5CS8A

Crystal structure of the first bromodomain of human brd4 in complex with benzo[cd]indol-2(1h)-one ligand
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
133
structure length
133
Chain Sequence
b'HHHHHLVPRGSNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bromodomain-containing protein 4
publication title Discovery of Benzo[cd]indol-2(1H)-ones as Potent and Specific BET Bromodomain Inhibitors: Structure-Based Virtual Screening, Optimization, and Biological Evaluation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/inhibitor
total genus 44
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 2015-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5cs8A01
5EWCA 5D3RA 2E7OA 4A9FA 2I7KA 5DLZA 5FG4A 5FE3A 5FFWA 5II2A 5HJCA 3JVMA 5CU8A 3MQMA 5CQ6A 5E9MA 3MB3A 4LRGA 4LZSA 4QR5A 5ENCA 5DKHA 5FBXA 5IBNA 4IR5A 3Q2FA 4UYDA 5A5NA 3IU5A 5E74A 5E7DA 4Q0NA 5FH8A 2RS9B 4XUBA 5F60A 4QYDA 4UYGA 4NR7A 4QNSA 5FB0A 4OGJA 5D3LA 4QBMA 4YYJA 4YBTA 5BT5A 4C66A 3G0JA 5ENEA 4QSVA 3QZTA 4ZQLA 4HBXA 5HLSA 5L98A 3I3JA 3G0LA 5KTUA 4YBSA 5HELA 5EU1A 4PCIA 3O37A 5E9VA 4NS5A 5AD2A 4C67A 3AADA 5D7XA 2YQDA 4HXKA 5H1UA 5F5ZA 4HXOA 5DY7A 4OGIA 4TTEA 4IR4A 5ETDA 5AMEA 5FE5A 4Z6HA 5FE4A 5ENIA 3LXJA 4QSUA 5JI8A 4YBMA 3ONIA 3HMHA 5FE1A 4CUUA 5I88A 5JWMA 5IG6A 3GG3A 5KO4A 4NR6A 3U5OA 4NQNA 5DYUA 5AMFA 4MR3A 4PTBA 5HENA 4NR8A 2YDWA 2FSAA 4UYEA 3D7CA 3P1FA 4BJXA 4O7AA 4O77A 5I86A 3U5NA 2DWWA 4LYSA 5CUDA 2YW5A 4O78A 2OSSA 5HFRA 5CQ8A 5CUAA 5A5PA 1WUMA 5LKUA 5EI4A 5FE0A 5E9KA 3MXFA 5LJ1A 5E73A 4FLPA 5D26A 4YABA 5I29A 4IORA 4Z1SA 4WIVA 4YYIA 5I7YA 4LZ2A 5F2PA 4CURA 3Q2EA 4ZC9A 4IOOA 4QC3A 4PY6A 4TT2A 5EICA 4O7FA 5ENGA 4BW4A 5KTWA 5COIA 5FH6A 5FE2A 5HQ5A 3ZYUA 4TZ8A 4UIZA 4Y03A 4YY6A 3UW9A 5C4QA 4QSWA 4J0RA 4HBYA 4MR6A 3SVFA 4TT6A 4Z1QA 4NRCA 5D3SA 5DYXA 3U5MA 4TS8A 4WHUA 5FDZA 4CL9A 4LDFA 4NQMA 3MULA 3P1CA 4IR6A 5HEMA 5FE6A 4QYLA 5CUEA 4HXRA 5FG6A 4YAXA 5EK9A 5E9YA 4AKNA 5EISA 3UVDA 4YYDA 4CFLA 4O76A 5EWHA 3HMFA 4N3WA 2NXBA 4QY4A 2DVQA 5DX4A 5D3JA 2R10A 4A9JA 2E7NA 4QSRA 4A9LA 3O34A 4A9NA 3K2JA 3JVLA 4QSPA 2E3KA 2LSPB 4WHWA 2L84A 4XYAA 5KU3A 5CQ3A 5FG5A 5HRVA 5CGPA 2MJVB 1ZS5A 4Z93A 4CUPA 4YYHA 5H1VA 5F3AA 5EPSA 4HXSA 2L5EA 5EQ1A 4O70A 5ETBA 5A5QA 5FB1A 4DONA 4O7CA 2DVSA 5CS8A 4NR9A 4MENA 5IGKA 2R0YA 4F3IA 3IU6A 2R0VA 4QUTA 5IGLA 5EV9A 3LQHA 5A7CA 4TU4A 3HMEA 4NYWA 4QSSA 5EA1A 4YATA 4UITA 4TZ2A 2D9EA 4QEUA 2RNYA 5AD3A 4O74A 2KTBB 4NRBA 5CPEA 4QEWA 5E9LA 3O33A 4TYLA 2G4AA 4ZW1A 3U5LA 5L99A 4YY4A 4NR4A 4QR4A 1EQFA 5F25A 4N4IA 3QZVA 4O75A 2RI7A 5CQTA 5D3PA 4UIXA 2L85A 5ENFA 4YH3A 5H85A 5I83A 5I40A 4NUEA 4YYNA 5CRZA 5D24A 5DW2A 2DKWA 5II1A 4UYHA 2YYNA 3S91A 3AQAA 5KTXA 4NR5A 4YADA 5HCLA 2I8NA 2YEMA 4CUSA 5FE7A 5A82A 4A9KA 4J1PA 4ALGA 5I7XA 5DYCA 5EWWA 4HXMA 4BW2A 5C85A 3LQJA 4J3IA 3NXBA 2D82A 4PS5A 5E9IA 5FFVA 5EWVA 5HRWA 3LJWA 4BHWA 4LC2A 4QSQA 2RNWA 4PKLA 5E3GA 4HXNA 4UYFB 4LYIA 5IGNA 4YYGA 5CY9A 4HBVA 5F61A 3UV4A 5ENHA 5HQ6A 5DLXA 5G4RA 5A5RA 5L8TA 5DFBA 3S92A 5A5SA 5FE9A 4QB3A 5G4SA 2YEKA 4TQNA 4RVRA 2H60A 5CP5A 5HQ7A 3DAIA 4NUDA 5EP7A 5D25A 5TCMA 2OUOA 5CQAA 4O72A 4MEQA 5C89A 4QC1A 2WP2A 4UYFA 4ALHA 3UV5A 4OUFA 4QR3A 5F1HA 5F62A 4IOQA 3UVWA 5C87A 4TT4A 5CQ5A 5IIDA 5F1LA 4UIVA 4HBWA 4TU6A 3U5KA 5A5OA 1F68A 5L97A 1E6IA 5DKCA 4XUAA 5D3TA 4NXJA 4YK0A 4GPJA 3SVHA 5ENBA 4Q0OA 3UVXA 5CQ7A 2RFJA 4XY9A 5EWDA 2OO1A 5DFCA 5A81A 5I1QA 5LVRA 3JVKA 5J0DA 4MR4A 5EGUA 3P5OA 4NUCA 4A9MA 4YYKA 3DWYA 4MR5A 4KCXA 2F6NA 4MEPA 4N4FA 5L8UA 2YELA 5EVAA 4X2IA 3JVJA 3P1EA 4NRAA 5E0RA 4QEVA 2GRCA 5H1TA 5LVQA 4QUUA 4HXLA 4PCEA 5CUGA 2WP1A 4CUQA 3RCWA 5K29A 4YYMA 3QZSA 5DW1A 3MUKA 5TB6A 5C7NA 5HRXA 4UIWA 4J0SA 4LR6A 4E96A 3MB4A 5KHMA 4A9HA 5A85A 5LJ2A 5FH7A 5D0CA 4QSXA 5L96A 5F63A 4CFKA 2DVRA 4QSTA 5LJ0A 5CTLA 4CLBA 5LKXA 5I80A 4KV4A 4YC9A 5E3DA 3O36A 3O35A 3SVGA 5BT4A 5CRMA 5D3NA 4A9EA 5I89A 5D3HA 5DKDA 1JSPB 5ACYA 5LKZA 4IR3A 4N4GA 4KV1A 4YH4A 3UVYA 4CUTA 3U5JA 5C8GA 5LUUA 5DYAA 5LKTA 5F36A 5EPBA 3P1DA 1WUGA 5CUCA 5CFWA 5IGMA 1N72A 2DATA 4UIUA 2R0SA 4NYVA 5HFQA 4Z6IA 5BT3A 3TLPA 2RNXA 4O7EA 2RO1A 5DBMA 4BW1A 3U5PA 4A9OA 5A83A 5EM3A 4LYWA 4O71A 4N4HA 5HM0A 4HXPA 3FKMX 2N9GA 4BW3A 3UV2A 2F6JA 4XY8A 4O7BA 5CQ4A 5CZGA 1X0JA 4A9IA 5FFYA 5FE8A 4UIYA 4MEOA 2DVVA 5EPRA 5ENJA 3LQIA 4QZSA 1JM4B 4NYXA 5DFDA 5CUBA 4LZRA
chains in the Genus database with same CATH superfamily
5EWCA 5D3RA 2E7OA 4A9FA 2I7KA 5DLZA 5FG4A 5FE3A 5FFWA 5II2A 5HJCA 3JVMA 5CU8A 3MQMA 5CQ6A 5E9MA 3MB3A 4LRGA 4LZSA 4QR5A 5ENCA 5DKHA 5FBXA 5IBNA 4IR5A 3Q2FA 4UYDA 5A5NA 3IU5A 5E74A 5E7DA 4Q0NA 5FH8A 2RS9B 4XUBA 5F60A 4QYDA 4UYGA 4NR7A 4QNSA 5FB0A 4OGJA 5D3LA 4QBMA 4YYJA 4YBTA 5BT5A 4C66A 3G0JA 5ENEA 4QSVA 3QZTA 4ZQLA 4HBXA 5HLSA 5L98A 3I3JA 3G0LA 5KTUA 4YBSA 5HELA 5EU1A 4PCIA 4AKIA 3O37A 5E9VA 4NS5A 5AD2A 4C67A 3AADA 5D7XA 3VKHA 2YQDA 4HXKA 5H1UA 5F5ZA 4HXOA 5DY7A 4OGIA 4TTEA 4IR4A 5ETDA 5AMEA 5FE5A 4Z6HA 5FE4A 5ENIA 3LXJA 4QSUA 5JI8A 4YBMA 3ONIA 3HMHA 5FE1A 4CUUA 5I88A 5JWMA 5IG6A 3GG3A 5KO4A 4NR6A 3U5OA 4NQNA 5DYUA 5AMFA 4MR3A 4PTBA 5HENA 4NR8A 2YDWA 2FSAA 4UYEA 3D7CA 3P1FA 4BJXA 4O7AA 4O77A 5I86A 3U5NA 4AKHA 2DWWA 4LYSA 5CUDA 2YW5A 4O78A 2OSSA 5HFRA 5CQ8A 5CUAA 5A5PA 1WUMA 5LKUA 5EI4A 5FE0A 5E9KA 3MXFA 5LJ1A 5E73A 4FLPA 5D26A 4YABA 5I29A 4IORA 4Z1SA 4WIVA 4YYIA 5I7YA 4LZ2A 5F2PA 4CURA 3Q2EA 4ZC9A 4IOOA 4QC3A 4PY6A 4TT2A 5EICA 4O7FA 5ENGA 4BW4A 5KTWA 5COIA 5FH6A 5FE2A 5HQ5A 3ZYUA 4TZ8A 4UIZA 4Y03A 4YY6A 3UW9A 5C4QA 4QSWA 4J0RA 4HBYA 4MR6A 3SVFA 4TT6A 4Z1QA 4NRCA 5D3SA 5DYXA 3U5MA 3ERRA 4TS8A 4WHUA 5FDZA 4CL9A 4LDFA 4NQMA 3MULA 3P1CA 4IR6A 5HEMA 5FE6A 4QYLA 5CUEA 4HXRA 5FG6A 4YAXA 5EK9A 5E9YA 4AKNA 5EISA 3UVDA 4YYDA 4CFLA 4O76A 5EWHA 3HMFA 4N3WA 2NXBA 4QY4A 2DVQA 5DX4A 5D3JA 2R10A 4A9JA 2E7NA 4QSRA 4A9LA 3O34A 4A9NA 3K2JA 3JVLA 4QSPA 2E3KA 2LSPB 4WHWA 2L84A 4XYAA 5KU3A 5CQ3A 5FG5A 5HRVA 5CGPA 2MJVB 1ZS5A 4Z93A 4CUPA 4YYHA 5H1VA 5F3AA 5EPSA 4HXSA 2L5EA 5EQ1A 4O70A 5ETBA 5A5QA 5FB1A 4DONA 4O7CA 2DVSA 5CS8A 4NR9A 4MENA 5IGKA 2R0YA 4F3IA 3IU6A 2R0VA 4QUTA 5IGLA 3D1DA 5EV9A 3LQHA 5A7CA 4TU4A 3HMEA 4NYWA 4QSSA 5EA1A 4YATA 4UITA 4TZ2A 2D9EA 4QEUA 2RNYA 5AD3A 4O74A 2KTBB 4NRBA 5CPEA 4QEWA 5E9LA 2EJNA 3O33A 4TYLA 2G4AA 4ZW1A 3U5LA 5L99A 4YY4A 4NR4A 4QR4A 1EQFA 5F25A 4N4IA 3QZVA 4O75A 2RI7A 5CQTA 5D3PA 4UIXA 2L85A 5ENFA 4YH3A 5H85A 5I83A 5I40A 4NUEA 4YYNA 5CRZA 5D24A 5DW2A 2DKWA 5II1A 4UYHA 2YYNA 3S91A 3AQAA 5KTXA 4NR5A 4YADA 5HCLA 2I8NA 2YEMA 4CUSA 5FE7A 5A82A 4A9KA 4J1PA 4ALGA 5I7XA 5DYCA 5EWWA 4HXMA 4BW2A 5C85A 3LQJA 4J3IA 3NXBA 2D82A 4PS5A 5E9IA 5FFVA 5EWVA 5HRWA 3LJWA 4BHWA 4LC2A 4QSQA 2RNWA 4PKLA 5E3GA 4HXNA 4UYFB 4LYIA 5IGNA 4YYGA 5CY9A 4HBVA 5F61A 3UV4A 5ENHA 5HQ6A 5DLXA 5G4RA 5A5RA 5L8TA 5DFBA 3S92A 5A5SA 5FE9A 4QB3A 5G4SA 2YEKA 4TQNA 4RVRA 2H60A 5CP5A 5HQ7A 3DAIA 4NUDA 5EP7A 5D25A 5TCMA 2OUOA 5CQAA 4O72A 4MEQA 5C89A 4QC1A 2WP2A 4UYFA 4ALHA 3UV5A 4OUFA 4QR3A 5F1HA 5F62A 4IOQA 3UVWA 5C87A 4TT4A 5CQ5A 5IIDA 5F1LA 4UIVA 4HBWA 4TU6A 3U5KA 5A5OA 1F68A 5L97A 1E6IA 5DKCA 4XUAA 5D3TA 4NXJA 4YK0A 4GPJA 3SVHA 5ENBA 4Q0OA 3UVXA 5CQ7A 2RFJA 4XY9A 5EWDA 2OO1A 5DFCA 5A81A 5I1QA 5LVRA 3JVKA 5J0DA 1ZKRA 4MR4A 5EGUA 3P5OA 4NUCA 4A9MA 4YYKA 3DWYA 4MR5A 4KCXA 2F6NA 4MEPA 4N4FA 5L8UA 2YELA 5EVAA 4X2IA 3JVJA 3P1EA 4NRAA 5E0RA 4QEVA 2GRCA 5H1TA 5LVQA 4QUUA 4HXLA 4PCEA 5CUGA 2WP1A 4CUQA 3RCWA 5K29A 4YYMA 3QZSA 5DW1A 3MUKA 5TB6A 5C7NA 5HRXA 4UIWA 4J0SA 4LR6A 4E96A 3MB4A 5KHMA 4A9HA 5A85A 5LJ2A 5FH7A 5D0CA 4QSXA 5L96A 4AKGA 5F63A 4CFKA 2DVRA 4QSTA 5LJ0A 5CTLA 4CLBA 5LKXA 5I80A 4KV4A 4YC9A 5E3DA 3O36A 3O35A 1PUOA 3SVGA 5BT4A 5CRMA 5D3NA 4A9EA 5I89A 5D3HA 5DKDA 1JSPB 5ACYA 5LKZA 4IR3A 4N4GA 4KV1A 4YH4A 3UVYA 4CUTA 3U5JA 5C8GA 5LUUA 5DYAA 5LKTA 3VKGA 5F36A 5EPBA 3P1DA 1WUGA 5CUCA 5CFWA 5IGMA 1N72A 2DATA 4UIUA 2R0SA 4NYVA 5HFQA 4Z6IA 5BT3A 3TLPA 4AI6A 2RNXA 4O7EA 2RO1A 5DBMA 4BW1A 3U5PA 4A9OA 5A83A 5EM3A 4LYWA 4O71A 4N4HA 5HM0A 4HXPA 3FKMX 2N9GA 4BW3A 3UV2A 2F6JA 4XY8A 4O7BA 5CQ4A 5CZGA 1X0JA 4A9IA 5FFYA 5FE8A 4UIYA 4MEOA 2DVVA 5EPRA 5ENJA 3LQIA 4QZSA 1JM4B 3D1BA 4NYXA 5DFDA 5CUBA 4LZRA
chains in the Genus database with same CATH topology
5EWCA 5D3RA 2E7OA 4A9FA 2I7KA 5DLZA 5FG4A 5FE3A 5FFWA 5II2A 5HJCA 3JVMA 5CU8A 3MQMA 5CQ6A 5E9MA 3MB3A 4LRGA 4LZSA 4QR5A 5ENCA 5DKHA 5FBXA 5IBNA 4IR5A 3Q2FA 4UYDA 5A5NA 3IU5A 5E74A 5E7DA 4Q0NA 5FH8A 2RS9B 4XUBA 5F60A 4QYDA 4UYGA 4NR7A 4QNSA 5FB0A 4OGJA 5D3LA 4QBMA 4YYJA 4YBTA 5BT5A 4C66A 3G0JA 5ENEA 4QSVA 3QZTA 4ZQLA 4HBXA 5HLSA 5L98A 3I3JA 3G0LA 5KTUA 4YBSA 5HELA 5EU1A 4PCIA 3O37A 5E9VA 4NS5A 5AD2A 4C67A 3AADA 5D7XA 2YQDA 4HXKA 5H1UA 5F5ZA 4HXOA 5DY7A 4OGIA 4TTEA 4IR4A 5ETDA 5AMEA 5FE5A 4Z6HA 5FE4A 5ENIA 3LXJA 4QSUA 5JI8A 4YBMA 3ONIA 3HMHA 5FE1A 4CUUA 5I88A 5JWMA 5IG6A 3GG3A 5KO4A 4NR6A 3U5OA 4NQNA 5DYUA 5AMFA 4MR3A 4PTBA 5HENA 4NR8A 2YDWA 2FSAA 4UYEA 3D7CA 3P1FA 4BJXA 4O7AA 4O77A 5I86A 3U5NA 2DWWA 4LYSA 5CUDA 2YW5A 4O78A 2OSSA 5HFRA 5CQ8A 5CUAA 5A5PA 1WUMA 5LKUA 5EI4A 5FE0A 5E9KA 3MXFA 5LJ1A 5E73A 4FLPA 5D26A 4YABA 5I29A 4IORA 4Z1SA 4WIVA 4YYIA 5I7YA 4LZ2A 5F2PA 4CURA 3Q2EA 4ZC9A 4IOOA 4QC3A 4PY6A 4TT2A 5EICA 4O7FA 5ENGA 4BW4A 5KTWA 5COIA 5FH6A 5FE2A 5HQ5A 3ZYUA 4TZ8A 4UIZA 4Y03A 4YY6A 3UW9A 5C4QA 4QSWA 4J0RA 4HBYA 4MR6A 3SVFA 4TT6A 4Z1QA 4NRCA 5D3SA 5DYXA 3U5MA 4TS8A 4WHUA 5FDZA 4CL9A 4LDFA 4NQMA 3MULA 3P1CA 4IR6A 5HEMA 5FE6A 4QYLA 5CUEA 4HXRA 5FG6A 4YAXA 5EK9A 5E9YA 4AKNA 5EISA 3UVDA 4YYDA 4CFLA 4O76A 5EWHA 3HMFA 4N3WA 2NXBA 4QY4A 2DVQA 5DX4A 5D3JA 2R10A 4A9JA 2E7NA 4QSRA 4A9LA 3O34A 4A9NA 3K2JA 3JVLA 4QSPA 2E3KA 2LSPB 4WHWA 2L84A 4XYAA 5KU3A 5CQ3A 5FG5A 5HRVA 5CGPA 2MJVB 1ZS5A 4Z93A 4CUPA 4YYHA 5H1VA 5F3AA 5EPSA 4HXSA 2L5EA 5EQ1A 4O70A 5ETBA 5A5QA 5FB1A 4DONA 4O7CA 2DVSA 5CS8A 4NR9A 4MENA 5IGKA 2R0YA 4F3IA 3IU6A 2R0VA 4QUTA 5IGLA 5EV9A 3LQHA 5A7CA 4TU4A 3HMEA 4NYWA 4QSSA 5EA1A 4YATA 4UITA 4TZ2A 2D9EA 4QEUA 2RNYA 5AD3A 4O74A 2KTBB 4NRBA 5CPEA 4QEWA 5E9LA 3O33A 4TYLA 2G4AA 4ZW1A 3U5LA 5L99A 4YY4A 4NR4A 4QR4A 1EQFA 5F25A 4N4IA 3QZVA 4O75A 2RI7A 5CQTA 5D3PA 4UIXA 2L85A 5ENFA 4YH3A 5H85A 5I83A 5I40A 4NUEA 4YYNA 5CRZA 5D24A 5DW2A 2DKWA 5II1A 4UYHA 2YYNA 3S91A 3AQAA 5KTXA 4NR5A 4YADA 5HCLA 2I8NA 2YEMA 4CUSA 5FE7A 5A82A 4A9KA 4J1PA 4ALGA 5I7XA 5DYCA 5EWWA 4HXMA 4BW2A 5C85A 3LQJA 4J3IA 3NXBA 2D82A 4PS5A 5E9IA 5FFVA 5EWVA 5HRWA 3LJWA 4BHWA 4LC2A 4QSQA 2RNWA 4PKLA 5E3GA 4HXNA 4UYFB 4LYIA 5IGNA 4YYGA 5CY9A 4HBVA 5F61A 3UV4A 5ENHA 5HQ6A 5DLXA 5G4RA 5A5RA 5L8TA 5DFBA 3S92A 5A5SA 5FE9A 4QB3A 5G4SA 2YEKA 4TQNA 4RVRA 2H60A 5CP5A 5HQ7A 3DAIA 4NUDA 5EP7A 5D25A 5TCMA 2OUOA 5CQAA 4O72A 4MEQA 5C89A 4QC1A 2WP2A 4UYFA 4ALHA 3UV5A 4OUFA 4QR3A 5F1HA 5F62A 4IOQA 3UVWA 5C87A 4TT4A 5CQ5A 5IIDA 5F1LA 4UIVA 4HBWA 4TU6A 3U5KA 5A5OA 1F68A 5L97A 1E6IA 5DKCA 4XUAA 5D3TA 4NXJA 4YK0A 4GPJA 3SVHA 5ENBA 4Q0OA 3UVXA 5CQ7A 2RFJA 4XY9A 5EWDA 2OO1A 5DFCA 5A81A 5I1QA 5LVRA 3JVKA 5J0DA 4MR4A 5EGUA 3P5OA 4NUCA 4A9MA 4YYKA 3DWYA 4MR5A 4KCXA 2F6NA 4MEPA 4N4FA 5L8UA 2YELA 5EVAA 4X2IA 3JVJA 3P1EA 4NRAA 5E0RA 4QEVA 2GRCA 5H1TA 5LVQA 4QUUA 4HXLA 4PCEA 5CUGA 2WP1A 4CUQA 3RCWA 5K29A 4YYMA 3QZSA 5DW1A 3MUKA 5TB6A 5C7NA 5HRXA 4UIWA 4J0SA 4LR6A 4E96A 3MB4A 5KHMA 4A9HA 5A85A 5LJ2A 5FH7A 5D0CA 4QSXA 5L96A 5F63A 4CFKA 2DVRA 4QSTA 5LJ0A 5CTLA 4CLBA 5LKXA 5I80A 4KV4A 4YC9A 5E3DA 3O36A 3O35A 3SVGA 5BT4A 5CRMA 5D3NA 4A9EA 5I89A 5D3HA 5DKDA 1JSPB 5ACYA 5LKZA 4IR3A 4N4GA 4KV1A 4YH4A 3UVYA 4CUTA 3U5JA 5C8GA 5LUUA 5DYAA 5LKTA 5F36A 5EPBA 3P1DA 1WUGA 5CUCA 5CFWA 5IGMA 1N72A 2DATA 4UIUA 2R0SA 4NYVA 5HFQA 4Z6IA 5BT3A 3TLPA 2RNXA 4O7EA 2RO1A 5DBMA 4BW1A 3U5PA 4A9OA 5A83A 5EM3A 4LYWA 4O71A 4N4HA 5HM0A 4HXPA 3FKMX 2N9GA 4BW3A 3UV2A 2F6JA 4XY8A 4O7BA 5CQ4A 5CZGA 1X0JA 4A9IA 5FFYA 5FE8A 4UIYA 4MEOA 2DVVA 5EPRA 5ENJA 3LQIA 4QZSA 1JM4B 4NYXA 5DFDA 5CUBA 4LZRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EWC A;  5D3R A;  2E7O A;  4A9F A;  2I7K A;  5DLZ A;  5FG4 A;  5FE3 A;  5FFW A;  5II2 A;  5HJC A;  3JVM A;  5CU8 A;  3MQM A;  5CQ6 A;  5E9M A;  3MB3 A;  4LRG A;  4LZS A;  4QR5 A;  5ENC A;  5DKH A;  5FBX A;  5IBN A;  4IR5 A;  3Q2F A;  4UYD A;  5A5N A;  3IU5 A;  5E74 A;  5E7D A;  4Q0N A;  5FH8 A;  2RS9 B;  4XUB A;  5F60 A;  4QYD A;  4UYG A;  4NR7 A;  4QNS A;  5FB0 A;  4OGJ A;  5D3L A;  4QBM A;  4YYJ A;  4YBT A;  5BT5 A;  4C66 A;  3G0J A;  5ENE A;  4QSV A;  3QZT A;  4ZQL A;  4HBX A;  5HLS A;  5L98 A;  3I3J A;  3G0L A;  5KTU A;  4YBS A;  5HEL A;  5EU1 A;  4PCI A;  3O37 A;  5E9V A;  4NS5 A;  5AD2 A;  4C67 A;  3AAD A;  5D7X A;  2YQD A;  4HXK A;  5H1U A;  5F5Z A;  4HXO A;  5DY7 A;  4OGI A;  4TTE A;  4IR4 A;  5ETD A;  5AME A;  5FE5 A;  4Z6H A;  5FE4 A;  5ENI A;  3LXJ A;  4QSU A;  5JI8 A;  4YBM A;  3ONI A;  3HMH A;  5FE1 A;  4CUU A;  5I88 A;  5JWM A;  5IG6 A;  3GG3 A;  5KO4 A;  4NR6 A;  3U5O A;  4NQN A;  5DYU A;  5AMF A;  4MR3 A;  4PTB A;  5HEN A;  4NR8 A;  2YDW A;  2FSA A;  4UYE A;  3D7C A;  3P1F A;  4BJX A;  4O7A A;  4O77 A;  5I86 A;  3U5N A;  2DWW A;  4LYS A;  5CUD A;  2YW5 A;  4O78 A;  2OSS A;  5HFR A;  5CQ8 A;  5CUA A;  5A5P A;  1WUM A;  5LKU A;  5EI4 A;  5FE0 A;  5E9K A;  3MXF A;  5LJ1 A;  5E73 A;  4FLP A;  5D26 A;  4YAB A;  5I29 A;  4IOR A;  4Z1S A;  4WIV A;  4YYI A;  5I7Y A;  4LZ2 A;  5F2P A;  4CUR A;  3Q2E A;  4ZC9 A;  4IOO A;  4QC3 A;  4PY6 A;  4TT2 A;  5EIC A;  4O7F A;  5ENG A;  4BW4 A;  5KTW A;  5COI A;  5FH6 A;  5FE2 A;  5HQ5 A;  3ZYU A;  4TZ8 A;  4UIZ A;  4Y03 A;  4YY6 A;  3UW9 A;  5C4Q A;  4QSW A;  4J0R A;  4HBY A;  4MR6 A;  3SVF A;  4TT6 A;  4Z1Q A;  4NRC A;  5D3S A;  5DYX A;  3U5M A;  4TS8 A;  4WHU A;  5FDZ A;  4CL9 A;  4LDF A;  4NQM A;  3MUL A;  3P1C A;  4IR6 A;  5HEM A;  5FE6 A;  4QYL A;  5CUE A;  4HXR A;  5FG6 A;  4YAX A;  5EK9 A;  5E9Y A;  4AKN A;  5EIS A;  3UVD A;  4YYD A;  4CFL A;  4O76 A;  5EWH A;  3HMF A;  4N3W A;  2NXB A;  4QY4 A;  2DVQ A;  5DX4 A;  5D3J A;  2R10 A;  4A9J A;  2E7N A;  4QSR A;  4A9L A;  3O34 A;  4A9N A;  3K2J A;  3JVL A;  4QSP A;  2E3K A;  2LSP B;  4WHW A;  2L84 A;  4XYA A;  5KU3 A;  5CQ3 A;  5FG5 A;  5HRV A;  5CGP A;  2MJV B;  1ZS5 A;  4Z93 A;  4CUP A;  4YYH A;  5H1V A;  5F3A A;  5EPS A;  4HXS A;  2L5E A;  5EQ1 A;  4O70 A;  5ETB A;  5A5Q A;  5FB1 A;  4DON A;  4O7C A;  2DVS A;  5CS8 A;  4NR9 A;  4MEN A;  5IGK A;  2R0Y A;  4F3I A;  3IU6 A;  2R0V A;  4QUT A;  5IGL A;  5EV9 A;  3LQH A;  5A7C A;  4TU4 A;  3HME A;  4NYW A;  4QSS A;  5EA1 A;  4YAT A;  4UIT A;  4TZ2 A;  2D9E A;  4QEU A;  2RNY A;  5AD3 A;  4O74 A;  2KTB B;  4NRB A;  5CPE A;  4QEW A;  5E9L A;  3O33 A;  4TYL A;  2G4A A;  4ZW1 A;  3U5L A;  5L99 A;  4YY4 A;  4NR4 A;  4QR4 A;  1EQF A;  5F25 A;  4N4I A;  3QZV A;  4O75 A;  2RI7 A;  5CQT A;  5D3P A;  4UIX A;  2L85 A;  5ENF A;  4YH3 A;  5H85 A;  5I83 A;  5I40 A;  4NUE A;  4YYN A;  5CRZ A;  5D24 A;  5DW2 A;  2DKW A;  5II1 A;  4UYH A;  2YYN A;  3S91 A;  3AQA A;  5KTX A;  4NR5 A;  4YAD A;  5HCL A;  2I8N A;  2YEM A;  4CUS A;  5FE7 A;  5A82 A;  4A9K A;  4J1P A;  4ALG A;  5I7X A;  5DYC A;  5EWW A;  4HXM A;  4BW2 A;  5C85 A;  3LQJ A;  4J3I A;  3NXB A;  2D82 A;  4PS5 A;  5E9I A;  5FFV A;  5EWV A;  5HRW A;  3LJW A;  4BHW A;  4LC2 A;  4QSQ A;  2RNW A;  4PKL A;  5E3G A;  4HXN A;  4UYF B;  4LYI A;  5IGN A;  4YYG A;  5CY9 A;  4HBV A;  5F61 A;  3UV4 A;  5ENH A;  5HQ6 A;  5DLX A;  5G4R A;  5A5R A;  5L8T A;  5DFB A;  3S92 A;  5A5S A;  5FE9 A;  4QB3 A;  5G4S A;  2YEK A;  4TQN A;  4RVR A;  2H60 A;  5CP5 A;  5HQ7 A;  3DAI A;  4NUD A;  5EP7 A;  5D25 A;  5TCM A;  2OUO A;  5CQA A;  4O72 A;  4MEQ A;  5C89 A;  4QC1 A;  2WP2 A;  4UYF A;  4ALH A;  3UV5 A;  4OUF A;  4QR3 A;  5F1H A;  5F62 A;  4IOQ A;  3UVW A;  5C87 A;  4TT4 A;  5CQ5 A;  5IID A;  5F1L A;  4UIV A;  4HBW A;  4TU6 A;  3U5K A;  5A5O A;  1F68 A;  5L97 A;  1E6I A;  5DKC A;  4XUA A;  5D3T A;  4NXJ A;  4YK0 A;  4GPJ A;  3SVH A;  5ENB A;  4Q0O A;  3UVX A;  5CQ7 A;  2RFJ A;  4XY9 A;  5EWD A;  2OO1 A;  5DFC A;  5A81 A;  5I1Q A;  5LVR A;  3JVK A;  5J0D A;  4MR4 A;  5EGU A;  3P5O A;  4NUC A;  4A9M A;  4YYK A;  3DWY A;  4MR5 A;  4KCX A;  2F6N A;  4MEP A;  4N4F A;  5L8U A;  2YEL A;  5EVA A;  4X2I A;  3JVJ A;  3P1E A;  4NRA A;  5E0R A;  4QEV A;  2GRC A;  5H1T A;  5LVQ A;  4QUU A;  4HXL A;  4PCE A;  5CUG A;  2WP1 A;  4CUQ A;  3RCW A;  5K29 A;  4YYM A;  3QZS A;  5DW1 A;  3MUK A;  5TB6 A;  5C7N A;  5HRX A;  4UIW A;  4J0S A;  4LR6 A;  4E96 A;  3MB4 A;  5KHM A;  4A9H A;  5A85 A;  5LJ2 A;  5FH7 A;  5D0C A;  4QSX A;  5L96 A;  5F63 A;  4CFK A;  2DVR A;  4QST A;  5LJ0 A;  5CTL A;  4CLB A;  5LKX A;  5I80 A;  4KV4 A;  4YC9 A;  5E3D A;  3O36 A;  3O35 A;  3SVG A;  5BT4 A;  5CRM A;  5D3N A;  4A9E A;  5I89 A;  5D3H A;  5DKD A;  1JSP B;  5ACY A;  5LKZ A;  4IR3 A;  4N4G A;  4KV1 A;  4YH4 A;  3UVY A;  4CUT A;  3U5J A;  5C8G A;  5LUU A;  5DYA A;  5LKT A;  5F36 A;  5EPB A;  3P1D A;  1WUG A;  5CUC A;  5CFW A;  5IGM A;  1N72 A;  2DAT A;  4UIU A;  2R0S A;  4NYV A;  5HFQ A;  4Z6I A;  5BT3 A;  3TLP A;  2RNX A;  4O7E A;  2RO1 A;  5DBM A;  4BW1 A;  3U5P A;  4A9O A;  5A83 A;  5EM3 A;  4LYW A;  4O71 A;  4N4H A;  5HM0 A;  4HXP A;  3FKM X;  2N9G A;  4BW3 A;  3UV2 A;  2F6J A;  4XY8 A;  4O7B A;  5CQ4 A;  5CZG A;  1X0J A;  4A9I A;  5FFY A;  5FE8 A;  4UIY A;  4MEO A;  2DVV A;  5EPR A;  5ENJ A;  3LQI A;  4QZS A;  1JM4 B;  4NYX A;  5DFD A;  5CUB A;  4LZR A; 
#chains in the Genus database with same CATH topology
 5EWC A;  5D3R A;  2E7O A;  4A9F A;  2I7K A;  5DLZ A;  5FG4 A;  5FE3 A;  5FFW A;  5II2 A;  5HJC A;  3JVM A;  5CU8 A;  3MQM A;  5CQ6 A;  5E9M A;  3MB3 A;  4LRG A;  4LZS A;  4QR5 A;  5ENC A;  5DKH A;  5FBX A;  5IBN A;  4IR5 A;  3Q2F A;  4UYD A;  5A5N A;  3IU5 A;  5E74 A;  5E7D A;  4Q0N A;  5FH8 A;  2RS9 B;  4XUB A;  5F60 A;  4QYD A;  4UYG A;  4NR7 A;  4QNS A;  5FB0 A;  4OGJ A;  5D3L A;  4QBM A;  4YYJ A;  4YBT A;  5BT5 A;  4C66 A;  3G0J A;  5ENE A;  4QSV A;  3QZT A;  4ZQL A;  4HBX A;  5HLS A;  5L98 A;  3I3J A;  3G0L A;  5KTU A;  4YBS A;  5HEL A;  5EU1 A;  4PCI A;  4AKI A;  3O37 A;  5E9V A;  4NS5 A;  5AD2 A;  4C67 A;  3AAD A;  5D7X A;  3VKH A;  2YQD A;  4HXK A;  5H1U A;  5F5Z A;  4HXO A;  5DY7 A;  4OGI A;  4TTE A;  4IR4 A;  5ETD A;  5AME A;  5FE5 A;  4Z6H A;  5FE4 A;  5ENI A;  3LXJ A;  4QSU A;  5JI8 A;  4YBM A;  3ONI A;  3HMH A;  5FE1 A;  4CUU A;  5I88 A;  5JWM A;  5IG6 A;  3GG3 A;  5KO4 A;  4NR6 A;  3U5O A;  4NQN A;  5DYU A;  5AMF A;  4MR3 A;  4PTB A;  5HEN A;  4NR8 A;  2YDW A;  2FSA A;  4UYE A;  3D7C A;  3P1F A;  4BJX A;  4O7A A;  4O77 A;  5I86 A;  3U5N A;  4AKH A;  2DWW A;  4LYS A;  5CUD A;  2YW5 A;  4O78 A;  2OSS A;  5HFR A;  5CQ8 A;  5CUA A;  5A5P A;  1WUM A;  5LKU A;  5EI4 A;  5FE0 A;  5E9K A;  3MXF A;  5LJ1 A;  5E73 A;  4FLP A;  5D26 A;  4YAB A;  5I29 A;  4IOR A;  4Z1S A;  4WIV A;  4YYI A;  5I7Y A;  4LZ2 A;  5F2P A;  4CUR A;  3Q2E A;  4ZC9 A;  4IOO A;  4QC3 A;  4PY6 A;  4TT2 A;  5EIC A;  4O7F A;  5ENG A;  4BW4 A;  5KTW A;  5COI A;  5FH6 A;  5FE2 A;  5HQ5 A;  3ZYU A;  4TZ8 A;  4UIZ A;  4Y03 A;  4YY6 A;  3UW9 A;  5C4Q A;  4QSW A;  4J0R A;  4HBY A;  4MR6 A;  3SVF A;  4TT6 A;  4Z1Q A;  4NRC A;  5D3S A;  5DYX A;  3U5M A;  3ERR A;  4TS8 A;  4WHU A;  5FDZ A;  4CL9 A;  4LDF A;  4NQM A;  3MUL A;  3P1C A;  4IR6 A;  5HEM A;  5FE6 A;  4QYL A;  5CUE A;  4HXR A;  5FG6 A;  4YAX A;  5EK9 A;  5E9Y A;  4AKN A;  5EIS A;  3UVD A;  4YYD A;  4CFL A;  4O76 A;  5EWH A;  3HMF A;  4N3W A;  2NXB A;  4QY4 A;  2DVQ A;  5DX4 A;  5D3J A;  2R10 A;  4A9J A;  2E7N A;  4QSR A;  4A9L A;  3O34 A;  4A9N A;  3K2J A;  3JVL A;  4QSP A;  2E3K A;  2LSP B;  4WHW A;  2L84 A;  4XYA A;  5KU3 A;  5CQ3 A;  5FG5 A;  5HRV A;  5CGP A;  2MJV B;  1ZS5 A;  4Z93 A;  4CUP A;  4YYH A;  5H1V A;  5F3A A;  5EPS A;  4HXS A;  2L5E A;  5EQ1 A;  4O70 A;  5ETB A;  5A5Q A;  5FB1 A;  4DON A;  4O7C A;  2DVS A;  5CS8 A;  4NR9 A;  4MEN A;  5IGK A;  2R0Y A;  4F3I A;  3IU6 A;  2R0V A;  4QUT A;  5IGL A;  3D1D A;  5EV9 A;  3LQH A;  5A7C A;  4TU4 A;  3HME A;  4NYW A;  4QSS A;  5EA1 A;  4YAT A;  4UIT A;  4TZ2 A;  2D9E A;  4QEU A;  2RNY A;  5AD3 A;  4O74 A;  2KTB B;  4NRB A;  5CPE A;  4QEW A;  5E9L A;  2EJN A;  3O33 A;  4TYL A;  2G4A A;  4ZW1 A;  3U5L A;  5L99 A;  4YY4 A;  4NR4 A;  4QR4 A;  1EQF A;  5F25 A;  4N4I A;  3QZV A;  4O75 A;  2RI7 A;  5CQT A;  5D3P A;  4UIX A;  2L85 A;  5ENF A;  4YH3 A;  5H85 A;  5I83 A;  5I40 A;  4NUE A;  4YYN A;  5CRZ A;  5D24 A;  5DW2 A;  2DKW A;  5II1 A;  4UYH A;  2YYN A;  3S91 A;  3AQA A;  5KTX A;  4NR5 A;  4YAD A;  5HCL A;  2I8N A;  2YEM A;  4CUS A;  5FE7 A;  5A82 A;  4A9K A;  4J1P A;  4ALG A;  5I7X A;  5DYC A;  5EWW A;  4HXM A;  4BW2 A;  5C85 A;  3LQJ A;  4J3I A;  3NXB A;  2D82 A;  4PS5 A;  5E9I A;  5FFV A;  5EWV A;  5HRW A;  3LJW A;  4BHW A;  4LC2 A;  4QSQ A;  2RNW A;  4PKL A;  5E3G A;  4HXN A;  4UYF B;  4LYI A;  5IGN A;  4YYG A;  5CY9 A;  4HBV A;  5F61 A;  3UV4 A;  5ENH A;  5HQ6 A;  5DLX A;  5G4R A;  5A5R A;  5L8T A;  5DFB A;  3S92 A;  5A5S A;  5FE9 A;  4QB3 A;  5G4S A;  2YEK A;  4TQN A;  4RVR A;  2H60 A;  5CP5 A;  5HQ7 A;  3DAI A;  4NUD A;  5EP7 A;  5D25 A;  5TCM A;  2OUO A;  5CQA A;  4O72 A;  4MEQ A;  5C89 A;  4QC1 A;  2WP2 A;  4UYF A;  4ALH A;  3UV5 A;  4OUF A;  4QR3 A;  5F1H A;  5F62 A;  4IOQ A;  3UVW A;  5C87 A;  4TT4 A;  5CQ5 A;  5IID A;  5F1L A;  4UIV A;  4HBW A;  4TU6 A;  3U5K A;  5A5O A;  1F68 A;  5L97 A;  1E6I A;  5DKC A;  4XUA A;  5D3T A;  4NXJ A;  4YK0 A;  4GPJ A;  3SVH A;  5ENB A;  4Q0O A;  3UVX A;  5CQ7 A;  2RFJ A;  4XY9 A;  5EWD A;  2OO1 A;  5DFC A;  5A81 A;  5I1Q A;  5LVR A;  3JVK A;  5J0D A;  1ZKR A;  4MR4 A;  5EGU A;  3P5O A;  4NUC A;  4A9M A;  4YYK A;  3DWY A;  4MR5 A;  4KCX A;  2F6N A;  4MEP A;  4N4F A;  5L8U A;  2YEL A;  5EVA A;  4X2I A;  3JVJ A;  3P1E A;  4NRA A;  5E0R A;  4QEV A;  2GRC A;  5H1T A;  5LVQ A;  4QUU A;  4HXL A;  4PCE A;  5CUG A;  2WP1 A;  4CUQ A;  3RCW A;  5K29 A;  4YYM A;  3QZS A;  5DW1 A;  3MUK A;  5TB6 A;  5C7N A;  5HRX A;  4UIW A;  4J0S A;  4LR6 A;  4E96 A;  3MB4 A;  5KHM A;  4A9H A;  5A85 A;  5LJ2 A;  5FH7 A;  5D0C A;  4QSX A;  5L96 A;  4AKG A;  5F63 A;  4CFK A;  2DVR A;  4QST A;  5LJ0 A;  5CTL A;  4CLB A;  5LKX A;  5I80 A;  4KV4 A;  4YC9 A;  5E3D A;  3O36 A;  3O35 A;  1PUO A;  3SVG A;  5BT4 A;  5CRM A;  5D3N A;  4A9E A;  5I89 A;  5D3H A;  5DKD A;  1JSP B;  5ACY A;  5LKZ A;  4IR3 A;  4N4G A;  4KV1 A;  4YH4 A;  3UVY A;  4CUT A;  3U5J A;  5C8G A;  5LUU A;  5DYA A;  5LKT A;  3VKG A;  5F36 A;  5EPB A;  3P1D A;  1WUG A;  5CUC A;  5CFW A;  5IGM A;  1N72 A;  2DAT A;  4UIU A;  2R0S A;  4NYV A;  5HFQ A;  4Z6I A;  5BT3 A;  3TLP A;  4AI6 A;  2RNX A;  4O7E A;  2RO1 A;  5DBM A;  4BW1 A;  3U5P A;  4A9O A;  5A83 A;  5EM3 A;  4LYW A;  4O71 A;  4N4H A;  5HM0 A;  4HXP A;  3FKM X;  2N9G A;  4BW3 A;  3UV2 A;  2F6J A;  4XY8 A;  4O7B A;  5CQ4 A;  5CZG A;  1X0J A;  4A9I A;  5FFY A;  5FE8 A;  4UIY A;  4MEO A;  2DVV A;  5EPR A;  5ENJ A;  3LQI A;  4QZS A;  1JM4 B;  3D1B A;  4NYX A;  5DFD A;  5CUB A;  4LZR A; 
#chains in the Genus database with same CATH homology
 5EWC A;  5D3R A;  2E7O A;  4A9F A;  2I7K A;  5DLZ A;  5FG4 A;  5FE3 A;  5FFW A;  5II2 A;  5HJC A;  3JVM A;  5CU8 A;  3MQM A;  5CQ6 A;  5E9M A;  3MB3 A;  4LRG A;  4LZS A;  4QR5 A;  5ENC A;  5DKH A;  5FBX A;  5IBN A;  4IR5 A;  3Q2F A;  4UYD A;  5A5N A;  3IU5 A;  5E74 A;  5E7D A;  4Q0N A;  5FH8 A;  2RS9 B;  4XUB A;  5F60 A;  4QYD A;  4UYG A;  4NR7 A;  4QNS A;  5FB0 A;  4OGJ A;  5D3L A;  4QBM A;  4YYJ A;  4YBT A;  5BT5 A;  4C66 A;  3G0J A;  5ENE A;  4QSV A;  3QZT A;  4ZQL A;  4HBX A;  5HLS A;  5L98 A;  3I3J A;  3G0L A;  5KTU A;  4YBS A;  5HEL A;  5EU1 A;  4PCI A;  3O37 A;  5E9V A;  4NS5 A;  5AD2 A;  4C67 A;  3AAD A;  5D7X A;  2YQD A;  4HXK A;  5H1U A;  5F5Z A;  4HXO A;  5DY7 A;  4OGI A;  4TTE A;  4IR4 A;  5ETD A;  5AME A;  5FE5 A;  4Z6H A;  5FE4 A;  5ENI A;  3LXJ A;  4QSU A;  5JI8 A;  4YBM A;  3ONI A;  3HMH A;  5FE1 A;  4CUU A;  5I88 A;  5JWM A;  5IG6 A;  3GG3 A;  5KO4 A;  4NR6 A;  3U5O A;  4NQN A;  5DYU A;  5AMF A;  4MR3 A;  4PTB A;  5HEN A;  4NR8 A;  2YDW A;  2FSA A;  4UYE A;  3D7C A;  3P1F A;  4BJX A;  4O7A A;  4O77 A;  5I86 A;  3U5N A;  2DWW A;  4LYS A;  5CUD A;  2YW5 A;  4O78 A;  2OSS A;  5HFR A;  5CQ8 A;  5CUA A;  5A5P A;  1WUM A;  5LKU A;  5EI4 A;  5FE0 A;  5E9K A;  3MXF A;  5LJ1 A;  5E73 A;  4FLP A;  5D26 A;  4YAB A;  5I29 A;  4IOR A;  4Z1S A;  4WIV A;  4YYI A;  5I7Y A;  4LZ2 A;  5F2P A;  4CUR A;  3Q2E A;  4ZC9 A;  4IOO A;  4QC3 A;  4PY6 A;  4TT2 A;  5EIC A;  4O7F A;  5ENG A;  4BW4 A;  5KTW A;  5COI A;  5FH6 A;  5FE2 A;  5HQ5 A;  3ZYU A;  4TZ8 A;  4UIZ A;  4Y03 A;  4YY6 A;  3UW9 A;  5C4Q A;  4QSW A;  4J0R A;  4HBY A;  4MR6 A;  3SVF A;  4TT6 A;  4Z1Q A;  4NRC A;  5D3S A;  5DYX A;  3U5M A;  4TS8 A;  4WHU A;  5FDZ A;  4CL9 A;  4LDF A;  4NQM A;  3MUL A;  3P1C A;  4IR6 A;  5HEM A;  5FE6 A;  4QYL A;  5CUE A;  4HXR A;  5FG6 A;  4YAX A;  5EK9 A;  5E9Y A;  4AKN A;  5EIS A;  3UVD A;  4YYD A;  4CFL A;  4O76 A;  5EWH A;  3HMF A;  4N3W A;  2NXB A;  4QY4 A;  2DVQ A;  5DX4 A;  5D3J A;  2R10 A;  4A9J A;  2E7N A;  4QSR A;  4A9L A;  3O34 A;  4A9N A;  3K2J A;  3JVL A;  4QSP A;  2E3K A;  2LSP B;  4WHW A;  2L84 A;  4XYA A;  5KU3 A;  5CQ3 A;  5FG5 A;  5HRV A;  5CGP A;  2MJV B;  1ZS5 A;  4Z93 A;  4CUP A;  4YYH A;  5H1V A;  5F3A A;  5EPS A;  4HXS A;  2L5E A;  5EQ1 A;  4O70 A;  5ETB A;  5A5Q A;  5FB1 A;  4DON A;  4O7C A;  2DVS A;  5CS8 A;  4NR9 A;  4MEN A;  5IGK A;  2R0Y A;  4F3I A;  3IU6 A;  2R0V A;  4QUT A;  5IGL A;  5EV9 A;  3LQH A;  5A7C A;  4TU4 A;  3HME A;  4NYW A;  4QSS A;  5EA1 A;  4YAT A;  4UIT A;  4TZ2 A;  2D9E A;  4QEU A;  2RNY A;  5AD3 A;  4O74 A;  2KTB B;  4NRB A;  5CPE A;  4QEW A;  5E9L A;  3O33 A;  4TYL A;  2G4A A;  4ZW1 A;  3U5L A;  5L99 A;  4YY4 A;  4NR4 A;  4QR4 A;  1EQF A;  5F25 A;  4N4I A;  3QZV A;  4O75 A;  2RI7 A;  5CQT A;  5D3P A;  4UIX A;  2L85 A;  5ENF A;  4YH3 A;  5H85 A;  5I83 A;  5I40 A;  4NUE A;  4YYN A;  5CRZ A;  5D24 A;  5DW2 A;  2DKW A;  5II1 A;  4UYH A;  2YYN A;  3S91 A;  3AQA A;  5KTX A;  4NR5 A;  4YAD A;  5HCL A;  2I8N A;  2YEM A;  4CUS A;  5FE7 A;  5A82 A;  4A9K A;  4J1P A;  4ALG A;  5I7X A;  5DYC A;  5EWW A;  4HXM A;  4BW2 A;  5C85 A;  3LQJ A;  4J3I A;  3NXB A;  2D82 A;  4PS5 A;  5E9I A;  5FFV A;  5EWV A;  5HRW A;  3LJW A;  4BHW A;  4LC2 A;  4QSQ A;  2RNW A;  4PKL A;  5E3G A;  4HXN A;  4UYF B;  4LYI A;  5IGN A;  4YYG A;  5CY9 A;  4HBV A;  5F61 A;  3UV4 A;  5ENH A;  5HQ6 A;  5DLX A;  5G4R A;  5A5R A;  5L8T A;  5DFB A;  3S92 A;  5A5S A;  5FE9 A;  4QB3 A;  5G4S A;  2YEK A;  4TQN A;  4RVR A;  2H60 A;  5CP5 A;  5HQ7 A;  3DAI A;  4NUD A;  5EP7 A;  5D25 A;  5TCM A;  2OUO A;  5CQA A;  4O72 A;  4MEQ A;  5C89 A;  4QC1 A;  2WP2 A;  4UYF A;  4ALH A;  3UV5 A;  4OUF A;  4QR3 A;  5F1H A;  5F62 A;  4IOQ A;  3UVW A;  5C87 A;  4TT4 A;  5CQ5 A;  5IID A;  5F1L A;  4UIV A;  4HBW A;  4TU6 A;  3U5K A;  5A5O A;  1F68 A;  5L97 A;  1E6I A;  5DKC A;  4XUA A;  5D3T A;  4NXJ A;  4YK0 A;  4GPJ A;  3SVH A;  5ENB A;  4Q0O A;  3UVX A;  5CQ7 A;  2RFJ A;  4XY9 A;  5EWD A;  2OO1 A;  5DFC A;  5A81 A;  5I1Q A;  5LVR A;  3JVK A;  5J0D A;  4MR4 A;  5EGU A;  3P5O A;  4NUC A;  4A9M A;  4YYK A;  3DWY A;  4MR5 A;  4KCX A;  2F6N A;  4MEP A;  4N4F A;  5L8U A;  2YEL A;  5EVA A;  4X2I A;  3JVJ A;  3P1E A;  4NRA A;  5E0R A;  4QEV A;  2GRC A;  5H1T A;  5LVQ A;  4QUU A;  4HXL A;  4PCE A;  5CUG A;  2WP1 A;  4CUQ A;  3RCW A;  5K29 A;  4YYM A;  3QZS A;  5DW1 A;  3MUK A;  5TB6 A;  5C7N A;  5HRX A;  4UIW A;  4J0S A;  4LR6 A;  4E96 A;  3MB4 A;  5KHM A;  4A9H A;  5A85 A;  5LJ2 A;  5FH7 A;  5D0C A;  4QSX A;  5L96 A;  5F63 A;  4CFK A;  2DVR A;  4QST A;  5LJ0 A;  5CTL A;  4CLB A;  5LKX A;  5I80 A;  4KV4 A;  4YC9 A;  5E3D A;  3O36 A;  3O35 A;  3SVG A;  5BT4 A;  5CRM A;  5D3N A;  4A9E A;  5I89 A;  5D3H A;  5DKD A;  1JSP B;  5ACY A;  5LKZ A;  4IR3 A;  4N4G A;  4KV1 A;  4YH4 A;  3UVY A;  4CUT A;  3U5J A;  5C8G A;  5LUU A;  5DYA A;  5LKT A;  5F36 A;  5EPB A;  3P1D A;  1WUG A;  5CUC A;  5CFW A;  5IGM A;  1N72 A;  2DAT A;  4UIU A;  2R0S A;  4NYV A;  5HFQ A;  4Z6I A;  5BT3 A;  3TLP A;  2RNX A;  4O7E A;  2RO1 A;  5DBM A;  4BW1 A;  3U5P A;  4A9O A;  5A83 A;  5EM3 A;  4LYW A;  4O71 A;  4N4H A;  5HM0 A;  4HXP A;  3FKM X;  2N9G A;  4BW3 A;  3UV2 A;  2F6J A;  4XY8 A;  4O7B A;  5CQ4 A;  5CZG A;  1X0J A;  4A9I A;  5FFY A;  5FE8 A;  4UIY A;  4MEO A;  2DVV A;  5EPR A;  5ENJ A;  3LQI A;  4QZS A;  1JM4 B;  4NYX A;  5DFD A;  5CUB A;  4LZR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...