4NYVA

Crystal structure of the bromodomain of human crebbp in complex with a quinazolin-one ligand
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
116
structure length
116
Chain Sequence
RKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords CREB-binding protein
publication title Crystal Structure of the Bromodomain of human CREBBP in complex with a quinazolin-one ligand
rcsb
source organism Homo sapiens
total genus 42
structure length 116
sequence length 116
chains with identical sequence B, C, D
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2013-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4nyvA00
4O75A 5A82A 5EA1A 4QYLA 4UIZA 3HMFA 2NXBA 4O7EA 4KV1A 3P5OA 4UYGA 5HQ6A 4LYWA 4QSRA 4Z93A 2R0VA 4KCXA 4LZRA 4NRAA 3P1DA 2OSSA 5DY7A 3FKMX 5CQ6A 5FFYA 4A9KA 5F3AA 4O71A 4ALHA 5H85A 4MR3A 5L8TA 4O7AA 4UIYA 4LRGA 3JVLA 5EPSA 4QEVA 5KTWA 5F60A 3S92A 4GPJA 2L84A 5CUCA 4TQNA 4UYDA 2DVRA 5FH7A 5CRZA 4J0RA 5I83A 4QSXA 4NS5A 5IG6A 5E9YA 3GG3A 5I29A 4N4GA 5D3JA 4BW2A 3QZTA 4HXSA 4ZC9A 5C7NA 3O35A 4MENA 4CFLA 4HXKA 5C87A 5D3NA 2KTBB 4NRBA 4ZW1A 4HBVA 5CP5A 5C8GA 3HMEA 3JVJA 5D3RA 5L96A 5IGKA 3G0JA 5BT3A 5F2PA 4BHWA 4IOOA 2I8NA 4YYHA 4RVRA 4NXJA 4QEUA 4HBXA 5G4SA 2N9GA 4UIVA 4Q0OA 1N72A 4TT6A 3UV5A 5I7XA 4A9NA 3AQAA 5AMEA 5J0DA 3MUKA 2E3KA 5COIA 4TT4A 5ETBA 2DWWA 4NUEA 5CQ7A 1E6IA 5DLZA 5EU1A 5HELA 5CUBA 5FG4A 5DYAA 4QSUA 5HJCA 4E96A 4OGIA 3O36A 4A9LA 4IR3A 5I88A 2YW5A 5A81A 4YAXA 4UIUA 4NRCA 4TU4A 5TCMA 1JM4B 3JVKA 4A9FA 5EWDA 5H1VA 3U5NA 5FE8A 5DFDA 5FE2A 5D3SA 4AKNA 3DAIA 4NR9A 2R0YA 3UV4A 4HBYA 2E7NA 3QZSA 4LC2A 4CUQA 5EISA 5II1A 4DONA 5LKUA 4Z6HA 5ENFA 3S91A 5CY9A 5FE6A 5LKTA 5EVAA 4WHUA 5LJ2A 2WP1A 4UIXA 4CFKA 5LJ0A 5EWCA 4YBTA 4BW1A 5D3LA 5DX4A 5FE5A 5EK9A 4YYJA 4OGJA 5E9KA 5A7CA 5CFWA 3O33A 5DYCA 5CGPA 5I86A 4MR4A 5JI8A 4QSQA 5HM0A 3U5JA 2OUOA 5CZGA 5E3DA 4NR6A 2F6JA 3P1CA 4NR4A 4QR5A 3UW9A 5E3GA 5LVRA 4XY9A 2D9EA 4KV4A 4QSVA 3O37A 4NQNA 5D3PA 2R0SA 4HXMA 5LVQA 3ONIA 2G4AA 4Z6IA 3MXFA 4XY8A 5IGNA 5I1QA 5TB6A 5EM3A 3UVYA 5EWHA 4C66A 5I89A 4QR3A 4NUDA 5DFBA 3DWYA 3UVDA 5A85A 5G4RA 5C85A 3P1FA 4PKLA 4A9HA 3MULA 4J3IA 3O34A 4XUAA 3LQJA 5EI4A 5CQTA 1ZS5A 3P1EA 5E9IA 5HFRA 4IOQA 4QNSA 5CQ8A 5EQ1A 1X0JA 1WUGA 4MEQA 1JSPB 5CUEA 3JVMA 2D82A 4YABA 5EPRA 4CUUA 4QSSA 4O70A 5II2A 4CUPA 2YELA 2H60A 4IR4A 4QR4A 4TZ2A 4TT2A 2YQDA 4QUUA 4J0SA 3U5KA 4A9JA 4A9MA 3SVHA 1EQFA 4IORA 5D3HA 2YEMA 4IR5A 5A5NA 3Q2EA 5EICA 5AMFA 2RNWA 5DKHA 5FE7A 5L97A 4A9IA 3G0LA 5DYUA 5CU8A 3UVWA 5I7YA 2RNYA 4NYWA 5HLSA 4CURA 4UYEA 4QZSA 5F25A 5F62A 5I80A 5E74A 5CUAA 4QSPA 3U5PA 3IU6A 3K2JA 5CQ5A 4FLPA 5CUGA 5HRXA 5FG6A 4QSWA 5E9MA 5DBMA 4LDFA 2YYNA 4UYFB 4NR5A 3QZVA 5HQ5A 3NXBA 3UV2A 4QYDA 5FE1A 5F5ZA 5LUUA 5EP7A 4O77A 2MJVB 4LR6A 5E0RA 5DW1A 2I7KA 4YBSA 4XUBA 3MQMA 2OO1A 5K29A 2WP2A 5KO4A 4HXLA 5H1UA 4IR6A 2L5EA 2YEKA 4J1PA 4N3WA 4O7FA 4ZQLA 4X2IA 5KTUA 5HRWA 4YK0A 2RNXA 5LKZA 5IGLA 5AD3A 4CL9A 4YYNA 5ENEA 4YY4A 5DKDA 5A5PA 4LYIA 3HMHA 5IIDA 5A5QA 2R10A 4UIWA 5ETDA 2DVSA 3LJWA 3TLPA 4TTEA 5HENA 5H1TA 5ENJA 5EGUA 4A9EA 4PTBA 3RCWA 5DYXA 4BW4A 4ALGA 4YYMA 4F3IA 4QB3A 5JWMA 4QEWA 5HEMA 3UVXA 4QUTA 1F68A 4HXOA 5HRVA 4CUSA 2YDWA 4C67A 4WHWA 4BW3A 5D26A 1WUMA 4O76A 4LYSA 5BT4A 5DW2A 5L8UA 4NYVA 2DATA 5KHMA 5E73A 5FFVA 5FE4A 5CUDA 3LQHA 5F1HA 3I3JA 2E7OA 5EWVA 4PS5A 4N4FA 4O78A 3MB4A 4HBWA 5EWWA 5D0CA 4UYHA 3U5OA 4MEOA 5IBNA 4YYIA 5KTXA 2L85A 3IU5A 4PCEA 2DVQA 5CPEA 5FBXA 5DLXA 5F1LA 5ENIA 4Y03A 5ENBA 5L99A 5C89A 5F61A 4LZ2A 5E9VA 4YATA 3ZYUA 2FSAA 3U5MA 5L98A 4YY6A 5HCLA 5ACYA 2RFJA 4XYAA 5ENGA 5ENHA 5HFQA 2F6NA 3U5LA 4OUFA 5D25A 5BT5A 5CQAA 4O7BA 4O72A 5CRMA 4YC9A 5C4QA 4YYGA 3SVGA 4YYKA 2RS9B 4MEPA 3AADA 2RO1A 4YH4A 4YADA 4CUTA 4MR6A 5D3TA 4UITA 4QY4A 4Z1SA 5DKCA 4Z1QA 5A83A 4N4IA 4QC1A 2RI7A 4PY6A 3SVFA 4LZSA 4BJXA 4HXNA 4TS8A 5FDZA 4N4HA 5FE3A 4YBMA 4O7CA 4NQMA 5FB1A 4UYFA 5FG5A 5LJ1A 5E9LA 4NUCA 3LXJA 5CQ3A 4YH3A 4YYDA 5I40A 5KU3A 4NR8A 4WIVA 4NR7A 5D24A 4MR5A 4TZ8A 5IGMA 5CQ4A 5FFWA 5LKXA 2DVVA 4HXPA 5DFCA 4NYXA 4HXRA 2LSPB 4PCIA 4QBMA 4CLBA 5EPBA 5CS8A 5AD2A 5HQ7A 2GRCA 5D7XA 5F63A 5FE0A 4TYLA 4QSTA 4QC3A 3MB3A 3LQIA 5E7DA 5CTLA 4Q0NA 5FB0A 4TU6A 5EV9A 5A5RA 2DKWA 5A5OA 5ENCA 4A9OA 3D7CA 5A5SA 4O74A 5FH8A 5FH6A 3Q2FA 5F36A 5FE9A
chains in the Genus database with same CATH superfamily
4O75A 5A82A 5EA1A 4QYLA 4UIZA 3HMFA 2NXBA 4O7EA 4KV1A 3P5OA 4UYGA 5HQ6A 4LYWA 4QSRA 4Z93A 2R0VA 4KCXA 4LZRA 4NRAA 3P1DA 2OSSA 5DY7A 3FKMX 5CQ6A 5FFYA 4A9KA 5F3AA 4O71A 4ALHA 5H85A 4MR3A 5L8TA 4O7AA 4UIYA 4LRGA 3JVLA 5EPSA 4QEVA 5KTWA 4AKGA 3VKHA 5F60A 3S92A 4GPJA 2L84A 5CUCA 4TQNA 4UYDA 2DVRA 5FH7A 5CRZA 4J0RA 5I83A 4QSXA 4NS5A 5IG6A 5E9YA 3GG3A 5I29A 4N4GA 5D3JA 4BW2A 3QZTA 4HXSA 4ZC9A 5C7NA 3O35A 4MENA 4CFLA 4HXKA 5C87A 5D3NA 2KTBB 4NRBA 4ZW1A 4HBVA 5CP5A 5C8GA 3HMEA 3JVJA 5D3RA 5L96A 5IGKA 3G0JA 5BT3A 5F2PA 4BHWA 4IOOA 2I8NA 4YYHA 4RVRA 4NXJA 4QEUA 4HBXA 5G4SA 2N9GA 4UIVA 4Q0OA 1N72A 4TT6A 3UV5A 5I7XA 4A9NA 3AQAA 5AMEA 5J0DA 2EJNA 3MUKA 2E3KA 5COIA 4TT4A 5ETBA 2DWWA 4NUEA 5CQ7A 1E6IA 5DLZA 5EU1A 5HELA 5CUBA 5FG4A 5DYAA 4QSUA 5HJCA 4E96A 4OGIA 3O36A 4A9LA 4IR3A 5I88A 2YW5A 5A81A 4YAXA 4UIUA 4NRCA 4TU4A 5TCMA 1JM4B 3JVKA 4A9FA 5EWDA 5H1VA 3U5NA 5FE8A 5DFDA 5FE2A 5D3SA 4AKNA 3DAIA 4NR9A 2R0YA 3UV4A 4HBYA 2E7NA 3QZSA 4LC2A 4CUQA 5EISA 5II1A 4DONA 5LKUA 4Z6HA 5ENFA 3S91A 5CY9A 5FE6A 5LKTA 5EVAA 4WHUA 5LJ2A 2WP1A 4UIXA 4CFKA 5LJ0A 5EWCA 4YBTA 4BW1A 5D3LA 4AKHA 5DX4A 5FE5A 5EK9A 4YYJA 4OGJA 5E9KA 5A7CA 5CFWA 3O33A 5DYCA 5CGPA 5I86A 4MR4A 5JI8A 4QSQA 5HM0A 3U5JA 2OUOA 5CZGA 5E3DA 4NR6A 2F6JA 3P1CA 4NR4A 4QR5A 3UW9A 5E3GA 5LVRA 4XY9A 2D9EA 4KV4A 4QSVA 3O37A 4NQNA 5D3PA 2R0SA 4HXMA 5LVQA 3ONIA 2G4AA 4Z6IA 3MXFA 4XY8A 5IGNA 5I1QA 5TB6A 5EM3A 3UVYA 5EWHA 1ZKRA 5I89A 3ERRA 4NUDA 4QR3A 3DWYA 5DFBA 3UVDA 5A85A 5G4RA 5C85A 3P1FA 4PKLA 4A9HA 3MULA 4J3IA 3O34A 4XUAA 3LQJA 5EI4A 5CQTA 1ZS5A 3P1EA 5E9IA 5HFRA 4IOQA 4QNSA 5CQ8A 5EQ1A 1X0JA 1WUGA 4MEQA 1JSPB 5CUEA 3JVMA 2D82A 4YABA 5EPRA 4CUUA 4QSSA 4O70A 5II2A 4CUPA 2YELA 2H60A 4IR4A 4QR4A 4TZ2A 4AKIA 4TT2A 2YQDA 4QUUA 4J0SA 3U5KA 4A9JA 4A9MA 3SVHA 1EQFA 4IORA 5D3HA 2YEMA 4IR5A 5A5NA 3Q2EA 5EICA 5AMFA 2RNWA 5DKHA 5FE7A 5L97A 4A9IA 3G0LA 5DYUA 5CU8A 3UVWA 5I7YA 2RNYA 4NYWA 5HLSA 4CURA 4UYEA 4QZSA 5F25A 5F62A 1PUOA 5I80A 5E74A 3D1DA 5CUAA 4QSPA 3U5PA 3IU6A 3K2JA 4C66A 5CQ5A 4FLPA 5CUGA 5HRXA 5FG6A 4QSWA 5E9MA 5DBMA 4LDFA 2YYNA 4UYFB 4NR5A 3D1BA 3QZVA 5HQ5A 3NXBA 3UV2A 4QYDA 5FE1A 5F5ZA 5LUUA 5EP7A 4O77A 2MJVB 4LR6A 5E0RA 5DW1A 2I7KA 4YBSA 4XUBA 3MQMA 2OO1A 5K29A 2WP2A 5KO4A 4HXLA 5H1UA 4IR6A 2L5EA 2YEKA 4J1PA 4N3WA 4O7FA 4ZQLA 4X2IA 5KTUA 5HRWA 4YK0A 2RNXA 5LKZA 5IGLA 5AD3A 4CL9A 4YYNA 5ENEA 4YY4A 5DKDA 5A5PA 4LYIA 3HMHA 5IIDA 5A5QA 2R10A 4UIWA 5ETDA 2DVSA 3LJWA 3TLPA 4TTEA 5HENA 5H1TA 5ENJA 5EGUA 4A9EA 4PTBA 3RCWA 5DYXA 4BW4A 4ALGA 4YYMA 4F3IA 4QB3A 5JWMA 4QEWA 5HEMA 3UVXA 4QUTA 1F68A 4HXOA 5HRVA 4CUSA 2YDWA 4C67A 4WHWA 4BW3A 5D26A 1WUMA 4O76A 4LYSA 5BT4A 5DW2A 5L8UA 4NYVA 2DATA 5KHMA 5E73A 5FFVA 5FE4A 5CUDA 3LQHA 5F1HA 3I3JA 2E7OA 5EWVA 4PS5A 4N4FA 4O78A 3MB4A 4HBWA 5EWWA 5D0CA 4UYHA 3U5OA 4MEOA 5IBNA 4YYIA 5KTXA 2L85A 3IU5A 4PCEA 2DVQA 5CPEA 5FBXA 5DLXA 5F1LA 5ENIA 4Y03A 5ENBA 5L99A 5C89A 5F61A 4LZ2A 5E9VA 4YATA 3ZYUA 2FSAA 3U5MA 5L98A 4YY6A 5HCLA 5ACYA 2RFJA 4XYAA 5ENGA 5ENHA 5HFQA 2F6NA 3U5LA 4OUFA 5D25A 5BT5A 5CQAA 4O7BA 4O72A 5CRMA 4YC9A 5C4QA 4YYGA 3SVGA 4YYKA 2RS9B 4MEPA 3AADA 2RO1A 4YH4A 4YADA 4CUTA 4MR6A 5D3TA 4UITA 4QY4A 4Z1SA 5DKCA 4Z1QA 3VKGA 5A83A 4N4IA 4QC1A 2RI7A 4PY6A 3SVFA 4LZSA 4BJXA 4HXNA 4TS8A 5FDZA 4N4HA 5FE3A 4YBMA 4O7CA 4NQMA 5FB1A 4UYFA 5FG5A 5LJ1A 5E9LA 4NUCA 3LXJA 5CQ3A 4YH3A 4YYDA 5I40A 5KU3A 4NR8A 4WIVA 4NR7A 5D24A 4MR5A 4TZ8A 5IGMA 5CQ4A 5FFWA 5LKXA 2DVVA 4HXPA 4NYXA 5DFCA 4HXRA 2LSPB 4PCIA 4QBMA 4CLBA 5EPBA 5CS8A 5AD2A 5HQ7A 2GRCA 5D7XA 5F63A 5FE0A 4TYLA 4QSTA 4QC3A 3MB3A 3LQIA 5E7DA 5CTLA 4Q0NA 5FB0A 4TU6A 5EV9A 5A5RA 2DKWA 5A5OA 5ENCA 4A9OA 3D7CA 5A5SA 4O74A 5FH8A 5FH6A 4AI6A 3Q2FA 5F36A 5FE9A
chains in the Genus database with same CATH topology
4O75A 5A82A 5EA1A 4QYLA 4UIZA 3HMFA 2NXBA 4O7EA 4KV1A 3P5OA 4UYGA 5HQ6A 4LYWA 4QSRA 4Z93A 2R0VA 4KCXA 4LZRA 4NRAA 3P1DA 2OSSA 5DY7A 3FKMX 5CQ6A 5FFYA 4A9KA 5F3AA 4O71A 4ALHA 5H85A 4MR3A 5L8TA 4O7AA 4UIYA 4LRGA 3JVLA 5EPSA 4QEVA 5KTWA 5F60A 3S92A 4GPJA 2L84A 5CUCA 4TQNA 4UYDA 2DVRA 5FH7A 5CRZA 4J0RA 5I83A 4QSXA 4NS5A 5IG6A 5E9YA 3GG3A 5I29A 4N4GA 5D3JA 4BW2A 3QZTA 4HXSA 4ZC9A 5C7NA 3O35A 4MENA 4CFLA 4HXKA 5C87A 5D3NA 2KTBB 4NRBA 4ZW1A 4HBVA 5CP5A 5C8GA 3HMEA 3JVJA 5D3RA 5L96A 5IGKA 3G0JA 5BT3A 5F2PA 4BHWA 4IOOA 2I8NA 4YYHA 4RVRA 4NXJA 4QEUA 4HBXA 5G4SA 2N9GA 4UIVA 4Q0OA 1N72A 4TT6A 3UV5A 5I7XA 4A9NA 3AQAA 5AMEA 5J0DA 3MUKA 2E3KA 5COIA 4TT4A 5ETBA 2DWWA 4NUEA 5CQ7A 1E6IA 5DLZA 5EU1A 5HELA 5CUBA 5FG4A 5DYAA 4QSUA 5HJCA 4E96A 4OGIA 3O36A 4A9LA 4IR3A 5I88A 2YW5A 5A81A 4YAXA 4UIUA 4NRCA 4TU4A 5TCMA 1JM4B 3JVKA 4A9FA 5EWDA 5H1VA 3U5NA 5FE8A 5DFDA 5FE2A 5D3SA 4AKNA 3DAIA 4NR9A 2R0YA 3UV4A 4HBYA 2E7NA 3QZSA 4LC2A 4CUQA 5EISA 5II1A 4DONA 5LKUA 4Z6HA 5ENFA 3S91A 5CY9A 5FE6A 5LKTA 5EVAA 4WHUA 5LJ2A 2WP1A 4UIXA 4CFKA 5LJ0A 5EWCA 4YBTA 4BW1A 5D3LA 5DX4A 5FE5A 5EK9A 4YYJA 4OGJA 5E9KA 5A7CA 5CFWA 3O33A 5DYCA 5CGPA 5I86A 4MR4A 5JI8A 4QSQA 5HM0A 3U5JA 2OUOA 5CZGA 5E3DA 4NR6A 2F6JA 3P1CA 4NR4A 4QR5A 3UW9A 5E3GA 5LVRA 4XY9A 2D9EA 4KV4A 4QSVA 3O37A 4NQNA 5D3PA 2R0SA 4HXMA 5LVQA 3ONIA 2G4AA 4Z6IA 3MXFA 4XY8A 5IGNA 5I1QA 5TB6A 5EM3A 3UVYA 5EWHA 4C66A 5I89A 4QR3A 4NUDA 5DFBA 3DWYA 3UVDA 5A85A 5G4RA 5C85A 3P1FA 4PKLA 4A9HA 3MULA 4J3IA 3O34A 4XUAA 3LQJA 5EI4A 5CQTA 1ZS5A 3P1EA 5E9IA 5HFRA 4IOQA 4QNSA 5CQ8A 5EQ1A 1X0JA 1WUGA 4MEQA 1JSPB 5CUEA 3JVMA 2D82A 4YABA 5EPRA 4CUUA 4QSSA 4O70A 5II2A 4CUPA 2YELA 2H60A 4IR4A 4QR4A 4TZ2A 4TT2A 2YQDA 4QUUA 4J0SA 3U5KA 4A9JA 4A9MA 3SVHA 1EQFA 4IORA 5D3HA 2YEMA 4IR5A 5A5NA 3Q2EA 5EICA 5AMFA 2RNWA 5DKHA 5FE7A 5L97A 4A9IA 3G0LA 5DYUA 5CU8A 3UVWA 5I7YA 2RNYA 4NYWA 5HLSA 4CURA 4UYEA 4QZSA 5F25A 5F62A 5I80A 5E74A 5CUAA 4QSPA 3U5PA 3IU6A 3K2JA 5CQ5A 4FLPA 5CUGA 5HRXA 5FG6A 4QSWA 5E9MA 5DBMA 4LDFA 2YYNA 4UYFB 4NR5A 3QZVA 5HQ5A 3NXBA 3UV2A 4QYDA 5FE1A 5F5ZA 5LUUA 5EP7A 4O77A 2MJVB 4LR6A 5E0RA 5DW1A 2I7KA 4YBSA 4XUBA 3MQMA 2OO1A 5K29A 2WP2A 5KO4A 4HXLA 5H1UA 4IR6A 2L5EA 2YEKA 4J1PA 4N3WA 4O7FA 4ZQLA 4X2IA 5KTUA 5HRWA 4YK0A 2RNXA 5LKZA 5IGLA 5AD3A 4CL9A 4YYNA 5ENEA 4YY4A 5DKDA 5A5PA 4LYIA 3HMHA 5IIDA 5A5QA 2R10A 4UIWA 5ETDA 2DVSA 3LJWA 3TLPA 4TTEA 5HENA 5H1TA 5ENJA 5EGUA 4A9EA 4PTBA 3RCWA 5DYXA 4BW4A 4ALGA 4YYMA 4F3IA 4QB3A 5JWMA 4QEWA 5HEMA 3UVXA 4QUTA 1F68A 4HXOA 5HRVA 4CUSA 2YDWA 4C67A 4WHWA 4BW3A 5D26A 1WUMA 4O76A 4LYSA 5BT4A 5DW2A 5L8UA 4NYVA 2DATA 5KHMA 5E73A 5FFVA 5FE4A 5CUDA 3LQHA 5F1HA 3I3JA 2E7OA 5EWVA 4PS5A 4N4FA 4O78A 3MB4A 4HBWA 5EWWA 5D0CA 4UYHA 3U5OA 4MEOA 5IBNA 4YYIA 5KTXA 2L85A 3IU5A 4PCEA 2DVQA 5CPEA 5FBXA 5DLXA 5F1LA 5ENIA 4Y03A 5ENBA 5L99A 5C89A 5F61A 4LZ2A 5E9VA 4YATA 3ZYUA 2FSAA 3U5MA 5L98A 4YY6A 5HCLA 5ACYA 2RFJA 4XYAA 5ENGA 5ENHA 5HFQA 2F6NA 3U5LA 4OUFA 5D25A 5BT5A 5CQAA 4O7BA 4O72A 5CRMA 4YC9A 5C4QA 4YYGA 3SVGA 4YYKA 2RS9B 4MEPA 3AADA 2RO1A 4YH4A 4YADA 4CUTA 4MR6A 5D3TA 4UITA 4QY4A 4Z1SA 5DKCA 4Z1QA 5A83A 4N4IA 4QC1A 2RI7A 4PY6A 3SVFA 4LZSA 4BJXA 4HXNA 4TS8A 5FDZA 4N4HA 5FE3A 4YBMA 4O7CA 4NQMA 5FB1A 4UYFA 5FG5A 5LJ1A 5E9LA 4NUCA 3LXJA 5CQ3A 4YH3A 4YYDA 5I40A 5KU3A 4NR8A 4WIVA 4NR7A 5D24A 4MR5A 4TZ8A 5IGMA 5CQ4A 5FFWA 5LKXA 2DVVA 4HXPA 5DFCA 4NYXA 4HXRA 2LSPB 4PCIA 4QBMA 4CLBA 5EPBA 5CS8A 5AD2A 5HQ7A 2GRCA 5D7XA 5F63A 5FE0A 4TYLA 4QSTA 4QC3A 3MB3A 3LQIA 5E7DA 5CTLA 4Q0NA 5FB0A 4TU6A 5EV9A 5A5RA 2DKWA 5A5OA 5ENCA 4A9OA 3D7CA 5A5SA 4O74A 5FH8A 5FH6A 3Q2FA 5F36A 5FE9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O75 A;  5A82 A;  5EA1 A;  4QYL A;  4UIZ A;  3HMF A;  2NXB A;  4O7E A;  4KV1 A;  3P5O A;  4UYG A;  5HQ6 A;  4LYW A;  4QSR A;  4Z93 A;  2R0V A;  4KCX A;  4LZR A;  4NRA A;  3P1D A;  2OSS A;  5DY7 A;  3FKM X;  5CQ6 A;  5FFY A;  4A9K A;  5F3A A;  4O71 A;  4ALH A;  5H85 A;  4MR3 A;  5L8T A;  4O7A A;  4UIY A;  4LRG A;  3JVL A;  5EPS A;  4QEV A;  5KTW A;  5F60 A;  3S92 A;  4GPJ A;  2L84 A;  5CUC A;  4TQN A;  4UYD A;  2DVR A;  5FH7 A;  5CRZ A;  4J0R A;  5I83 A;  4QSX A;  4NS5 A;  5IG6 A;  5E9Y A;  3GG3 A;  5I29 A;  4N4G A;  5D3J A;  4BW2 A;  3QZT A;  4HXS A;  4ZC9 A;  5C7N A;  3O35 A;  4MEN A;  4CFL A;  4HXK A;  5C87 A;  5D3N A;  2KTB B;  4NRB A;  4ZW1 A;  4HBV A;  5CP5 A;  5C8G A;  3HME A;  3JVJ A;  5D3R A;  5L96 A;  5IGK A;  3G0J A;  5BT3 A;  5F2P A;  4BHW A;  4IOO A;  2I8N A;  4YYH A;  4RVR A;  4NXJ A;  4QEU A;  4HBX A;  5G4S A;  2N9G A;  4UIV A;  4Q0O A;  1N72 A;  4TT6 A;  3UV5 A;  5I7X A;  4A9N A;  3AQA A;  5AME A;  5J0D A;  3MUK A;  2E3K A;  5COI A;  4TT4 A;  5ETB A;  2DWW A;  4NUE A;  5CQ7 A;  1E6I A;  5DLZ A;  5EU1 A;  5HEL A;  5CUB A;  5FG4 A;  5DYA A;  4QSU A;  5HJC A;  4E96 A;  4OGI A;  3O36 A;  4A9L A;  4IR3 A;  5I88 A;  2YW5 A;  5A81 A;  4YAX A;  4UIU A;  4NRC A;  4TU4 A;  5TCM A;  1JM4 B;  3JVK A;  4A9F A;  5EWD A;  5H1V A;  3U5N A;  5FE8 A;  5DFD A;  5FE2 A;  5D3S A;  4AKN A;  3DAI A;  4NR9 A;  2R0Y A;  3UV4 A;  4HBY A;  2E7N A;  3QZS A;  4LC2 A;  4CUQ A;  5EIS A;  5II1 A;  4DON A;  5LKU A;  4Z6H A;  5ENF A;  3S91 A;  5CY9 A;  5FE6 A;  5LKT A;  5EVA A;  4WHU A;  5LJ2 A;  2WP1 A;  4UIX A;  4CFK A;  5LJ0 A;  5EWC A;  4YBT A;  4BW1 A;  5D3L A;  5DX4 A;  5FE5 A;  5EK9 A;  4YYJ A;  4OGJ A;  5E9K A;  5A7C A;  5CFW A;  3O33 A;  5DYC A;  5CGP A;  5I86 A;  4MR4 A;  5JI8 A;  4QSQ A;  5HM0 A;  3U5J A;  2OUO A;  5CZG A;  5E3D A;  4NR6 A;  2F6J A;  3P1C A;  4NR4 A;  4QR5 A;  3UW9 A;  5E3G A;  5LVR A;  4XY9 A;  2D9E A;  4KV4 A;  4QSV A;  3O37 A;  4NQN A;  5D3P A;  2R0S A;  4HXM A;  5LVQ A;  3ONI A;  2G4A A;  4Z6I A;  3MXF A;  4XY8 A;  5IGN A;  5I1Q A;  5TB6 A;  5EM3 A;  3UVY A;  5EWH A;  4C66 A;  5I89 A;  4QR3 A;  4NUD A;  5DFB A;  3DWY A;  3UVD A;  5A85 A;  5G4R A;  5C85 A;  3P1F A;  4PKL A;  4A9H A;  3MUL A;  4J3I A;  3O34 A;  4XUA A;  3LQJ A;  5EI4 A;  5CQT A;  1ZS5 A;  3P1E A;  5E9I A;  5HFR A;  4IOQ A;  4QNS A;  5CQ8 A;  5EQ1 A;  1X0J A;  1WUG A;  4MEQ A;  1JSP B;  5CUE A;  3JVM A;  2D82 A;  4YAB A;  5EPR A;  4CUU A;  4QSS A;  4O70 A;  5II2 A;  4CUP A;  2YEL A;  2H60 A;  4IR4 A;  4QR4 A;  4TZ2 A;  4TT2 A;  2YQD A;  4QUU A;  4J0S A;  3U5K A;  4A9J A;  4A9M A;  3SVH A;  1EQF A;  4IOR A;  5D3H A;  2YEM A;  4IR5 A;  5A5N A;  3Q2E A;  5EIC A;  5AMF A;  2RNW A;  5DKH A;  5FE7 A;  5L97 A;  4A9I A;  3G0L A;  5DYU A;  5CU8 A;  3UVW A;  5I7Y A;  2RNY A;  4NYW A;  5HLS A;  4CUR A;  4UYE A;  4QZS A;  5F25 A;  5F62 A;  5I80 A;  5E74 A;  5CUA A;  4QSP A;  3U5P A;  3IU6 A;  3K2J A;  5CQ5 A;  4FLP A;  5CUG A;  5HRX A;  5FG6 A;  4QSW A;  5E9M A;  5DBM A;  4LDF A;  2YYN A;  4UYF B;  4NR5 A;  3QZV A;  5HQ5 A;  3NXB A;  3UV2 A;  4QYD A;  5FE1 A;  5F5Z A;  5LUU A;  5EP7 A;  4O77 A;  2MJV B;  4LR6 A;  5E0R A;  5DW1 A;  2I7K A;  4YBS A;  4XUB A;  3MQM A;  2OO1 A;  5K29 A;  2WP2 A;  5KO4 A;  4HXL A;  5H1U A;  4IR6 A;  2L5E A;  2YEK A;  4J1P A;  4N3W A;  4O7F A;  4ZQL A;  4X2I A;  5KTU A;  5HRW A;  4YK0 A;  2RNX A;  5LKZ A;  5IGL A;  5AD3 A;  4CL9 A;  4YYN A;  5ENE A;  4YY4 A;  5DKD A;  5A5P A;  4LYI A;  3HMH A;  5IID A;  5A5Q A;  2R10 A;  4UIW A;  5ETD A;  2DVS A;  3LJW A;  3TLP A;  4TTE A;  5HEN A;  5H1T A;  5ENJ A;  5EGU A;  4A9E A;  4PTB A;  3RCW A;  5DYX A;  4BW4 A;  4ALG A;  4YYM A;  4F3I A;  4QB3 A;  5JWM A;  4QEW A;  5HEM A;  3UVX A;  4QUT A;  1F68 A;  4HXO A;  5HRV A;  4CUS A;  2YDW A;  4C67 A;  4WHW A;  4BW3 A;  5D26 A;  1WUM A;  4O76 A;  4LYS A;  5BT4 A;  5DW2 A;  5L8U A;  4NYV A;  2DAT A;  5KHM A;  5E73 A;  5FFV A;  5FE4 A;  5CUD A;  3LQH A;  5F1H A;  3I3J A;  2E7O A;  5EWV A;  4PS5 A;  4N4F A;  4O78 A;  3MB4 A;  4HBW A;  5EWW A;  5D0C A;  4UYH A;  3U5O A;  4MEO A;  5IBN A;  4YYI A;  5KTX A;  2L85 A;  3IU5 A;  4PCE A;  2DVQ A;  5CPE A;  5FBX A;  5DLX A;  5F1L A;  5ENI A;  4Y03 A;  5ENB A;  5L99 A;  5C89 A;  5F61 A;  4LZ2 A;  5E9V A;  4YAT A;  3ZYU A;  2FSA A;  3U5M A;  5L98 A;  4YY6 A;  5HCL A;  5ACY A;  2RFJ A;  4XYA A;  5ENG A;  5ENH A;  5HFQ A;  2F6N A;  3U5L A;  4OUF A;  5D25 A;  5BT5 A;  5CQA A;  4O7B A;  4O72 A;  5CRM A;  4YC9 A;  5C4Q A;  4YYG A;  3SVG A;  4YYK A;  2RS9 B;  4MEP A;  3AAD A;  2RO1 A;  4YH4 A;  4YAD A;  4CUT A;  4MR6 A;  5D3T A;  4UIT A;  4QY4 A;  4Z1S A;  5DKC A;  4Z1Q A;  5A83 A;  4N4I A;  4QC1 A;  2RI7 A;  4PY6 A;  3SVF A;  4LZS A;  4BJX A;  4HXN A;  4TS8 A;  5FDZ A;  4N4H A;  5FE3 A;  4YBM A;  4O7C A;  4NQM A;  5FB1 A;  4UYF A;  5FG5 A;  5LJ1 A;  5E9L A;  4NUC A;  3LXJ A;  5CQ3 A;  4YH3 A;  4YYD A;  5I40 A;  5KU3 A;  4NR8 A;  4WIV A;  4NR7 A;  5D24 A;  4MR5 A;  4TZ8 A;  5IGM A;  5CQ4 A;  5FFW A;  5LKX A;  2DVV A;  4HXP A;  5DFC A;  4NYX A;  4HXR A;  2LSP B;  4PCI A;  4QBM A;  4CLB A;  5EPB A;  5CS8 A;  5AD2 A;  5HQ7 A;  2GRC A;  5D7X A;  5F63 A;  5FE0 A;  4TYL A;  4QST A;  4QC3 A;  3MB3 A;  3LQI A;  5E7D A;  5CTL A;  4Q0N A;  5FB0 A;  4TU6 A;  5EV9 A;  5A5R A;  2DKW A;  5A5O A;  5ENC A;  4A9O A;  3D7C A;  5A5S A;  4O74 A;  5FH8 A;  5FH6 A;  3Q2F A;  5F36 A;  5FE9 A; 
#chains in the Genus database with same CATH topology
 4O75 A;  5A82 A;  5EA1 A;  4QYL A;  4UIZ A;  3HMF A;  2NXB A;  4O7E A;  4KV1 A;  3P5O A;  4UYG A;  5HQ6 A;  4LYW A;  4QSR A;  4Z93 A;  2R0V A;  4KCX A;  4LZR A;  4NRA A;  3P1D A;  2OSS A;  5DY7 A;  3FKM X;  5CQ6 A;  5FFY A;  4A9K A;  5F3A A;  4O71 A;  4ALH A;  5H85 A;  4MR3 A;  5L8T A;  4O7A A;  4UIY A;  4LRG A;  3JVL A;  5EPS A;  4QEV A;  5KTW A;  4AKG A;  3VKH A;  5F60 A;  3S92 A;  4GPJ A;  2L84 A;  5CUC A;  4TQN A;  4UYD A;  2DVR A;  5FH7 A;  5CRZ A;  4J0R A;  5I83 A;  4QSX A;  4NS5 A;  5IG6 A;  5E9Y A;  3GG3 A;  5I29 A;  4N4G A;  5D3J A;  4BW2 A;  3QZT A;  4HXS A;  4ZC9 A;  5C7N A;  3O35 A;  4MEN A;  4CFL A;  4HXK A;  5C87 A;  5D3N A;  2KTB B;  4NRB A;  4ZW1 A;  4HBV A;  5CP5 A;  5C8G A;  3HME A;  3JVJ A;  5D3R A;  5L96 A;  5IGK A;  3G0J A;  5BT3 A;  5F2P A;  4BHW A;  4IOO A;  2I8N A;  4YYH A;  4RVR A;  4NXJ A;  4QEU A;  4HBX A;  5G4S A;  2N9G A;  4UIV A;  4Q0O A;  1N72 A;  4TT6 A;  3UV5 A;  5I7X A;  4A9N A;  3AQA A;  5AME A;  5J0D A;  2EJN A;  3MUK A;  2E3K A;  5COI A;  4TT4 A;  5ETB A;  2DWW A;  4NUE A;  5CQ7 A;  1E6I A;  5DLZ A;  5EU1 A;  5HEL A;  5CUB A;  5FG4 A;  5DYA A;  4QSU A;  5HJC A;  4E96 A;  4OGI A;  3O36 A;  4A9L A;  4IR3 A;  5I88 A;  2YW5 A;  5A81 A;  4YAX A;  4UIU A;  4NRC A;  4TU4 A;  5TCM A;  1JM4 B;  3JVK A;  4A9F A;  5EWD A;  5H1V A;  3U5N A;  5FE8 A;  5DFD A;  5FE2 A;  5D3S A;  4AKN A;  3DAI A;  4NR9 A;  2R0Y A;  3UV4 A;  4HBY A;  2E7N A;  3QZS A;  4LC2 A;  4CUQ A;  5EIS A;  5II1 A;  4DON A;  5LKU A;  4Z6H A;  5ENF A;  3S91 A;  5CY9 A;  5FE6 A;  5LKT A;  5EVA A;  4WHU A;  5LJ2 A;  2WP1 A;  4UIX A;  4CFK A;  5LJ0 A;  5EWC A;  4YBT A;  4BW1 A;  5D3L A;  4AKH A;  5DX4 A;  5FE5 A;  5EK9 A;  4YYJ A;  4OGJ A;  5E9K A;  5A7C A;  5CFW A;  3O33 A;  5DYC A;  5CGP A;  5I86 A;  4MR4 A;  5JI8 A;  4QSQ A;  5HM0 A;  3U5J A;  2OUO A;  5CZG A;  5E3D A;  4NR6 A;  2F6J A;  3P1C A;  4NR4 A;  4QR5 A;  3UW9 A;  5E3G A;  5LVR A;  4XY9 A;  2D9E A;  4KV4 A;  4QSV A;  3O37 A;  4NQN A;  5D3P A;  2R0S A;  4HXM A;  5LVQ A;  3ONI A;  2G4A A;  4Z6I A;  3MXF A;  4XY8 A;  5IGN A;  5I1Q A;  5TB6 A;  5EM3 A;  3UVY A;  5EWH A;  1ZKR A;  5I89 A;  3ERR A;  4NUD A;  4QR3 A;  3DWY A;  5DFB A;  3UVD A;  5A85 A;  5G4R A;  5C85 A;  3P1F A;  4PKL A;  4A9H A;  3MUL A;  4J3I A;  3O34 A;  4XUA A;  3LQJ A;  5EI4 A;  5CQT A;  1ZS5 A;  3P1E A;  5E9I A;  5HFR A;  4IOQ A;  4QNS A;  5CQ8 A;  5EQ1 A;  1X0J A;  1WUG A;  4MEQ A;  1JSP B;  5CUE A;  3JVM A;  2D82 A;  4YAB A;  5EPR A;  4CUU A;  4QSS A;  4O70 A;  5II2 A;  4CUP A;  2YEL A;  2H60 A;  4IR4 A;  4QR4 A;  4TZ2 A;  4AKI A;  4TT2 A;  2YQD A;  4QUU A;  4J0S A;  3U5K A;  4A9J A;  4A9M A;  3SVH A;  1EQF A;  4IOR A;  5D3H A;  2YEM A;  4IR5 A;  5A5N A;  3Q2E A;  5EIC A;  5AMF A;  2RNW A;  5DKH A;  5FE7 A;  5L97 A;  4A9I A;  3G0L A;  5DYU A;  5CU8 A;  3UVW A;  5I7Y A;  2RNY A;  4NYW A;  5HLS A;  4CUR A;  4UYE A;  4QZS A;  5F25 A;  5F62 A;  1PUO A;  5I80 A;  5E74 A;  3D1D A;  5CUA A;  4QSP A;  3U5P A;  3IU6 A;  3K2J A;  4C66 A;  5CQ5 A;  4FLP A;  5CUG A;  5HRX A;  5FG6 A;  4QSW A;  5E9M A;  5DBM A;  4LDF A;  2YYN A;  4UYF B;  4NR5 A;  3D1B A;  3QZV A;  5HQ5 A;  3NXB A;  3UV2 A;  4QYD A;  5FE1 A;  5F5Z A;  5LUU A;  5EP7 A;  4O77 A;  2MJV B;  4LR6 A;  5E0R A;  5DW1 A;  2I7K A;  4YBS A;  4XUB A;  3MQM A;  2OO1 A;  5K29 A;  2WP2 A;  5KO4 A;  4HXL A;  5H1U A;  4IR6 A;  2L5E A;  2YEK A;  4J1P A;  4N3W A;  4O7F A;  4ZQL A;  4X2I A;  5KTU A;  5HRW A;  4YK0 A;  2RNX A;  5LKZ A;  5IGL A;  5AD3 A;  4CL9 A;  4YYN A;  5ENE A;  4YY4 A;  5DKD A;  5A5P A;  4LYI A;  3HMH A;  5IID A;  5A5Q A;  2R10 A;  4UIW A;  5ETD A;  2DVS A;  3LJW A;  3TLP A;  4TTE A;  5HEN A;  5H1T A;  5ENJ A;  5EGU A;  4A9E A;  4PTB A;  3RCW A;  5DYX A;  4BW4 A;  4ALG A;  4YYM A;  4F3I A;  4QB3 A;  5JWM A;  4QEW A;  5HEM A;  3UVX A;  4QUT A;  1F68 A;  4HXO A;  5HRV A;  4CUS A;  2YDW A;  4C67 A;  4WHW A;  4BW3 A;  5D26 A;  1WUM A;  4O76 A;  4LYS A;  5BT4 A;  5DW2 A;  5L8U A;  4NYV A;  2DAT A;  5KHM A;  5E73 A;  5FFV A;  5FE4 A;  5CUD A;  3LQH A;  5F1H A;  3I3J A;  2E7O A;  5EWV A;  4PS5 A;  4N4F A;  4O78 A;  3MB4 A;  4HBW A;  5EWW A;  5D0C A;  4UYH A;  3U5O A;  4MEO A;  5IBN A;  4YYI A;  5KTX A;  2L85 A;  3IU5 A;  4PCE A;  2DVQ A;  5CPE A;  5FBX A;  5DLX A;  5F1L A;  5ENI A;  4Y03 A;  5ENB A;  5L99 A;  5C89 A;  5F61 A;  4LZ2 A;  5E9V A;  4YAT A;  3ZYU A;  2FSA A;  3U5M A;  5L98 A;  4YY6 A;  5HCL A;  5ACY A;  2RFJ A;  4XYA A;  5ENG A;  5ENH A;  5HFQ A;  2F6N A;  3U5L A;  4OUF A;  5D25 A;  5BT5 A;  5CQA A;  4O7B A;  4O72 A;  5CRM A;  4YC9 A;  5C4Q A;  4YYG A;  3SVG A;  4YYK A;  2RS9 B;  4MEP A;  3AAD A;  2RO1 A;  4YH4 A;  4YAD A;  4CUT A;  4MR6 A;  5D3T A;  4UIT A;  4QY4 A;  4Z1S A;  5DKC A;  4Z1Q A;  3VKG A;  5A83 A;  4N4I A;  4QC1 A;  2RI7 A;  4PY6 A;  3SVF A;  4LZS A;  4BJX A;  4HXN A;  4TS8 A;  5FDZ A;  4N4H A;  5FE3 A;  4YBM A;  4O7C A;  4NQM A;  5FB1 A;  4UYF A;  5FG5 A;  5LJ1 A;  5E9L A;  4NUC A;  3LXJ A;  5CQ3 A;  4YH3 A;  4YYD A;  5I40 A;  5KU3 A;  4NR8 A;  4WIV A;  4NR7 A;  5D24 A;  4MR5 A;  4TZ8 A;  5IGM A;  5CQ4 A;  5FFW A;  5LKX A;  2DVV A;  4HXP A;  4NYX A;  5DFC A;  4HXR A;  2LSP B;  4PCI A;  4QBM A;  4CLB A;  5EPB A;  5CS8 A;  5AD2 A;  5HQ7 A;  2GRC A;  5D7X A;  5F63 A;  5FE0 A;  4TYL A;  4QST A;  4QC3 A;  3MB3 A;  3LQI A;  5E7D A;  5CTL A;  4Q0N A;  5FB0 A;  4TU6 A;  5EV9 A;  5A5R A;  2DKW A;  5A5O A;  5ENC A;  4A9O A;  3D7C A;  5A5S A;  4O74 A;  5FH8 A;  5FH6 A;  4AI6 A;  3Q2F A;  5F36 A;  5FE9 A; 
#chains in the Genus database with same CATH homology
 4O75 A;  5A82 A;  5EA1 A;  4QYL A;  4UIZ A;  3HMF A;  2NXB A;  4O7E A;  4KV1 A;  3P5O A;  4UYG A;  5HQ6 A;  4LYW A;  4QSR A;  4Z93 A;  2R0V A;  4KCX A;  4LZR A;  4NRA A;  3P1D A;  2OSS A;  5DY7 A;  3FKM X;  5CQ6 A;  5FFY A;  4A9K A;  5F3A A;  4O71 A;  4ALH A;  5H85 A;  4MR3 A;  5L8T A;  4O7A A;  4UIY A;  4LRG A;  3JVL A;  5EPS A;  4QEV A;  5KTW A;  5F60 A;  3S92 A;  4GPJ A;  2L84 A;  5CUC A;  4TQN A;  4UYD A;  2DVR A;  5FH7 A;  5CRZ A;  4J0R A;  5I83 A;  4QSX A;  4NS5 A;  5IG6 A;  5E9Y A;  3GG3 A;  5I29 A;  4N4G A;  5D3J A;  4BW2 A;  3QZT A;  4HXS A;  4ZC9 A;  5C7N A;  3O35 A;  4MEN A;  4CFL A;  4HXK A;  5C87 A;  5D3N A;  2KTB B;  4NRB A;  4ZW1 A;  4HBV A;  5CP5 A;  5C8G A;  3HME A;  3JVJ A;  5D3R A;  5L96 A;  5IGK A;  3G0J A;  5BT3 A;  5F2P A;  4BHW A;  4IOO A;  2I8N A;  4YYH A;  4RVR A;  4NXJ A;  4QEU A;  4HBX A;  5G4S A;  2N9G A;  4UIV A;  4Q0O A;  1N72 A;  4TT6 A;  3UV5 A;  5I7X A;  4A9N A;  3AQA A;  5AME A;  5J0D A;  3MUK A;  2E3K A;  5COI A;  4TT4 A;  5ETB A;  2DWW A;  4NUE A;  5CQ7 A;  1E6I A;  5DLZ A;  5EU1 A;  5HEL A;  5CUB A;  5FG4 A;  5DYA A;  4QSU A;  5HJC A;  4E96 A;  4OGI A;  3O36 A;  4A9L A;  4IR3 A;  5I88 A;  2YW5 A;  5A81 A;  4YAX A;  4UIU A;  4NRC A;  4TU4 A;  5TCM A;  1JM4 B;  3JVK A;  4A9F A;  5EWD A;  5H1V A;  3U5N A;  5FE8 A;  5DFD A;  5FE2 A;  5D3S A;  4AKN A;  3DAI A;  4NR9 A;  2R0Y A;  3UV4 A;  4HBY A;  2E7N A;  3QZS A;  4LC2 A;  4CUQ A;  5EIS A;  5II1 A;  4DON A;  5LKU A;  4Z6H A;  5ENF A;  3S91 A;  5CY9 A;  5FE6 A;  5LKT A;  5EVA A;  4WHU A;  5LJ2 A;  2WP1 A;  4UIX A;  4CFK A;  5LJ0 A;  5EWC A;  4YBT A;  4BW1 A;  5D3L A;  5DX4 A;  5FE5 A;  5EK9 A;  4YYJ A;  4OGJ A;  5E9K A;  5A7C A;  5CFW A;  3O33 A;  5DYC A;  5CGP A;  5I86 A;  4MR4 A;  5JI8 A;  4QSQ A;  5HM0 A;  3U5J A;  2OUO A;  5CZG A;  5E3D A;  4NR6 A;  2F6J A;  3P1C A;  4NR4 A;  4QR5 A;  3UW9 A;  5E3G A;  5LVR A;  4XY9 A;  2D9E A;  4KV4 A;  4QSV A;  3O37 A;  4NQN A;  5D3P A;  2R0S A;  4HXM A;  5LVQ A;  3ONI A;  2G4A A;  4Z6I A;  3MXF A;  4XY8 A;  5IGN A;  5I1Q A;  5TB6 A;  5EM3 A;  3UVY A;  5EWH A;  4C66 A;  5I89 A;  4QR3 A;  4NUD A;  5DFB A;  3DWY A;  3UVD A;  5A85 A;  5G4R A;  5C85 A;  3P1F A;  4PKL A;  4A9H A;  3MUL A;  4J3I A;  3O34 A;  4XUA A;  3LQJ A;  5EI4 A;  5CQT A;  1ZS5 A;  3P1E A;  5E9I A;  5HFR A;  4IOQ A;  4QNS A;  5CQ8 A;  5EQ1 A;  1X0J A;  1WUG A;  4MEQ A;  1JSP B;  5CUE A;  3JVM A;  2D82 A;  4YAB A;  5EPR A;  4CUU A;  4QSS A;  4O70 A;  5II2 A;  4CUP A;  2YEL A;  2H60 A;  4IR4 A;  4QR4 A;  4TZ2 A;  4TT2 A;  2YQD A;  4QUU A;  4J0S A;  3U5K A;  4A9J A;  4A9M A;  3SVH A;  1EQF A;  4IOR A;  5D3H A;  2YEM A;  4IR5 A;  5A5N A;  3Q2E A;  5EIC A;  5AMF A;  2RNW A;  5DKH A;  5FE7 A;  5L97 A;  4A9I A;  3G0L A;  5DYU A;  5CU8 A;  3UVW A;  5I7Y A;  2RNY A;  4NYW A;  5HLS A;  4CUR A;  4UYE A;  4QZS A;  5F25 A;  5F62 A;  5I80 A;  5E74 A;  5CUA A;  4QSP A;  3U5P A;  3IU6 A;  3K2J A;  5CQ5 A;  4FLP A;  5CUG A;  5HRX A;  5FG6 A;  4QSW A;  5E9M A;  5DBM A;  4LDF A;  2YYN A;  4UYF B;  4NR5 A;  3QZV A;  5HQ5 A;  3NXB A;  3UV2 A;  4QYD A;  5FE1 A;  5F5Z A;  5LUU A;  5EP7 A;  4O77 A;  2MJV B;  4LR6 A;  5E0R A;  5DW1 A;  2I7K A;  4YBS A;  4XUB A;  3MQM A;  2OO1 A;  5K29 A;  2WP2 A;  5KO4 A;  4HXL A;  5H1U A;  4IR6 A;  2L5E A;  2YEK A;  4J1P A;  4N3W A;  4O7F A;  4ZQL A;  4X2I A;  5KTU A;  5HRW A;  4YK0 A;  2RNX A;  5LKZ A;  5IGL A;  5AD3 A;  4CL9 A;  4YYN A;  5ENE A;  4YY4 A;  5DKD A;  5A5P A;  4LYI A;  3HMH A;  5IID A;  5A5Q A;  2R10 A;  4UIW A;  5ETD A;  2DVS A;  3LJW A;  3TLP A;  4TTE A;  5HEN A;  5H1T A;  5ENJ A;  5EGU A;  4A9E A;  4PTB A;  3RCW A;  5DYX A;  4BW4 A;  4ALG A;  4YYM A;  4F3I A;  4QB3 A;  5JWM A;  4QEW A;  5HEM A;  3UVX A;  4QUT A;  1F68 A;  4HXO A;  5HRV A;  4CUS A;  2YDW A;  4C67 A;  4WHW A;  4BW3 A;  5D26 A;  1WUM A;  4O76 A;  4LYS A;  5BT4 A;  5DW2 A;  5L8U A;  4NYV A;  2DAT A;  5KHM A;  5E73 A;  5FFV A;  5FE4 A;  5CUD A;  3LQH A;  5F1H A;  3I3J A;  2E7O A;  5EWV A;  4PS5 A;  4N4F A;  4O78 A;  3MB4 A;  4HBW A;  5EWW A;  5D0C A;  4UYH A;  3U5O A;  4MEO A;  5IBN A;  4YYI A;  5KTX A;  2L85 A;  3IU5 A;  4PCE A;  2DVQ A;  5CPE A;  5FBX A;  5DLX A;  5F1L A;  5ENI A;  4Y03 A;  5ENB A;  5L99 A;  5C89 A;  5F61 A;  4LZ2 A;  5E9V A;  4YAT A;  3ZYU A;  2FSA A;  3U5M A;  5L98 A;  4YY6 A;  5HCL A;  5ACY A;  2RFJ A;  4XYA A;  5ENG A;  5ENH A;  5HFQ A;  2F6N A;  3U5L A;  4OUF A;  5D25 A;  5BT5 A;  5CQA A;  4O7B A;  4O72 A;  5CRM A;  4YC9 A;  5C4Q A;  4YYG A;  3SVG A;  4YYK A;  2RS9 B;  4MEP A;  3AAD A;  2RO1 A;  4YH4 A;  4YAD A;  4CUT A;  4MR6 A;  5D3T A;  4UIT A;  4QY4 A;  4Z1S A;  5DKC A;  4Z1Q A;  5A83 A;  4N4I A;  4QC1 A;  2RI7 A;  4PY6 A;  3SVF A;  4LZS A;  4BJX A;  4HXN A;  4TS8 A;  5FDZ A;  4N4H A;  5FE3 A;  4YBM A;  4O7C A;  4NQM A;  5FB1 A;  4UYF A;  5FG5 A;  5LJ1 A;  5E9L A;  4NUC A;  3LXJ A;  5CQ3 A;  4YH3 A;  4YYD A;  5I40 A;  5KU3 A;  4NR8 A;  4WIV A;  4NR7 A;  5D24 A;  4MR5 A;  4TZ8 A;  5IGM A;  5CQ4 A;  5FFW A;  5LKX A;  2DVV A;  4HXP A;  5DFC A;  4NYX A;  4HXR A;  2LSP B;  4PCI A;  4QBM A;  4CLB A;  5EPB A;  5CS8 A;  5AD2 A;  5HQ7 A;  2GRC A;  5D7X A;  5F63 A;  5FE0 A;  4TYL A;  4QST A;  4QC3 A;  3MB3 A;  3LQI A;  5E7D A;  5CTL A;  4Q0N A;  5FB0 A;  4TU6 A;  5EV9 A;  5A5R A;  2DKW A;  5A5O A;  5ENC A;  4A9O A;  3D7C A;  5A5S A;  4O74 A;  5FH8 A;  5FH6 A;  3Q2F A;  5F36 A;  5FE9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...