHW A;  5EIS A;  4QSR A;  4WHW A;  4YYN A;  4UYG A;  2DVV A;  2OSS A;  5L97 A;  3K2J A;  5D24 A;  5FFY A;  5FFV A;  4TYL A;  3O34 A;  2I8N A;  5DLX A;  5ENH A;  4MR6 A;  4QYL A;  4XY8 A;  5IGN A;  2G4A A;  4KV4 A;  4A9H A;  5TB6 A;  4IR6 A;  2OUO A;  4QBM A;  4YK0 A;  4LR6 A;  4NR4 A;  5HFR A;  5FE8 A;  4TT2 A;  4NS5 A;  4UIW A;  5HJC A;  5CUB A;  4HXK A;  5DY7 A;  5EI4 A;  4CFK A;  5A7C A;  4CUQ A;  5IGM A;  5I88 A;  4CUP A;  5FE6 A;  4LYI A;  3LJW A;  4QSV A;  5BT5 A;  4YC9 A;  5A5P A;  3AAD A;  5FE2 A;  2RNW A;  5G4S A;  4XUB A;  5A5S A;  5HRX A;  5LKX A;  4IOQ A;  4QUU A;  4O74 A;  3MUK A;  3S91 A;  4UIV A;  5FE9 A;  5F5Z A;  3U5K A;  3U5L A;  4NRC A;  4PY6 A;  1X0J A;  4CLB A;  4NUD A;  5IG6 A;  4N4H A;  5E9L A;  2DVS A;  4CUS A;  3LQJ A;  5D25 A;  5FE3 A;  5FBX A;  5E7D A;  3JVJ A;  4TU4 A;  4LZ2 A;  5CZG A;  4NYV A;  4UYF A;  5F3A A;  5CRZ A;  3MQM A;  5FH7 A;  3ONI A;  4UIT A;  4A9I A;  2LSP B;  5HQ5 A;  4MEN A;  3D7C A;  4HXR A;  5A5Q A;  5FH6 A;  4QSQ A;  4FLP A;  5II2 A;  3U5O A;  5I7Y A;  5CQ5 A;  4O7F A;  3DAI A;  5CPE A;  5CQA A;  5DYC A;  5LVR A;  5CQ7 A;  4HXO A;  5CQT A;  4CL9 A;  5ENG A;  5I86 A;  5K29 A;  2FSA A;  3NXB A;  4YAT A;  4LDF A;  1F68 A;  4OUF A;  4KV1 A;  5E73 A;  5F60 A;  3UV4 A;  5D0C A;  4O7C A;  1E6I A;  5FE7 A;  4Q0O A;  4WHU A;  5DYA A;  5A5R A;  4J1P A;  2L85 A;  5DKC A;  5LKT A;  2WP2 A;  5ENC A;  4TTE A;  4UIU A;  5AD2 A;  1JM4 B;  3LQI A;  5HEL A;  2D82 A;  5EVA A;  4BW1 A;  2DKW A;  4YYH A;  4NQN A;  2YEM A;  4HXN A;  2H60 A;  4QZS A;  5ENI A;  4QY4 A;  3UVD A;  5CP5 A;  4GPJ A;  4NYX A;  4QB3 A;  3HMF A;  2E7N A;  4NR8 A;  5JI8 A;  5EIC A;  5EA1 A;  5E9K A;  3UW9 A;  3IU6 A;  4TT6 A;  2E7O A;  3FKM X;  2RNX A;  2DWW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...