5CS8A

Crystal structure of the first bromodomain of human brd4 in complex with benzo[cd]indol-2(1h)-one ligand
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
133
structure length
133
Chain Sequence
HHHHHLVPRGSNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein/inhibitor
molecule keywords Bromodomain-containing protein 4
publication title Discovery of Benzo[cd]indol-2(1H)-ones as Potent and Specific BET Bromodomain Inhibitors: Structure-Based Virtual Screening, Optimization, and Biological Evaluation
pubmed doi rcsb
source organism Homo sapiens
total genus 44
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 2015-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5cs8A01
4QEVA 2DVQA 5A7CA 5II1A 3UVYA 4CUQA 5FE5A 3O36A 4UIZA 5F61A 4YBTA 5F2PA 4NR7A 5DYUA 5KO4A 4O7FA 4HXLA 3SVHA 4QYLA 4WHUA 2R0YA 5AMEA 2I7KA 5D3TA 5EQ1A 5ENFA 5IGMA 1JM4B 4YABA 1WUGA 3TLPA 5FB0A 4QYDA 2E7OA 4QSSA 4YYGA 4O70A 5CGPA 4QB3A 4UITA 2YW5A 5A5NA 5I7XA 5FE6A 5I83A 5EA1A 5IG6A 5HFRA 4MR5A 3U5OA 3UVWA 5EPRA 5EPBA 5FE2A 4Y03A 4TQNA 1ZS5A 5FG6A 4PY6A 4TZ8A 5DY7A 4NS5A 4LR6A 5DFCA 5TB6A 5DX4A 4QC1A 5CUBA 3P1FA 3MB4A 4KV4A 5CQ6A 5JI8A 5CUDA 5FG5A 5C8GA 5HJCA 3MQMA 5ACYA 4ZW1A 5LJ1A 5EV9A 5CP5A 4YYDA 5F3AA 5DBMA 4KCXA 5D24A 4QNSA 3JVKA 4J0RA 4A9IA 3QZVA 3JVMA 5BT5A 3DAIA 5H85A 4PCEA 5IIDA 3Q2FA 4BW1A 4NXJA 5L8UA 4IOQA 5DLXA 4YBSA 3FKMX 4OUFA 3JVJA 5IGLA 4CFKA 4HXOA 5EP7A 4WIVA 3MXFA 4CUUA 4NRCA 5CTLA 5ETBA 4YYKA 2R0VA 3NXBA 5E9VA 5C7NA 4N3WA 4O75A 3AQAA 5E74A 4DONA 4NRBA 4QSTA 4A9HA 4HBWA 5ENGA 2E3KA 3UV2A 5CFWA 5EWCA 1X0JA 5G4SA 4Z6IA 2YDWA 5L97A 4YAXA 4HXNA 5EWVA 4QSWA 4UIVA 5E9LA 5IGNA 4NR5A 5I29A 4NR9A 2F6JA 5A81A 3D7CA 4QC3A 4CUSA 5E3DA 4IR6A 4O7AA 5FFVA 5F62A 5II2A 4UYGA 5F1LA 3RCWA 5FE7A 2RNYA 5F60A 2RNWA 4NYWA 3O37A 4QZSA 4A9FA 3P1CA 4N4FA 4A9OA 4ALGA 2YEMA 4QR3A 5CPEA 2DVRA 5IBNA 5FFYA 4NUDA 2RNXA 2D9EA 2WP1A 4CURA 3LQHA 4PCIA 2N9GA 5D3LA 3K2JA 4MR4A 3UV5A 5FE4A 2RI7A 4LZ2A 5HQ7A 4IR3A 4QSQA 5EWHA 3ONIA 4HXMA 5CUCA 5KTUA 1WUMA 2DWWA 3MB3A 2KTBB 3P1EA 2L5EA 5FE8A 5E7DA 4OGJA 4QSXA 4YK0A 2R10A 5I86A 5HRXA 5D7XA 5D3SA 5COIA 5E9YA 4J3IA 4YYJA 5F63A 4X2IA 3O35A 5FH6A 4QY4A 3SVGA 4N4IA 3QZTA 3U5PA 5CU8A 5CS8A 2RO1A 5EWDA 5KU3A 4O74A 4MEQA 3P1DA 5CY9A 5D3JA 4YBMA 5CQTA 5A5QA 4NR6A 5D3HA 4UYFB 5EU1A 5I7YA 4HXRA 4CLBA 5F36A 5BT4A 4Z6HA 5EISA 4UIUA 3LJWA 5FE3A 5I40A 5I1QA 3G0LA 2YEKA 4WHWA 5EWWA 3JVLA 5AMFA 4ZQLA 4YYMA 5FFWA 5A5SA 4NQNA 3IU6A 4A9NA 4GPJA 4TYLA 4TS8A 5DKHA 5EI4A 5ENIA 3HMFA 4NR4A 4LDFA 5E0RA 5FB1A 4IOOA 5FE1A 5KTXA 5L99A 4LYSA 5DYXA 5A5PA 5E3GA 5C89A 4LYIA 2OSSA 3UVDA 4IR4A 4YATA 5CQ7A 3MUKA 2YELA 5CQ3A 4O71A 5H1VA 5D26A 2D82A 5LKZA 4O78A 5HQ5A 4LZRA 5FE0A 5FH7A 4J0SA 4UYEA 4XUAA 4BW4A 4Z1QA 4QR4A 2R0SA 5HQ6A 4HXKA 4XYAA 2H60A 5J0DA 3IU5A 4A9JA 4YYHA 5DKCA 5ENHA 3LXJA 5H1UA 4YY6A 5DW2A 5D0CA 4E96A 5FE9A 5FH8A 4YYIA 2I8NA 2YYNA 5F25A 5LUUA 5CRZA 4HBYA 4Z93A 4UYHA 4N4GA 4LC2A 4NRAA 1F68A 4HXSA 5EM3A 3U5JA 5HFQA 4IORA 4CFLA 4O7BA 5LKUA 3LQJA 4NQMA 2LSPB 5CQAA 3QZSA 4QBMA 4YY4A 5LVRA 4A9MA 3HMEA 2OO1A 4XY9A 5IGKA 4YC9A 5KTWA 4RVRA 2DKWA 2FSAA 4KV1A 5HM0A 5LVQA 4ALHA 5HENA 5AD3A 4F3IA 2GRCA 2RS9B 2WP2A 5ENBA 4QSVA 3I3JA 4UIYA 4PKLA 5L8TA 3GG3A 5DYAA 3UV4A 5BT3A 4IR5A 5CRMA 5A85A 5LJ2A 5HRWA 4HXPA 2L84A 4FLPA 3G0JA 4O77A 4QR5A 3P5OA 5ENJA 4CUPA 5EK9A 5DFDA 4AKNA 5I89A 4QSPA 4CUTA 4BW2A 5HELA 5A82A 5CQ5A 5HCLA 5CUEA 5EPSA 5L96A 3UW9A 4BJXA 4Q0OA 4TU6A 4QEUA 5DFBA 5EICA 3AADA 4PTBA 4TT2A 2YQDA 4XY8A 5FDZA 3U5MA 4TTEA 5L98A 4TT4A 5FG4A 2DVSA 5I88A 4NYXA 4C67A 1EQFA 5C87A 4O76A 5ENEA 2DATA 5AD2A 4QUUA 3LQIA 5D3RA 5CQ4A 4UIXA 5ETDA 4A9KA 5E9MA 3O34A 2DVVA 5A83A 2RFJA 3UVXA 4Z1SA 4ZC9A 4NR8A 5F5ZA 5A5OA 4UYDA 5C85A 2E7NA 5I80A 4HBXA 4MR3A 5CQ8A 3O33A 5F1HA 4MR6A 5DW1A 3Q2EA 4QSUA 4TT6A 5CZGA 5ENCA 5A5RA 5LJ0A 4CL9A 5FBXA 4YH4A 3U5LA 2G4AA 5JWMA 5TCMA 4LRGA 3S92A 4BHWA 3DWYA 3SVFA 4LYWA 2L85A 4UIWA 5D25A 5HLSA 4O72A 4YYNA 2NXBA 5C4QA 5HRVA 4TZ2A 4NUCA 5E9KA 4A9LA 1E6IA 4QSRA 4O7EA 4UYFA 5H1TA 4QEWA 4A9EA 4BW3A 5HEMA 5G4RA 5LKXA 5EVAA 4TU4A 4YH3A 4QUTA 5E9IA 4LZSA 3HMHA 5CUGA 5D3PA 2F6NA 4Q0NA 4J1PA 3U5NA 5K29A 5DKDA 4NYVA 5DYCA 2MJVB 1JSPB 4O7CA 3ZYUA 4YADA 3MULA 4MEOA 5DLZA 4MEPA 5CUAA 2OUOA 1N72A 4XUBA 4C66A 5E73A 4HBVA 4PS5A 4MENA 4N4HA 5LKTA 4OGIA 4NUEA 5KHMA 3U5KA 5D3NA 5EGUA 3S91A
chains in the Genus database with same CATH superfamily
4QEVA 2DVQA 5A7CA 5II1A 3UVYA 4CUQA 5FE5A 3O36A 4UIZA 5F61A 4YBTA 5F2PA 4NR7A 5DYUA 5KO4A 4O7FA 4HXLA 3SVHA 4QYLA 4WHUA 2R0YA 5AMEA 2I7KA 5D3TA 5EQ1A 5ENFA 5IGMA 1JM4B 4AKGA 4YABA 1WUGA 3TLPA 5FB0A 4QYDA 2E7OA 4QSSA 4YYGA 4O70A 5CGPA 4QB3A 4UITA 2YW5A 5A5NA 5I7XA 5FE6A 5I83A 3D1BA 5EA1A 5IG6A 5HFRA 4MR5A 3U5OA 4AI6A 3UVWA 5EPRA 5EPBA 5FE2A 4Y03A 4TQNA 1ZS5A 5FG6A 4PY6A 4TZ8A 5DY7A 4NS5A 4LR6A 5DFCA 5TB6A 5DX4A 4QC1A 5CUBA 3P1FA 3MB4A 4KV4A 5CQ6A 5JI8A 5CUDA 5FG5A 5C8GA 5HJCA 4AKIA 3MQMA 5ACYA 4ZW1A 5LJ1A 5EV9A 5CP5A 4YYDA 5F3AA 5DBMA 4KCXA 5D24A 4QNSA 3JVKA 4J0RA 4A9IA 4AKHA 3QZVA 3JVMA 5BT5A 3DAIA 5H85A 4PCEA 5IIDA 3Q2FA 4BW1A 4NXJA 5L8UA 4IOQA 5DLXA 4YBSA 3FKMX 4OUFA 3JVJA 5IGLA 4CFKA 3VKGA 4HXOA 5EP7A 4WIVA 3MXFA 4CUUA 4NRCA 5CTLA 5ETBA 4YYKA 2R0VA 3NXBA 5E9VA 5C7NA 4N3WA 4O75A 3AQAA 5E74A 4DONA 4NRBA 4QSTA 4A9HA 4HBWA 5ENGA 2E3KA 3UV2A 5CFWA 5EWCA 1X0JA 5G4SA 4Z6IA 2YDWA 5L97A 4YAXA 4HXNA 5EWVA 4QSWA 4UIVA 5E9LA 5IGNA 3D1DA 4NR5A 5I29A 4NR9A 2F6JA 5A81A 3D7CA 4QC3A 4CUSA 5E3DA 4IR6A 4O7AA 5FFVA 5F62A 3VKHA 5II2A 4UYGA 5F1LA 3RCWA 5FE7A 2RNYA 5F60A 2RNWA 2EJNA 4NYWA 3O37A 4QZSA 4A9FA 3P1CA 4N4FA 4A9OA 4ALGA 2YEMA 4QR3A 5CPEA 2DVRA 5IBNA 5FFYA 4NUDA 1PUOA 2RNXA 2D9EA 2WP1A 4CURA 3LQHA 4PCIA 2N9GA 5D3LA 3K2JA 4MR4A 3UV5A 5FE4A 2RI7A 4LZ2A 5HQ7A 4IR3A 4QSQA 5EWHA 3ONIA 4HXMA 5CUCA 5KTUA 1WUMA 2DWWA 3MB3A 2KTBB 3P1EA 2L5EA 5FE8A 5E7DA 4OGJA 4QSXA 4YK0A 2R10A 5I86A 5HRXA 5D7XA 5D3SA 5COIA 5E9YA 4J3IA 4YYJA 5F63A 4X2IA 3O35A 5FH6A 4QY4A 3SVGA 4N4IA 3QZTA 3U5PA 5CU8A 5CS8A 2RO1A 5EWDA 5KU3A 4O74A 4MEQA 3P1DA 5CY9A 5D3JA 4YBMA 5CQTA 5A5QA 4NR6A 5D3HA 4UYFB 5EU1A 5I7YA 4HXRA 4CLBA 5F36A 5BT4A 4Z6HA 5EISA 4UIUA 3LJWA 5FE3A 5I40A 5I1QA 3G0LA 2YEKA 4WHWA 5EWWA 3JVLA 5AMFA 4ZQLA 4YYMA 5FFWA 5A5SA 4NQNA 3IU6A 4A9NA 4GPJA 4TYLA 4TS8A 5DKHA 5EI4A 5ENIA 3HMFA 4NR4A 4LDFA 5E0RA 5FB1A 4IOOA 5FE1A 5KTXA 5L99A 4LYSA 5DYXA 5A5PA 5E3GA 5C89A 4LYIA 2OSSA 3UVDA 4IR4A 4YATA 5CQ7A 3MUKA 3ERRA 2YELA 5CQ3A 4O71A 5H1VA 5D26A 2D82A 5LKZA 4O78A 5HQ5A 4LZRA 5FE0A 5FH7A 4J0SA 4UYEA 4XUAA 4BW4A 4Z1QA 4QR4A 2R0SA 5HQ6A 4HXKA 4XYAA 2H60A 5J0DA 3IU5A 4A9JA 4YYHA 5DKCA 5ENHA 3LXJA 5H1UA 4YY6A 5DW2A 5D0CA 4E96A 5FE9A 5FH8A 4YYIA 2I8NA 2YYNA 5F25A 5LUUA 5CRZA 4HBYA 4Z93A 4UYHA 4N4GA 4LC2A 4NRAA 1F68A 4HXSA 5EM3A 3U5JA 5HFQA 4IORA 4CFLA 4O7BA 5LKUA 3LQJA 4NQMA 2LSPB 5CQAA 3QZSA 4QBMA 4YY4A 5LVRA 4A9MA 3HMEA 2OO1A 4XY9A 5IGKA 4YC9A 5KTWA 4RVRA 2DKWA 2FSAA 4KV1A 5HM0A 5LVQA 4ALHA 5HENA 5AD3A 4F3IA 2GRCA 2RS9B 2WP2A 5ENBA 4QSVA 3I3JA 1ZKRA 4UIYA 4PKLA 5L8TA 3GG3A 5DYAA 3UV4A 5BT3A 4IR5A 5CRMA 5A85A 5LJ2A 5HRWA 4HXPA 2L84A 4FLPA 3G0JA 4O77A 4QR5A 3P5OA 5ENJA 4CUPA 5EK9A 5DFDA 4AKNA 5I89A 4QSPA 4CUTA 4BW2A 5HELA 5A82A 5CQ5A 5HCLA 5CUEA 5EPSA 5L96A 3UW9A 4BJXA 4Q0OA 4TU6A 4QEUA 5DFBA 5EICA 3AADA 4PTBA 4TT2A 2YQDA 4XY8A 5FDZA 3U5MA 4TTEA 5L98A 4TT4A 5FG4A 2DVSA 5I88A 4NYXA 4C67A 1EQFA 5C87A 4O76A 5ENEA 2DATA 5AD2A 4QUUA 3LQIA 5D3RA 5CQ4A 4UIXA 5ETDA 4A9KA 5E9MA 3O34A 2DVVA 5A83A 2RFJA 3UVXA 4Z1SA 4ZC9A 4NR8A 5F5ZA 5A5OA 4UYDA 5C85A 2E7NA 5I80A 4HBXA 4MR3A 5CQ8A 3O33A 5F1HA 4MR6A 5DW1A 3Q2EA 4QSUA 4TT6A 5CZGA 5ENCA 5A5RA 5LJ0A 4CL9A 5FBXA 4YH4A 3U5LA 2G4AA 5JWMA 5TCMA 4LRGA 3S92A 4BHWA 3DWYA 3SVFA 4LYWA 2L85A 4UIWA 5D25A 5HLSA 4O72A 4YYNA 2NXBA 5C4QA 5HRVA 4TZ2A 4NUCA 5E9KA 4A9LA 1E6IA 4QSRA 4O7EA 4UYFA 5H1TA 4QEWA 4A9EA 4BW3A 5HEMA 5G4RA 5LKXA 5EVAA 4TU4A 4YH3A 4QUTA 5E9IA 4LZSA 3HMHA 5CUGA 5D3PA 2F6NA 4Q0NA 4J1PA 3U5NA 5K29A 5DKDA 4NYVA 5DYCA 2MJVB 1JSPB 4O7CA 3ZYUA 4YADA 3MULA 4MEOA 5DLZA 4MEPA 5CUAA 2OUOA 1N72A 4XUBA 4C66A 5E73A 4HBVA 4PS5A 4MENA 4N4HA 5LKTA 4OGIA 4NUEA 5KHMA 3U5KA 5D3NA 5EGUA 3S91A
chains in the Genus database with same CATH topology
4QEVA 2DVQA 5A7CA 5II1A 3UVYA 4CUQA 5FE5A 3O36A 4UIZA 5F61A 4YBTA 5F2PA 4NR7A 5DYUA 5KO4A 4O7FA 4HXLA 3SVHA 4QYLA 4WHUA 2R0YA 5AMEA 2I7KA 5D3TA 5EQ1A 5ENFA 5IGMA 1JM4B 4YABA 1WUGA 3TLPA 5FB0A 4QYDA 2E7OA 4QSSA 4YYGA 4O70A 5CGPA 4QB3A 4UITA 2YW5A 5A5NA 5I7XA 5FE6A 5I83A 5EA1A 5IG6A 5HFRA 4MR5A 3U5OA 3UVWA 5EPRA 5EPBA 5FE2A 4Y03A 4TQNA 1ZS5A 5FG6A 4PY6A 4TZ8A 5DY7A 4NS5A 4LR6A 5DFCA 5TB6A 5DX4A 4QC1A 5CUBA 3P1FA 3MB4A 4KV4A 5CQ6A 5JI8A 5CUDA 5FG5A 5C8GA 5HJCA 3MQMA 5ACYA 4ZW1A 5LJ1A 5EV9A 5CP5A 4YYDA 5F3AA 5DBMA 4KCXA 5D24A 4QNSA 3JVKA 4J0RA 4A9IA 3QZVA 3JVMA 5BT5A 3DAIA 5H85A 4PCEA 5IIDA 3Q2FA 4BW1A 4NXJA 5L8UA 4IOQA 5DLXA 4YBSA 3FKMX 4OUFA 3JVJA 5IGLA 4CFKA 4HXOA 5EP7A 4WIVA 3MXFA 4CUUA 4NRCA 5CTLA 5ETBA 4YYKA 2R0VA 3NXBA 5E9VA 5C7NA 4N3WA 4O75A 3AQAA 5E74A 4DONA 4NRBA 4QSTA 4A9HA 4HBWA 5ENGA 2E3KA 3UV2A 5CFWA 5EWCA 1X0JA 5G4SA 4Z6IA 2YDWA 5L97A 4YAXA 4HXNA 5EWVA 4QSWA 4UIVA 5E9LA 5IGNA 4NR5A 5I29A 4NR9A 2F6JA 5A81A 3D7CA 4QC3A 4CUSA 5E3DA 4IR6A 4O7AA 5FFVA 5F62A 5II2A 4UYGA 5F1LA 3RCWA 5FE7A 2RNYA 5F60A 2RNWA 4NYWA 3O37A 4QZSA 4A9FA 3P1CA 4N4FA 4A9OA 4ALGA 2YEMA 4QR3A 5CPEA 2DVRA 5IBNA 5FFYA 4NUDA 2RNXA 2D9EA 2WP1A 4CURA 3LQHA 4PCIA 2N9GA 5D3LA 3K2JA 4MR4A 3UV5A 5FE4A 2RI7A 4LZ2A 5HQ7A 4IR3A 4QSQA 5EWHA 3ONIA 4HXMA 5CUCA 5KTUA 1WUMA 2DWWA 3MB3A 2KTBB 3P1EA 2L5EA 5FE8A 5E7DA 4OGJA 4QSXA 4YK0A 2R10A 5I86A 5HRXA 5D7XA 5D3SA 5COIA 5E9YA 4J3IA 4YYJA 5F63A 4X2IA 3O35A 5FH6A 4QY4A 3SVGA 4N4IA 3QZTA 3U5PA 5CU8A 5CS8A 2RO1A 5EWDA 5KU3A 4O74A 4MEQA 3P1DA 5CY9A 5D3JA 4YBMA 5CQTA 5A5QA 4NR6A 5D3HA 4UYFB 5EU1A 5I7YA 4HXRA 4CLBA 5F36A 5BT4A 4Z6HA 5EISA 4UIUA 3LJWA 5FE3A 5I40A 5I1QA 3G0LA 2YEKA 4WHWA 5EWWA 3JVLA 5AMFA 4ZQLA 4YYMA 5FFWA 5A5SA 4NQNA 3IU6A 4A9NA 4GPJA 4TYLA 4TS8A 5DKHA 5EI4A 5ENIA 3HMFA 4NR4A 4LDFA 5E0RA 5FB1A 4IOOA 5FE1A 5KTXA 5L99A 4LYSA 5DYXA 5A5PA 5E3GA 5C89A 4LYIA 2OSSA 3UVDA 4IR4A 4YATA 5CQ7A 3MUKA 2YELA 5CQ3A 4O71A 5H1VA 5D26A 2D82A 5LKZA 4O78A 5HQ5A 4LZRA 5FE0A 5FH7A 4J0SA 4UYEA 4XUAA 4BW4A 4Z1QA 4QR4A 2R0SA 5HQ6A 4HXKA 4XYAA 2H60A 5J0DA 3IU5A 4A9JA 4YYHA 5DKCA 5ENHA 3LXJA 5H1UA 4YY6A 5DW2A 5D0CA 4E96A 5FE9A 5FH8A 4YYIA 2I8NA 2YYNA 5F25A 5LUUA 5CRZA 4HBYA 4Z93A 4UYHA 4N4GA 4LC2A 4NRAA 1F68A 4HXSA 5EM3A 3U5JA 5HFQA 4IORA 4CFLA 4O7BA 5LKUA 3LQJA 4NQMA 2LSPB 5CQAA 3QZSA 4QBMA 4YY4A 5LVRA 4A9MA 3HMEA 2OO1A 4XY9A 5IGKA 4YC9A 5KTWA 4RVRA 2DKWA 2FSAA 4KV1A 5HM0A 5LVQA 4ALHA 5HENA 5AD3A 4F3IA 2GRCA 2RS9B 2WP2A 5ENBA 4QSVA 3I3JA 4UIYA 4PKLA 5L8TA 3GG3A 5DYAA 3UV4A 5BT3A 4IR5A 5CRMA 5A85A 5LJ2A 5HRWA 4HXPA 2L84A 4FLPA 3G0JA 4O77A 4QR5A 3P5OA 5ENJA 4CUPA 5EK9A 5DFDA 4AKNA 5I89A 4QSPA 4CUTA 4BW2A 5HELA 5A82A 5CQ5A 5HCLA 5CUEA 5EPSA 5L96A 3UW9A 4BJXA 4Q0OA 4TU6A 4QEUA 5DFBA 5EICA 3AADA 4PTBA 4TT2A 2YQDA 4XY8A 5FDZA 3U5MA 4TTEA 5L98A 4TT4A 5FG4A 2DVSA 5I88A 4NYXA 4C67A 1EQFA 5C87A 4O76A 5ENEA 2DATA 5AD2A 4QUUA 3LQIA 5D3RA 5CQ4A 4UIXA 5ETDA 4A9KA 5E9MA 3O34A 2DVVA 5A83A 2RFJA 3UVXA 4Z1SA 4ZC9A 4NR8A 5F5ZA 5A5OA 4UYDA 5C85A 2E7NA 5I80A 4HBXA 4MR3A 5CQ8A 3O33A 5F1HA 4MR6A 5DW1A 3Q2EA 4QSUA 4TT6A 5CZGA 5ENCA 5A5RA 5LJ0A 4CL9A 5FBXA 4YH4A 3U5LA 2G4AA 5JWMA 5TCMA 4LRGA 3S92A 4BHWA 3DWYA 3SVFA 4LYWA 2L85A 4UIWA 5D25A 5HLSA 4O72A 4YYNA 2NXBA 5C4QA 5HRVA 4TZ2A 4NUCA 5E9KA 4A9LA 1E6IA 4QSRA 4O7EA 4UYFA 5H1TA 4QEWA 4A9EA 4BW3A 5HEMA 5G4RA 5LKXA 5EVAA 4TU4A 4YH3A 4QUTA 5E9IA 4LZSA 3HMHA 5CUGA 5D3PA 2F6NA 4Q0NA 4J1PA 3U5NA 5K29A 5DKDA 4NYVA 5DYCA 2MJVB 1JSPB 4O7CA 3ZYUA 4YADA 3MULA 4MEOA 5DLZA 4MEPA 5CUAA 2OUOA 1N72A 4XUBA 4C66A 5E73A 4HBVA 4PS5A 4MENA 4N4HA 5LKTA 4OGIA 4NUEA 5KHMA 3U5KA 5D3NA 5EGUA 3S91A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QEV A;  2DVQ A;  5A7C A;  5II1 A;  3UVY A;  4CUQ A;  5FE5 A;  3O36 A;  4UIZ A;  5F61 A;  4YBT A;  5F2P A;  4NR7 A;  5DYU A;  5KO4 A;  4O7F A;  4HXL A;  3SVH A;  4QYL A;  4WHU A;  2R0Y A;  5AME A;  2I7K A;  5D3T A;  5EQ1 A;  5ENF A;  5IGM A;  1JM4 B;  4YAB A;  1WUG A;  3TLP A;  5FB0 A;  4QYD A;  2E7O A;  4QSS A;  4YYG A;  4O70 A;  5CGP A;  4QB3 A;  4UIT A;  2YW5 A;  5A5N A;  5I7X A;  5FE6 A;  5I83 A;  5EA1 A;  5IG6 A;  5HFR A;  4MR5 A;  3U5O A;  3UVW A;  5EPR A;  5EPB A;  5FE2 A;  4Y03 A;  4TQN A;  1ZS5 A;  5FG6 A;  4PY6 A;  4TZ8 A;  5DY7 A;  4NS5 A;  4LR6 A;  5DFC A;  5TB6 A;  5DX4 A;  4QC1 A;  5CUB A;  3P1F A;  3MB4 A;  4KV4 A;  5CQ6 A;  5JI8 A;  5CUD A;  5FG5 A;  5C8G A;  5HJC A;  3MQM A;  5ACY A;  4ZW1 A;  5LJ1 A;  5EV9 A;  5CP5 A;  4YYD A;  5F3A A;  5DBM A;  4KCX A;  5D24 A;  4QNS A;  3JVK A;  4J0R A;  4A9I A;  3QZV A;  3JVM A;  5BT5 A;  3DAI A;  5H85 A;  4PCE A;  5IID A;  3Q2F A;  4BW1 A;  4NXJ A;  5L8U A;  4IOQ A;  5DLX A;  4YBS A;  3FKM X;  4OUF A;  3JVJ A;  5IGL A;  4CFK A;  4HXO A;  5EP7 A;  4WIV A;  3MXF A;  4CUU A;  4NRC A;  5CTL A;  5ETB A;  4YYK A;  2R0V A;  3NXB A;  5E9V A;  5C7N A;  4N3W A;  4O75 A;  3AQA A;  5E74 A;  4DON A;  4NRB A;  4QST A;  4A9H A;  4HBW A;  5ENG A;  2E3K A;  3UV2 A;  5CFW A;  5EWC A;  1X0J A;  5G4S A;  4Z6I A;  2YDW A;  5L97 A;  4YAX A;  4HXN A;  5EWV A;  4QSW A;  4UIV A;  5E9L A;  5IGN A;  4NR5 A;  5I29 A;  4NR9 A;  2F6J A;  5A81 A;  3D7C A;  4QC3 A;  4CUS A;  5E3D A;  4IR6 A;  4O7A A;  5FFV A;  5F62 A;  5II2 A;  4UYG A;  5F1L A;  3RCW A;  5FE7 A;  2RNY A;  5F60 A;  2RNW A;  4NYW A;  3O37 A;  4QZS A;  4A9F A;  3P1C A;  4N4F A;  4A9O A;  4ALG A;  2YEM A;  4QR3 A;  5CPE A;  2DVR A;  5IBN A;  5FFY A;  4NUD A;  2RNX A;  2D9E A;  2WP1 A;  4CUR A;  3LQH A;  4PCI A;  2N9G A;  5D3L A;  3K2J A;  4MR4 A;  3UV5 A;  5FE4 A;  2RI7 A;  4LZ2 A;  5HQ7 A;  4IR3 A;  4QSQ A;  5EWH A;  3ONI A;  4HXM A;  5CUC A;  5KTU A;  1WUM A;  2DWW A;  3MB3 A;  2KTB B;  3P1E A;  2L5E A;  5FE8 A;  5E7D A;  4OGJ A;  4QSX A;  4YK0 A;  2R10 A;  5I86 A;  5HRX A;  5D7X A;  5D3S A;  5COI A;  5E9Y A;  4J3I A;  4YYJ A;  5F63 A;  4X2I A;  3O35 A;  5FH6 A;  4QY4 A;  3SVG A;  4N4I A;  3QZT A;  3U5P A;  5CU8 A;  5CS8 A;  2RO1 A;  5EWD A;  5KU3 A;  4O74 A;  4MEQ A;  3P1D A;  5CY9 A;  5D3J A;  4YBM A;  5CQT A;  5A5Q A;  4NR6 A;  5D3H A;  4UYF B;  5EU1 A;  5I7Y A;  4HXR A;  4CLB A;  5F36 A;  5BT4 A;  4Z6H A;  5EIS A;  4UIU A;  3LJW A;  5FE3 A;  5I40 A;  5I1Q A;  3G0L A;  2YEK A;  4WHW A;  5EWW A;  3JVL A;  5AMF A;  4ZQL A;  4YYM A;  5FFW A;  5A5S A;  4NQN A;  3IU6 A;  4A9N A;  4GPJ A;  4TYL A;  4TS8 A;  5DKH A;  5EI4 A;  5ENI A;  3HMF A;  4NR4 A;  4LDF A;  5E0R A;  5FB1 A;  4IOO A;  5FE1 A;  5KTX A;  5L99 A;  4LYS A;  5DYX A;  5A5P A;  5E3G A;  5C89 A;  4LYI A;  2OSS A;  3UVD A;  4IR4 A;  4YAT A;  5CQ7 A;  3MUK A;  2YEL A;  5CQ3 A;  4O71 A;  5H1V A;  5D26 A;  2D82 A;  5LKZ A;  4O78 A;  5HQ5 A;  4LZR A;  5FE0 A;  5FH7 A;  4J0S A;  4UYE A;  4XUA A;  4BW4 A;  4Z1Q A;  4QR4 A;  2R0S A;  5HQ6 A;  4HXK A;  4XYA A;  2H60 A;  5J0D A;  3IU5 A;  4A9J A;  4YYH A;  5DKC A;  5ENH A;  3LXJ A;  5H1U A;  4YY6 A;  5DW2 A;  5D0C A;  4E96 A;  5FE9 A;  5FH8 A;  4YYI A;  2I8N A;  2YYN A;  5F25 A;  5LUU A;  5CRZ A;  4HBY A;  4Z93 A;  4UYH A;  4N4G A;  4LC2 A;  4NRA A;  1F68 A;  4HXS A;  5EM3 A;  3U5J A;  5HFQ A;  4IOR A;  4CFL A;  4O7B A;  5LKU A;  3LQJ A;  4NQM A;  2LSP B;  5CQA A;  3QZS A;  4QBM A;  4YY4 A;  5LVR A;  4A9M A;  3HME A;  2OO1 A;  4XY9 A;  5IGK A;  4YC9 A;  5KTW A;  4RVR A;  2DKW A;  2FSA A;  4KV1 A;  5HM0 A;  5LVQ A;  4ALH A;  5HEN A;  5AD3 A;  4F3I A;  2GRC A;  2RS9 B;  2WP2 A;  5ENB A;  4QSV A;  3I3J A;  4UIY A;  4PKL A;  5L8T A;  3GG3 A;  5DYA A;  3UV4 A;  5BT3 A;  4IR5 A;  5CRM A;  5A85 A;  5LJ2 A;  5HRW A;  4HXP A;  2L84 A;  4FLP A;  3G0J A;  4O77 A;  4QR5 A;  3P5O A;  5ENJ A;  4CUP A;  5EK9 A;  5DFD A;  4AKN A;  5I89 A;  4QSP A;  4CUT A;  4BW2 A;  5HEL A;  5A82 A;  5CQ5 A;  5HCL A;  5CUE A;  5EPS A;  5L96 A;  3UW9 A;  4BJX A;  4Q0O A;  4TU6 A;  4QEU A;  5DFB A;  5EIC A;  3AAD A;  4PTB A;  4TT2 A;  2YQD A;  4XY8 A;  5FDZ A;  3U5M A;  4TTE A;  5L98 A;  4TT4 A;  5FG4 A;  2DVS A;  5I88 A;  4NYX A;  4C67 A;  1EQF A;  5C87 A;  4O76 A;  5ENE A;  2DAT A;  5AD2 A;  4QUU A;  3LQI A;  5D3R A;  5CQ4 A;  4UIX A;  5ETD A;  4A9K A;  5E9M A;  3O34 A;  2DVV A;  5A83 A;  2RFJ A;  3UVX A;  4Z1S A;  4ZC9 A;  4NR8 A;  5F5Z A;  5A5O A;  4UYD A;  5C85 A;  2E7N A;  5I80 A;  4HBX A;  4MR3 A;  5CQ8 A;  3O33 A;  5F1H A;  4MR6 A;  5DW1 A;  3Q2E A;  4QSU A;  4TT6 A;  5CZG A;  5ENC A;  5A5R A;  5LJ0 A;  4CL9 A;  5FBX A;  4YH4 A;  3U5L A;  2G4A A;  5JWM A;  5TCM A;  4LRG A;  3S92 A;  4BHW A;  3DWY A;  3SVF A;  4LYW A;  2L85 A;  4UIW A;  5D25 A;  5HLS A;  4O72 A;  4YYN A;  2NXB A;  5C4Q A;  5HRV A;  4TZ2 A;  4NUC A;  5E9K A;  4A9L A;  1E6I A;  4QSR A;  4O7E A;  4UYF A;  5H1T A;  4QEW A;  4A9E A;  4BW3 A;  5HEM A;  5G4R A;  5LKX A;  5EVA A;  4TU4 A;  4YH3 A;  4QUT A;  5E9I A;  4LZS A;  3HMH A;  5CUG A;  5D3P A;  2F6N A;  4Q0N A;  4J1P A;  3U5N A;  5K29 A;  5DKD A;  4NYV A;  5DYC A;  2MJV B;  1JSP B;  4O7C A;  3ZYU A;  4YAD A;  3MUL A;  4MEO A;  5DLZ A;  4MEP A;  5CUA A;  2OUO A;  1N72 A;  4XUB A;  4C66 A;  5E73 A;  4HBV A;  4PS5 A;  4MEN A;  4N4H A;  5LKT A;  4OGI A;  4NUE A;  5KHM A;  3U5K A;  5D3N A;  5EGU A;  3S91 A; 
#chains in the Genus database with same CATH topology
 4QEV A;  2DVQ A;  5A7C A;  5II1 A;  3UVY A;  4CUQ A;  5FE5 A;  3O36 A;  4UIZ A;  5F61 A;  4YBT A;  5F2P A;  4NR7 A;  5DYU A;  5KO4 A;  4O7F A;  4HXL A;  3SVH A;  4QYL A;  4WHU A;  2R0Y A;  5AME A;  2I7K A;  5D3T A;  5EQ1 A;  5ENF A;  5IGM A;  1JM4 B;  4AKG A;  4YAB A;  1WUG A;  3TLP A;  5FB0 A;  4QYD A;  2E7O A;  4QSS A;  4YYG A;  4O70 A;  5CGP A;  4QB3 A;  4UIT A;  2YW5 A;  5A5N A;  5I7X A;  5FE6 A;  5I83 A;  3D1B A;  5EA1 A;  5IG6 A;  5HFR A;  4MR5 A;  3U5O A;  4AI6 A;  3UVW A;  5EPR A;  5EPB A;  5FE2 A;  4Y03 A;  4TQN A;  1ZS5 A;  5FG6 A;  4PY6 A;  4TZ8 A;  5DY7 A;  4NS5 A;  4LR6 A;  5DFC A;  5TB6 A;  5DX4 A;  4QC1 A;  5CUB A;  3P1F A;  3MB4 A;  4KV4 A;  5CQ6 A;  5JI8 A;  5CUD A;  5FG5 A;  5C8G A;  5HJC A;  4AKI A;  3MQM A;  5ACY A;  4ZW1 A;  5LJ1 A;  5EV9 A;  5CP5 A;  4YYD A;  5F3A A;  5DBM A;  4KCX A;  5D24 A;  4QNS A;  3JVK A;  4J0R A;  4A9I A;  4AKH A;  3QZV A;  3JVM A;  5BT5 A;  3DAI A;  5H85 A;  4PCE A;  5IID A;  3Q2F A;  4BW1 A;  4NXJ A;  5L8U A;  4IOQ A;  5DLX A;  4YBS A;  3FKM X;  4OUF A;  3JVJ A;  5IGL A;  4CFK A;  3VKG A;  4HXO A;  5EP7 A;  4WIV A;  3MXF A;  4CUU A;  4NRC A;  5CTL A;  5ETB A;  4YYK A;  2R0V A;  3NXB A;  5E9V A;  5C7N A;  4N3W A;  4O75 A;  3AQA A;  5E74 A;  4DON A;  4NRB A;  4QST A;  4A9H A;  4HBW A;  5ENG A;  2E3K A;  3UV2 A;  5CFW A;  5EWC A;  1X0J A;  5G4S A;  4Z6I A;  2YDW A;  5L97 A;  4YAX A;  4HXN A;  5EWV A;  4QSW A;  4UIV A;  5E9L A;  5IGN A;  3D1D A;  4NR5 A;  5I29 A;  4NR9 A;  2F6J A;  5A81 A;  3D7C A;  4QC3 A;  4CUS A;  5E3D A;  4IR6 A;  4O7A A;  5FFV A;  5F62 A;  3VKH A;  5II2 A;  4UYG A;  5F1L A;  3RCW A;  5FE7 A;  2RNY A;  5F60 A;  2RNW A;  2EJN A;  4NYW A;  3O37 A;  4QZS A;  4A9F A;  3P1C A;  4N4F A;  4A9O A;  4ALG A;  2YEM A;  4QR3 A;  5CPE A;  2DVR A;  5IBN A;  5FFY A;  4NUD A;  1PUO A;  2RNX A;  2D9E A;  2WP1 A;  4CUR A;  3LQH A;  4PCI A;  2N9G A;  5D3L A;  3K2J A;  4MR4 A;  3UV5 A;  5FE4 A;  2RI7 A;  4LZ2 A;  5HQ7 A;  4IR3 A;  4QSQ A;  5EWH A;  3ONI A;  4HXM A;  5CUC A;  5KTU A;  1WUM A;  2DWW A;  3MB3 A;  2KTB B;  3P1E A;  2L5E A;  5FE8 A;  5E7D A;  4OGJ A;  4QSX A;  4YK0 A;  2R10 A;  5I86 A;  5HRX A;  5D7X A;  5D3S A;  5COI A;  5E9Y A;  4J3I A;  4YYJ A;  5F63 A;  4X2I A;  3O35 A;  5FH6 A;  4QY4 A;  3SVG A;  4N4I A;  3QZT A;  3U5P A;  5CU8 A;  5CS8 A;  2RO1 A;  5EWD A;  5KU3 A;  4O74 A;  4MEQ A;  3P1D A;  5CY9 A;  5D3J A;  4YBM A;  5CQT A;  5A5Q A;  4NR6 A;  5D3H A;  4UYF B;  5EU1 A;  5I7Y A;  4HXR A;  4CLB A;  5F36 A;  5BT4 A;  4Z6H A;  5EIS A;  4UIU A;  3LJW A;  5FE3 A;  5I40 A;  5I1Q A;  3G0L A;  2YEK A;  4WHW A;  5EWW A;  3JVL A;  5AMF A;  4ZQL A;  4YYM A;  5FFW A;  5A5S A;  4NQN A;  3IU6 A;  4A9N A;  4GPJ A;  4TYL A;  4TS8 A;  5DKH A;  5EI4 A;  5ENI A;  3HMF A;  4NR4 A;  4LDF A;  5E0R A;  5FB1 A;  4IOO A;  5FE1 A;  5KTX A;  5L99 A;  4LYS A;  5DYX A;  5A5P A;  5E3G A;  5C89 A;  4LYI A;  2OSS A;  3UVD A;  4IR4 A;  4YAT A;  5CQ7 A;  3MUK A;  3ERR A;  2YEL A;  5CQ3 A;  4O71 A;  5H1V A;  5D26 A;  2D82 A;  5LKZ A;  4O78 A;  5HQ5 A;  4LZR A;  5FE0 A;  5FH7 A;  4J0S A;  4UYE A;  4XUA A;  4BW4 A;  4Z1Q A;  4QR4 A;  2R0S A;  5HQ6 A;  4HXK A;  4XYA A;  2H60 A;  5J0D A;  3IU5 A;  4A9J A;  4YYH A;  5DKC A;  5ENH A;  3LXJ A;  5H1U A;  4YY6 A;  5DW2 A;  5D0C A;  4E96 A;  5FE9 A;  5FH8 A;  4YYI A;  2I8N A;  2YYN A;  5F25 A;  5LUU A;  5CRZ A;  4HBY A;  4Z93 A;  4UYH A;  4N4G A;  4LC2 A;  4NRA A;  1F68 A;  4HXS A;  5EM3 A;  3U5J A;  5HFQ A;  4IOR A;  4CFL A;  4O7B A;  5LKU A;  3LQJ A;  4NQM A;  2LSP B;  5CQA A;  3QZS A;  4QBM A;  4YY4 A;  5LVR A;  4A9M A;  3HME A;  2OO1 A;  4XY9 A;  5IGK A;  4YC9 A;  5KTW A;  4RVR A;  2DKW A;  2FSA A;  4KV1 A;  5HM0 A;  5LVQ A;  4ALH A;  5HEN A;  5AD3 A;  4F3I A;  2GRC A;  2RS9 B;  2WP2 A;  5ENB A;  4QSV A;  3I3J A;  1ZKR A;  4UIY A;  4PKL A;  5L8T A;  3GG3 A;  5DYA A;  3UV4 A;  5BT3 A;  4IR5 A;  5CRM A;  5A85 A;  5LJ2 A;  5HRW A;  4HXP A;  2L84 A;  4FLP A;  3G0J A;  4O77 A;  4QR5 A;  3P5O A;  5ENJ A;  4CUP A;  5EK9 A;  5DFD A;  4AKN A;  5I89 A;  4QSP A;  4CUT A;  4BW2 A;  5HEL A;  5A82 A;  5CQ5 A;  5HCL A;  5CUE A;  5EPS A;  5L96 A;  3UW9 A;  4BJX A;  4Q0O A;  4TU6 A;  4QEU A;  5DFB A;  5EIC A;  3AAD A;  4PTB A;  4TT2 A;  2YQD A;  4XY8 A;  5FDZ A;  3U5M A;  4TTE A;  5L98 A;  4TT4 A;  5FG4 A;  2DVS A;  5I88 A;  4NYX A;  4C67 A;  1EQF A;  5C87 A;  4O76 A;  5ENE A;  2DAT A;  5AD2 A;  4QUU A;  3LQI A;  5D3R A;  5CQ4 A;  4UIX A;  5ETD A;  4A9K A;  5E9M A;  3O34 A;  2DVV A;  5A83 A;  2RFJ A;  3UVX A;  4Z1S A;  4ZC9 A;  4NR8 A;  5F5Z A;  5A5O A;  4UYD A;  5C85 A;  2E7N A;  5I80 A;  4HBX A;  4MR3 A;  5CQ8 A;  3O33 A;  5F1H A;  4MR6 A;  5DW1 A;  3Q2E A;  4QSU A;  4TT6 A;  5CZG A;  5ENC A;  5A5R A;  5LJ0 A;  4CL9 A;  5FBX A;  4YH4 A;  3U5L A;  2G4A A;  5JWM A;  5TCM A;  4LRG A;  3S92 A;  4BHW A;  3DWY A;  3SVF A;  4LYW A;  2L85 A;  4UIW A;  5D25 A;  5HLS A;  4O72 A;  4YYN A;  2NXB A;  5C4Q A;  5HRV A;  4TZ2 A;  4NUC A;  5E9K A;  4A9L A;  1E6I A;  4QSR A;  4O7E A;  4UYF A;  5H1T A;  4QEW A;  4A9E A;  4BW3 A;  5HEM A;  5G4R A;  5LKX A;  5EVA A;  4TU4 A;  4YH3 A;  4QUT A;  5E9I A;  4LZS A;  3HMH A;  5CUG A;  5D3P A;  2F6N A;  4Q0N A;  4J1P A;  3U5N A;  5K29 A;  5DKD A;  4NYV A;  5DYC A;  2MJV B;  1JSP B;  4O7C A;  3ZYU A;  4YAD A;  3MUL A;  4MEO A;  5DLZ A;  4MEP A;  5CUA A;  2OUO A;  1N72 A;  4XUB A;  4C66 A;  5E73 A;  4HBV A;  4PS5 A;  4MEN A;  4N4H A;  5LKT A;  4OGI A;  4NUE A;  5KHM A;  3U5K A;  5D3N A;  5EGU A;  3S91 A; 
#chains in the Genus database with same CATH homology
 4QEV A;  2DVQ A;  5A7C A;  5II1 A;  3UVY A;  4CUQ A;  5FE5 A;  3O36 A;  4UIZ A;  5F61 A;  4YBT A;  5F2P A;  4NR7 A;  5DYU A;  5KO4 A;  4O7F A;  4HXL A;  3SVH A;  4QYL A;  4WHU A;  2R0Y A;  5AME A;  2I7K A;  5D3T A;  5EQ1 A;  5ENF A;  5IGM A;  1JM4 B;  4YAB A;  1WUG A;  3TLP A;  5FB0 A;  4QYD A;  2E7O A;  4QSS A;  4YYG A;  4O70 A;  5CGP A;  4QB3 A;  4UIT A;  2YW5 A;  5A5N A;  5I7X A;  5FE6 A;  5I83 A;  5EA1 A;  5IG6 A;  5HFR A;  4MR5 A;  3U5O A;  3UVW A;  5EPR A;  5EPB A;  5FE2 A;  4Y03 A;  4TQN A;  1ZS5 A;  5FG6 A;  4PY6 A;  4TZ8 A;  5DY7 A;  4NS5 A;  4LR6 A;  5DFC A;  5TB6 A;  5DX4 A;  4QC1 A;  5CUB A;  3P1F A;  3MB4 A;  4KV4 A;  5CQ6 A;  5JI8 A;  5CUD A;  5FG5 A;  5C8G A;  5HJC A;  3MQM A;  5ACY A;  4ZW1 A;  5LJ1 A;  5EV9 A;  5CP5 A;  4YYD A;  5F3A A;  5DBM A;  4KCX A;  5D24 A;  4QNS A;  3JVK A;  4J0R A;  4A9I A;  3QZV A;  3JVM A;  5BT5 A;  3DAI A;  5H85 A;  4PCE A;  5IID A;  3Q2F A;  4BW1 A;  4NXJ A;  5L8U A;  4IOQ A;  5DLX A;  4YBS A;  3FKM X;  4OUF A;  3JVJ A;  5IGL A;  4CFK A;  4HXO A;  5EP7 A;  4WIV A;  3MXF A;  4CUU A;  4NRC A;  5CTL A;  5ETB A;  4YYK A;  2R0V A;  3NXB A;  5E9V A;  5C7N A;  4N3W A;  4O75 A;  3AQA A;  5E74 A;  4DON A;  4NRB A;  4QST A;  4A9H A;  4HBW A;  5ENG A;  2E3K A;  3UV2 A;  5CFW A;  5EWC A;  1X0J A;  5G4S A;  4Z6I A;  2YDW A;  5L97 A;  4YAX A;  4HXN A;  5EWV A;  4QSW A;  4UIV A;  5E9L A;  5IGN A;  4NR5 A;  5I29 A;  4NR9 A;  2F6J A;  5A81 A;  3D7C A;  4QC3 A;  4CUS A;  5E3D A;  4IR6 A;  4O7A A;  5FFV A;  5F62 A;  5II2 A;  4UYG A;  5F1L A;  3RCW A;  5FE7 A;  2RNY A;  5F60 A;  2RNW A;  4NYW A;  3O37 A;  4QZS A;  4A9F A;  3P1C A;  4N4F A;  4A9O A;  4ALG A;  2YEM A;  4QR3 A;  5CPE A;  2DVR A;  5IBN A;  5FFY A;  4NUD A;  2RNX A;  2D9E A;  2WP1 A;  4CUR A;  3LQH A;  4PCI A;  2N9G A;  5D3L A;  3K2J A;  4MR4 A;  3UV5 A;  5FE4 A;  2RI7 A;  4LZ2 A;  5HQ7 A;  4IR3 A;  4QSQ A;  5EWH A;  3ONI A;  4HXM A;  5CUC A;  5KTU A;  1WUM A;  2DWW A;  3MB3 A;  2KTB B;  3P1E A;  2L5E A;  5FE8 A;  5E7D A;  4OGJ A;  4QSX A;  4YK0 A;  2R10 A;  5I86 A;  5HRX A;  5D7X A;  5D3S A;  5COI A;  5E9Y A;  4J3I A;  4YYJ A;  5F63 A;  4X2I A;  3O35 A;  5FH6 A;  4QY4 A;  3SVG A;  4N4I A;  3QZT A;  3U5P A;  5CU8 A;  5CS8 A;  2RO1 A;  5EWD A;  5KU3 A;  4O74 A;  4MEQ A;  3P1D A;  5CY9 A;  5D3J A;  4YBM A;  5CQT A;  5A5Q A;  4NR6 A;  5D3H A;  4UYF B;  5EU1 A;  5I7Y A;  4HXR A;  4CLB A;  5F36 A;  5BT4 A;  4Z6H A;  5EIS A;  4UIU A;  3LJW A;  5FE3 A;  5I40 A;  5I1Q A;  3G0L A;  2YEK A;  4WHW A;  5EWW A;  3JVL A;  5AMF A;  4ZQL A;  4YYM A;  5FFW A;  5A5S A;  4NQN A;  3IU6 A;  4A9N A;  4GPJ A;  4TYL A;  4TS8 A;  5DKH A;  5EI4 A;  5ENI A;  3HMF A;  4NR4 A;  4LDF A;  5E0R A;  5FB1 A;  4IOO A;  5FE1 A;  5KTX A;  5L99 A;  4LYS A;  5DYX A;  5A5P A;  5E3G A;  5C89 A;  4LYI A;  2OSS A;  3UVD A;  4IR4 A;  4YAT A;  5CQ7 A;  3MUK A;  2YEL A;  5CQ3 A;  4O71 A;  5H1V A;  5D26 A;  2D82 A;  5LKZ A;  4O78 A;  5HQ5 A;  4LZR A;  5FE0 A;  5FH7 A;  4J0S A;  4UYE A;  4XUA A;  4BW4 A;  4Z1Q A;  4QR4 A;  2R0S A;  5HQ6 A;  4HXK A;  4XYA A;  2H60 A;  5J0D A;  3IU5 A;  4A9J A;  4YYH A;  5DKC A;  5ENH A;  3LXJ A;  5H1U A;  4YY6 A;  5DW2 A;  5D0C A;  4E96 A;  5FE9 A;  5FH8 A;  4YYI A;  2I8N A;  2YYN A;  5F25 A;  5LUU A;  5CRZ A;  4HBY A;  4Z93 A;  4UYH A;  4N4G A;  4LC2 A;  4NRA A;  1F68 A;  4HXS A;  5EM3 A;  3U5J A;  5HFQ A;  4IOR A;  4CFL A;  4O7B A;  5LKU A;  3LQJ A;  4NQM A;  2LSP B;  5CQA A;  3QZS A;  4QBM A;  4YY4 A;  5LVR A;  4A9M A;  3HME A;  2OO1 A;  4XY9 A;  5IGK A;  4YC9 A;  5KTW A;  4RVR A;  2DKW A;  2FSA A;  4KV1 A;  5HM0 A;  5LVQ A;  4ALH A;  5HEN A;  5AD3 A;  4F3I A;  2GRC A;  2RS9 B;  2WP2 A;  5ENB A;  4QSV A;  3I3J A;  4UIY A;  4PKL A;  5L8T A;  3GG3 A;  5DYA A;  3UV4 A;  5BT3 A;  4IR5 A;  5CRM A;  5A85 A;  5LJ2 A;  5HRW A;  4HXP A;  2L84 A;  4FLP A;  3G0J A;  4O77 A;  4QR5 A;  3P5O A;  5ENJ A;  4CUP A;  5EK9 A;  5DFD A;  4AKN A;  5I89 A;  4QSP A;  4CUT A;  4BW2 A;  5HEL A;  5A82 A;  5CQ5 A;  5HCL A;  5CUE A;  5EPS A;  5L96 A;  3UW9 A;  4BJX A;  4Q0O A;  4TU6 A;  4QEU A;  5DFB A;  5EIC A;  3AAD A;  4PTB A;  4TT2 A;  2YQD A;  4XY8 A;  5FDZ A;  3U5M A;  4TTE A;  5L98 A;  4TT4 A;  5FG4 A;  2DVS A;  5I88 A;  4NYX A;  4C67 A;  1EQF A;  5C87 A;  4O76 A;  5ENE A;  2DAT A;  5AD2 A;  4QUU A;  3LQI A;  5D3R A;  5CQ4 A;  4UIX A;  5ETD A;  4A9K A;  5E9M A;  3O34 A;  2DVV A;  5A83 A;  2RFJ A;  3UVX A;  4Z1S A;  4ZC9 A;  4NR8 A;  5F5Z A;  5A5O A;  4UYD A;  5C85 A;  2E7N A;  5I80 A;  4HBX A;  4MR3 A;  5CQ8 A;  3O33 A;  5F1H A;  4MR6 A;  5DW1 A;  3Q2E A;  4QSU A;  4TT6 A;  5CZG A;  5ENC A;  5A5R A;  5LJ0 A;  4CL9 A;  5FBX A;  4YH4 A;  3U5L A;  2G4A A;  5JWM A;  5TCM A;  4LRG A;  3S92 A;  4BHW A;  3DWY A;  3SVF A;  4LYW A;  2L85 A;  4UIW A;  5D25 A;  5HLS A;  4O72 A;  4YYN A;  2NXB A;  5C4Q A;  5HRV A;  4TZ2 A;  4NUC A;  5E9K A;  4A9L A;  1E6I A;  4QSR A;  4O7E A;  4UYF A;  5H1T A;  4QEW A;  4A9E A;  4BW3 A;  5HEM A;  5G4R A;  5LKX A;  5EVA A;  4TU4 A;  4YH3 A;  4QUT A;  5E9I A;  4LZS A;  3HMH A;  5CUG A;  5D3P A;  2F6N A;  4Q0N A;  4J1P A;  3U5N A;  5K29 A;  5DKD A;  4NYV A;  5DYC A;  2MJV B;  1JSP B;  4O7C A;  3ZYU A;  4YAD A;  3MUL A;  4MEO A;  5DLZ A;  4MEP A;  5CUA A;  2OUO A;  1N72 A;  4XUB A;  4C66 A;  5E73 A;  4HBV A;  4PS5 A;  4MEN A;  4N4H A;  5LKT A;  4OGI A;  4NUE A;  5KHM A;  3U5K A;  5D3N A;  5EGU A;  3S91 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...