4NYVA

Crystal structure of the bromodomain of human crebbp in complex with a quinazolin-one ligand
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
116
structure length
116
Chain Sequence
RKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CREB-binding protein
publication title Crystal Structure of the Bromodomain of human CREBBP in complex with a quinazolin-one ligand
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 42
structure length 116
sequence length 116
chains with identical sequence B, C, D
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2013-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4nyvA00
3UVYA 5C85A 4CURA 4UIZA 5F61A 4YY4A 5CRZA 1ZS5A 5CUAA 5EP7A 4NUEA 4XUAA 4HXKA 4PKLA 5IGMA 5K29A 3D7CA 2YEMA 3AQAA 4IR4A 5I1QA 5LKZA 4XYAA 5D3RA 5CUCA 4KV1A 4KV4A 5FE4A 4O75A 4QSRA 5E3GA 3GG3A 4UYHA 4QC3A 5I88A 4Z6HA 5CUBA 5BT3A 5A81A 5LJ0A 4TS8A 4HBYA 5E7DA 5L98A 3RCWA 3S91A 3S92A 1WUGA 4QYLA 1E6IA 4HXOA 4LR6A 4PS5A 5FFWA 5LVRA 5EISA 4YYNA 5HEMA 5I80A 3Q2FA 4YADA 5F63A 4C66A 3UVWA 5CFWA 4YATA 4HXRA 5LKXA 4XUBA 4C67A 4YK0A 5D26A 5A5RA 4NRCA 5D0CA 2DKWA 2GRCA 4MR6A 4GPJA 4N4FA 4YABA 4NRAA 4NR5A 3U5LA 3O36A 4LYWA 3O37A 2RNXA 4PCIA 4XY8A 2N9GA 4BW4A 5ENJA 4CFLA 5D7XA 2L84A 4Q0NA 4TT6A 5FH6A 5CQ3A 4N4GA 1JSPB 5I83A 4UIYA 5TB6A 4NYWA 3QZVA 4CUTA 2LSPB 4LZSA 5E9IA 5DKCA 5KTUA 4TZ2A 4TU4A 3P5OA 5EQ1A 5A83A 2R0SA 3LQJA 4CLBA 4CUQA 5KTWA 5EK9A 2RS9B 4QEVA 4YYHA 4UIUA 4LYSA 5F25A 2DVRA 3FKMX 4QYDA 5AMEA 2DVVA 5G4SA 3MB4A 4BJXA 5F2PA 4A9KA 5D3HA 3U5PA 4LC2A 5D3PA 3UV4A 4QEWA 2RNYA 5E9MA 5CQ7A 5F60A 3I3JA 3SVHA 5DYCA 5I29A 2YELA 5HLSA 5F1HA 4TU6A 5CZGA 4QSSA 4MEOA 5DLXA 5DW2A 5FG5A 5FE0A 4LRGA 5HQ5A 1EQFA 5FG4A 5HRVA 3HMEA 5CGPA 2E7NA 5HCLA 4YY6A 4O78A 5E0RA 4HXSA 5EPBA 4A9NA 4WHUA 4MR4A 4X2IA 2RFJA 4O7EA 4A9EA 5FFYA 4ZW1A 3O33A 4YH4A 5A5NA 4YYMA 4QZSA 3U5MA 4LYIA 2F6NA 5IBNA 4TT2A 4Z93A 5CQ4A 5AD2A 4YBMA 3IU5A 2MJVB 5EWDA 5FE2A 3MB3A 3HMFA 4BHWA 3ONIA 4ALHA 5HM0A 5C89A 5LVQA 5CPEA 5CS8A 5ENGA 3G0LA 5ENEA 4J0SA 5CQAA 5JI8A 4NR7A 2WP2A 4PTBA 4AKNA 5II1A 4BW3A 5KTXA 4NR9A 5A7CA 3UW9A 4BW2A 5C87A 4Q0OA 2FSAA 4LZ2A 3QZTA 2OUOA 5F3AA 4NXJA 5II2A 4IOQA 5D3LA 5HQ6A 3AADA 2D9EA 4RVRA 4UIWA 5ACYA 5I86A 4QR3A 2D82A 4O74A 3HMHA 4QUUA 4LDFA 4NYVA 5DKDA 5DKHA 5L99A 2F6JA 3P1DA 4YYGA 5DYUA 3ZYUA 5EI4A 5DW1A 5I7XA 5BT4A 3P1FA 4Z1QA 4QUTA 4UYFB 2YEKA 5IGKA 4TT4A 3Q2EA 5HFRA 2H60A 4UYEA 5TCMA 4IOOA 5L8TA 4NYXA 5IGLA 2I8NA 3DWYA 4N4IA 4PCEA 5L96A 3TLPA 4F3IA 5EM3A 4UIVA 4O7BA 3UVXA 5A5OA 5HRWA 3QZSA 4MR5A 3U5OA 5H1UA 4ALGA 4O7FA 5FFVA 5LJ1A 2OO1A 5I89A 5D3NA 4A9HA 4Z1SA 5EGUA 5EWVA 5FE6A 3MXFA 4J3IA 2G4AA 5A5PA 2DATA 3UVDA 5D3TA 3U5KA 1F68A 4CFKA 3IU6A 1WUMA 4NUDA 5AD3A 4ZC9A 4QEUA 5CRMA 5CQTA 5ETBA 5HQ7A 5ENFA 5A5QA 4IORA 5CQ8A 5EU1A 2I7KA 5BT5A 4QSQA 5KHMA 3JVLA 4A9IA 5HJCA 3MULA 4UYDA 4A9JA 2WP1A 5CQ6A 4YYKA 3MQMA 5DFBA 5F62A 4QBMA 1X0JA 4IR6A 4A9LA 2R10A 2YQDA 2DVSA 5C4QA 4N4HA 5HFQA 4QSXA 4OGJA 2E3KA 5EICA 2YW5A 3NXBA 4YYDA 5EA1A 4O7CA 4YAXA 4CUUA 5E9LA 3U5NA 5ENCA 5EWWA 5G4RA 5H1VA 5EVAA 4A9MA 5FE7A 4IR3A 5LJ2A 4UIXA 5E3DA 5F1LA 4UYGA 4O77A 5FG6A 5JWMA 2RNWA 4NS5A 4NQNA 4TYLA 5FDZA 4TZ8A 5DX4A 2L85A 3O34A 5F5ZA 5IGNA 4YH3A 5FB1A 4QR5A 4NR4A 5COIA 3LQIA 4MEPA 4YC9A 5FB0A 3K2JA 5D24A 4LZRA 4A9OA 3DAIA 3JVJA 5CU8A 5HRXA 5FBXA 4HBWA 4KCXA 5FE3A 5H1TA 3U5JA 4QSTA 5FE1A 3UV5A 5C8GA 3UV2A 5CTLA 5DYAA 5E9YA 3MUKA 4WHWA 2L5EA 5LKTA 5D25A 5IG6A 5LUUA 4HBVA 5CQ5A 5EPSA 4FLPA 5A5SA 4O7AA 5CY9A 4J1PA 2DVQA 5C7NA 2R0VA 5LKUA 4DONA 2RO1A 4E96A 2KTBB 4IR5A 5L8UA 2E7OA 4NR6A 2YYNA 4O72A 5F36A 4YYIA 4XY9A 4MR3A 5DFDA 1JM4B 4PY6A 2YDWA 3LQHA 4HXLA 1N72A 4Y03A 4HBXA 5KU3A 4MENA 5FH8A 5CP5A 5I7YA 4NUCA 4O76A 4TQNA 2OSSA 5FE9A 2RI7A 4UYFA 5HENA 5ENIA 4J0RA 5A82A 5EWCA 3JVKA 2NXBA 4YBSA 5EV9A 4HXPA 4QB3A 5E9KA 3SVFA 3P1EA 4QR4A 4OGIA 5J0DA 5L97A 4QSVA 4MEQA 5D3JA 3O35A 5E74A 5IIDA 4QSPA 5EPRA 4YYJA 4QSWA 4WIVA 4CUPA 5DBMA 3JVMA 4CL9A 2DWWA 4HXMA 3G0JA 4TTEA 5D3SA 5AMFA 5H85A 5DLZA 5DYXA 4NR8A 3SVGA 4OUFA 5DFCA 5ENHA 4CUSA 4BW1A 5CUDA 5HELA 5DY7A 5EWHA 5FH7A 4UITA 4QNSA 4Z6IA 4YBTA 4QC1A 5E9VA 4HXNA 5CUEA 4NQMA 4A9FA 4ZQLA 5KO4A 5ETDA 5FE8A 4O71A 3P1CA 4O70A 3LJWA 5E73A 5ENBA 4QY4A 5FE5A 3LXJA 4N3WA 5A85A 4NRBA 2R0YA 5I40A 5CUGA 4QSUA
chains in the Genus database with same CATH superfamily
3UVYA 5C85A 4CURA 4UIZA 4AI6A 5F61A 4YY4A 5CRZA 1ZS5A 5CUAA 1ZKRA 5EP7A 4NUEA 4XUAA 4HXKA 4PKLA 5IGMA 2EJNA 5K29A 3D7CA 2YEMA 3AQAA 4IR4A 5I1QA 5LKZA 4XYAA 5D3RA 5CUCA 4KV1A 4KV4A 5FE4A 4O75A 4QSRA 5E3GA 3GG3A 4UYHA 4QC3A 5I88A 4Z6HA 5CUBA 5BT3A 5A81A 5LJ0A 4TS8A 4HBYA 5E7DA 5L98A 3RCWA 3S91A 3S92A 1WUGA 4QYLA 1E6IA 4HXOA 4LR6A 4PS5A 5FFWA 5LVRA 5EISA 4YYNA 5HEMA 5I80A 3Q2FA 4YADA 5F63A 4C66A 3UVWA 5CFWA 4YATA 4HXRA 5LKXA 4XUBA 4C67A 4YK0A 5D26A 5A5RA 4NRCA 5D0CA 2DKWA 2GRCA 4MR6A 4GPJA 4N4FA 4YABA 4NRAA 4NR5A 3U5LA 3O36A 4LYWA 3O37A 2RNXA 4PCIA 4XY8A 2N9GA 4BW4A 5ENJA 4CFLA 5D7XA 2L84A 4Q0NA 4TT6A 5FH6A 5CQ3A 4N4GA 1JSPB 5I83A 4UIYA 5TB6A 4NYWA 3QZVA 4CUTA 2LSPB 4LZSA 5E9IA 5DKCA 5KTUA 4TZ2A 4TU4A 3P5OA 5EQ1A 5A83A 2R0SA 3LQJA 4CLBA 4CUQA 5KTWA 5EK9A 2RS9B 4QEVA 4YYHA 4UIUA 4LYSA 5F25A 2DVRA 3FKMX 4QYDA 5AMEA 2DVVA 5G4SA 3MB4A 4BJXA 5F2PA 4A9KA 5D3HA 3U5PA 4LC2A 5D3PA 3UV4A 4QEWA 2RNYA 5E9MA 5CQ7A 5F60A 3I3JA 3SVHA 5DYCA 5I29A 2YELA 5HLSA 5F1HA 4TU6A 5CZGA 4QSSA 4MEOA 5DLXA 5DW2A 5FG5A 5FE0A 4LRGA 5HQ5A 1EQFA 5FG4A 5HRVA 3HMEA 5CGPA 2E7NA 5HCLA 4YY6A 4O78A 5E0RA 4HXSA 5EPBA 4A9NA 4WHUA 4MR4A 4X2IA 2RFJA 4O7EA 4A9EA 3D1BA 4AKIA 5FFYA 4ZW1A 3O33A 4YH4A 5A5NA 4YYMA 4QZSA 3U5MA 4LYIA 2F6NA 5IBNA 4TT2A 4Z93A 5CQ4A 5AD2A 4YBMA 2MJVB 3IU5A 5EWDA 5FE2A 3MB3A 3HMFA 4BHWA 3ONIA 4ALHA 5HM0A 5C89A 5LVQA 5CPEA 5CS8A 5ENGA 3G0LA 5ENEA 4J0SA 5CQAA 5JI8A 4NR7A 2WP2A 4PTBA 4AKNA 5II1A 4BW3A 5KTXA 4NR9A 5A7CA 3UW9A 4BW2A 5C87A 4Q0OA 2FSAA 4LZ2A 3QZTA 2OUOA 5F3AA 1PUOA 4NXJA 5II2A 4IOQA 5D3LA 5HQ6A 3AADA 2D9EA 4RVRA 4UIWA 5ACYA 5I86A 4QR3A 2D82A 4O74A 3HMHA 4QUUA 4LDFA 4NYVA 5DKDA 5DKHA 5L99A 2F6JA 3P1DA 4YYGA 5DYUA 3ZYUA 5EI4A 5DW1A 5I7XA 5BT4A 3P1FA 4Z1QA 4QUTA 4UYFB 2YEKA 5IGKA 4TT4A 3Q2EA 5HFRA 2H60A 3VKGA 4UYEA 5TCMA 4IOOA 5L8TA 4NYXA 5IGLA 2I8NA 3DWYA 4N4IA 4PCEA 5L96A 3TLPA 4F3IA 5EM3A 4UIVA 4O7BA 3UVXA 5A5OA 5HRWA 3QZSA 4MR5A 3U5OA 5H1UA 4ALGA 4O7FA 5FFVA 5LJ1A 2OO1A 5I89A 5D3NA 4A9HA 4Z1SA 5EGUA 5EWVA 5FE6A 3MXFA 4J3IA 2G4AA 5A5PA 2DATA 3UVDA 5D3TA 3U5KA 1F68A 4CFKA 3IU6A 1WUMA 4NUDA 5AD3A 4ZC9A 4QEUA 5CRMA 5CQTA 5ETBA 5HQ7A 5ENFA 5A5QA 4IORA 5CQ8A 5EU1A 2I7KA 5BT5A 4QSQA 5KHMA 4AKGA 3JVLA 4A9IA 5HJCA 3MULA 4UYDA 4A9JA 2WP1A 5CQ6A 4YYKA 3MQMA 5DFBA 5F62A 4QBMA 1X0JA 3VKHA 4IR6A 4A9LA 2R10A 2YQDA 2DVSA 5C4QA 4N4HA 5HFQA 4QSXA 4OGJA 2E3KA 5EICA 2YW5A 3NXBA 4YYDA 5EA1A 4O7CA 4YAXA 4CUUA 5E9LA 3U5NA 5ENCA 5EWWA 5G4RA 5H1VA 5EVAA 4A9MA 5FE7A 4IR3A 5LJ2A 4UIXA 5E3DA 5F1LA 4UYGA 4O77A 5FG6A 5JWMA 2RNWA 4NS5A 4NQNA 4TYLA 5FDZA 4TZ8A 5DX4A 2L85A 3O34A 5F5ZA 5IGNA 4YH3A 5FB1A 4QR5A 4NR4A 5COIA 3LQIA 4MEPA 4YC9A 5FB0A 3K2JA 5D24A 4LZRA 4A9OA 3DAIA 3JVJA 5CU8A 5HRXA 5FBXA 4HBWA 4KCXA 5FE3A 5H1TA 3U5JA 4QSTA 5FE1A 3UV5A 5C8GA 3UV2A 5CTLA 5DYAA 5E9YA 3MUKA 4WHWA 2L5EA 5LKTA 5D25A 5IG6A 5LUUA 4HBVA 5CQ5A 5EPSA 4FLPA 5A5SA 4O7AA 5CY9A 4J1PA 2DVQA 5C7NA 2R0VA 5LKUA 4DONA 2RO1A 4E96A 2KTBB 4IR5A 5L8UA 2E7OA 4NR6A 2YYNA 4O72A 5F36A 4YYIA 4XY9A 4MR3A 5DFDA 1JM4B 4PY6A 2YDWA 3LQHA 4HXLA 1N72A 4Y03A 4HBXA 5KU3A 4MENA 5FH8A 5CP5A 5I7YA 4NUCA 4O76A 4TQNA 2OSSA 5FE9A 2RI7A 3D1DA 4UYFA 5HENA 5ENIA 4J0RA 5A82A 5EWCA 3JVKA 2NXBA 4YBSA 4AKHA 5EV9A 4HXPA 4QB3A 5E9KA 3SVFA 3P1EA 4QR4A 4OGIA 5J0DA 5L97A 4QSVA 4MEQA 5D3JA 3O35A 5E74A 5IIDA 4QSPA 5EPRA 4YYJA 4QSWA 4WIVA 4CUPA 5DBMA 3JVMA 4CL9A 2DWWA 4HXMA 3G0JA 4TTEA 5D3SA 5AMFA 5H85A 5DLZA 3ERRA 5DYXA 4NR8A 3SVGA 4OUFA 5DFCA 5ENHA 4CUSA 4BW1A 5CUDA 5HELA 5DY7A 5EWHA 5FH7A 4UITA 4QNSA 4Z6IA 4YBTA 4QC1A 5E9VA 4HXNA 5CUEA 4NQMA 4A9FA 4ZQLA 5KO4A 5ETDA 5FE8A 4O71A 3P1CA 4O70A 3LJWA 5E73A 5ENBA 4QY4A 5FE5A 3LXJA 4N3WA 5A85A 4NRBA 2R0YA 5I40A 5CUGA 4QSUA
chains in the Genus database with same CATH topology
3UVYA 5C85A 4CURA 4UIZA 5F61A 4YY4A 5CRZA 1ZS5A 5CUAA 5EP7A 4NUEA 4XUAA 4HXKA 4PKLA 5IGMA 5K29A 3D7CA 2YEMA 3AQAA 4IR4A 5I1QA 5LKZA 4XYAA 5D3RA 5CUCA 4KV1A 4KV4A 5FE4A 4O75A 4QSRA 5E3GA 3GG3A 4UYHA 4QC3A 5I88A 4Z6HA 5CUBA 5BT3A 5A81A 5LJ0A 4TS8A 4HBYA 5E7DA 5L98A 3RCWA 3S91A 3S92A 1WUGA 4QYLA 1E6IA 4HXOA 4LR6A 4PS5A 5FFWA 5LVRA 5EISA 4YYNA 5HEMA 5I80A 3Q2FA 4YADA 5F63A 4C66A 3UVWA 5CFWA 4YATA 4HXRA 5LKXA 4XUBA 4C67A 4YK0A 5D26A 5A5RA 4NRCA 5D0CA 2DKWA 2GRCA 4MR6A 4GPJA 4N4FA 4YABA 4NRAA 4NR5A 3U5LA 3O36A 4LYWA 3O37A 2RNXA 4PCIA 4XY8A 2N9GA 4BW4A 5ENJA 4CFLA 5D7XA 2L84A 4Q0NA 4TT6A 5FH6A 5CQ3A 4N4GA 1JSPB 5I83A 4UIYA 5TB6A 4NYWA 3QZVA 4CUTA 2LSPB 4LZSA 5E9IA 5DKCA 5KTUA 4TZ2A 4TU4A 3P5OA 5EQ1A 5A83A 2R0SA 3LQJA 4CLBA 4CUQA 5KTWA 5EK9A 2RS9B 4QEVA 4YYHA 4UIUA 4LYSA 5F25A 2DVRA 3FKMX 4QYDA 5AMEA 2DVVA 5G4SA 3MB4A 4BJXA 5F2PA 4A9KA 5D3HA 3U5PA 4LC2A 5D3PA 3UV4A 4QEWA 2RNYA 5E9MA 5CQ7A 5F60A 3I3JA 3SVHA 5DYCA 5I29A 2YELA 5HLSA 5F1HA 4TU6A 5CZGA 4QSSA 4MEOA 5DLXA 5DW2A 5FG5A 5FE0A 4LRGA 5HQ5A 1EQFA 5FG4A 5HRVA 3HMEA 5CGPA 2E7NA 5HCLA 4YY6A 4O78A 5E0RA 4HXSA 5EPBA 4A9NA 4WHUA 4MR4A 4X2IA 2RFJA 4O7EA 4A9EA 5FFYA 4ZW1A 3O33A 4YH4A 5A5NA 4YYMA 4QZSA 3U5MA 4LYIA 2F6NA 5IBNA 4TT2A 4Z93A 5CQ4A 5AD2A 4YBMA 3IU5A 2MJVB 5EWDA 5FE2A 3MB3A 3HMFA 4BHWA 3ONIA 4ALHA 5HM0A 5C89A 5LVQA 5CPEA 5CS8A 5ENGA 3G0LA 5ENEA 4J0SA 5CQAA 5JI8A 4NR7A 2WP2A 4PTBA 4AKNA 5II1A 4BW3A 5KTXA 4NR9A 5A7CA 3UW9A 4BW2A 5C87A 4Q0OA 2FSAA 4LZ2A 3QZTA 2OUOA 5F3AA 4NXJA 5II2A 4IOQA 5D3LA 5HQ6A 3AADA 2D9EA 4RVRA 4UIWA 5ACYA 5I86A 4QR3A 2D82A 4O74A 3HMHA 4QUUA 4LDFA 4NYVA 5DKDA 5DKHA 5L99A 2F6JA 3P1DA 4YYGA 5DYUA 3ZYUA 5EI4A 5DW1A 5I7XA 5BT4A 3P1FA 4Z1QA 4QUTA 4UYFB 2YEKA 5IGKA 4TT4A 3Q2EA 5HFRA 2H60A 4UYEA 5TCMA 4IOOA 5L8TA 4NYXA 5IGLA 2I8NA 3DWYA 4N4IA 4PCEA 5L96A 3TLPA 4F3IA 5EM3A 4UIVA 4O7BA 3UVXA 5A5OA 5HRWA 3QZSA 4MR5A 3U5OA 5H1UA 4ALGA 4O7FA 5FFVA 5LJ1A 2OO1A 5I89A 5D3NA 4A9HA 4Z1SA 5EGUA 5EWVA 5FE6A 3MXFA 4J3IA 2G4AA 5A5PA 2DATA 3UVDA 5D3TA 3U5KA 1F68A 4CFKA 3IU6A 1WUMA 4NUDA 5AD3A 4ZC9A 4QEUA 5CRMA 5CQTA 5ETBA 5HQ7A 5ENFA 5A5QA 4IORA 5CQ8A 5EU1A 2I7KA 5BT5A 4QSQA 5KHMA 3JVLA 4A9IA 5HJCA 3MULA 4UYDA 4A9JA 2WP1A 5CQ6A 4YYKA 3MQMA 5DFBA 5F62A 4QBMA 1X0JA 4IR6A 4A9LA 2R10A 2YQDA 2DVSA 5C4QA 4N4HA 5HFQA 4QSXA 4OGJA 2E3KA 5EICA 2YW5A 3NXBA 4YYDA 5EA1A 4O7CA 4YAXA 4CUUA 5E9LA 3U5NA 5ENCA 5EWWA 5G4RA 5H1VA 5EVAA 4A9MA 5FE7A 4IR3A 5LJ2A 4UIXA 5E3DA 5F1LA 4UYGA 4O77A 5FG6A 5JWMA 2RNWA 4NS5A 4NQNA 4TYLA 5FDZA 4TZ8A 5DX4A 2L85A 3O34A 5F5ZA 5IGNA 4YH3A 5FB1A 4QR5A 4NR4A 5COIA 3LQIA 4MEPA 4YC9A 5FB0A 3K2JA 5D24A 4LZRA 4A9OA 3DAIA 3JVJA 5CU8A 5HRXA 5FBXA 4HBWA 4KCXA 5FE3A 5H1TA 3U5JA 4QSTA 5FE1A 3UV5A 5C8GA 3UV2A 5CTLA 5DYAA 5E9YA 3MUKA 4WHWA 2L5EA 5LKTA 5D25A 5IG6A 5LUUA 4HBVA 5CQ5A 5EPSA 4FLPA 5A5SA 4O7AA 5CY9A 4J1PA 2DVQA 5C7NA 2R0VA 5LKUA 4DONA 2RO1A 4E96A 2KTBB 4IR5A 5L8UA 2E7OA 4NR6A 2YYNA 4O72A 5F36A 4YYIA 4XY9A 4MR3A 5DFDA 1JM4B 4PY6A 2YDWA 3LQHA 4HXLA 1N72A 4Y03A 4HBXA 5KU3A 4MENA 5FH8A 5CP5A 5I7YA 4NUCA 4O76A 4TQNA 2OSSA 5FE9A 2RI7A 4UYFA 5HENA 5ENIA 4J0RA 5A82A 5EWCA 3JVKA 2NXBA 4YBSA 5EV9A 4HXPA 4QB3A 5E9KA 3SVFA 3P1EA 4QR4A 4OGIA 5J0DA 5L97A 4QSVA 4MEQA 5D3JA 3O35A 5E74A 5IIDA 4QSPA 5EPRA 4YYJA 4QSWA 4WIVA 4CUPA 5DBMA 3JVMA 4CL9A 2DWWA 4HXMA 3G0JA 4TTEA 5D3SA 5AMFA 5H85A 5DLZA 5DYXA 4NR8A 3SVGA 4OUFA 5DFCA 5ENHA 4CUSA 4BW1A 5CUDA 5HELA 5DY7A 5EWHA 5FH7A 4UITA 4QNSA 4Z6IA 4YBTA 4QC1A 5E9VA 4HXNA 5CUEA 4NQMA 4A9FA 4ZQLA 5KO4A 5ETDA 5FE8A 4O71A 3P1CA 4O70A 3LJWA 5E73A 5ENBA 4QY4A 5FE5A 3LXJA 4N3WA 5A85A 4NRBA 2R0YA 5I40A 5CUGA 4QSUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UVY A;  5C85 A;  4CUR A;  4UIZ A;  5F61 A;  4YY4 A;  5CRZ A;  1ZS5 A;  5CUA A;  5EP7 A;  4NUE A;  4XUA A;  4HXK A;  4PKL A;  5IGM A;  5K29 A;  3D7C A;  2YEM A;  3AQA A;  4IR4 A;  5I1Q A;  5LKZ A;  4XYA A;  5D3R A;  5CUC A;  4KV1 A;  4KV4 A;  5FE4 A;  4O75 A;  4QSR A;  5E3G A;  3GG3 A;  4UYH A;  4QC3 A;  5I88 A;  4Z6H A;  5CUB A;  5BT3 A;  5A81 A;  5LJ0 A;  4TS8 A;  4HBY A;  5E7D A;  5L98 A;  3RCW A;  3S91 A;  3S92 A;  1WUG A;  4QYL A;  1E6I A;  4HXO A;  4LR6 A;  4PS5 A;  5FFW A;  5LVR A;  5EIS A;  4YYN A;  5HEM A;  5I80 A;  3Q2F A;  4YAD A;  5F63 A;  4C66 A;  3UVW A;  5CFW A;  4YAT A;  4HXR A;  5LKX A;  4XUB A;  4C67 A;  4YK0 A;  5D26 A;  5A5R A;  4NRC A;  5D0C A;  2DKW A;  2GRC A;  4MR6 A;  4GPJ A;  4N4F A;  4YAB A;  4NRA A;  4NR5 A;  3U5L A;  3O36 A;  4LYW A;  3O37 A;  2RNX A;  4PCI A;  4XY8 A;  2N9G A;  4BW4 A;  5ENJ A;  4CFL A;  5D7X A;  2L84 A;  4Q0N A;  4TT6 A;  5FH6 A;  5CQ3 A;  4N4G A;  1JSP B;  5I83 A;  4UIY A;  5TB6 A;  4NYW A;  3QZV A;  4CUT A;  2LSP B;  4LZS A;  5E9I A;  5DKC A;  5KTU A;  4TZ2 A;  4TU4 A;  3P5O A;  5EQ1 A;  5A83 A;  2R0S A;  3LQJ A;  4CLB A;  4CUQ A;  5KTW A;  5EK9 A;  2RS9 B;  4QEV A;  4YYH A;  4UIU A;  4LYS A;  5F25 A;  2DVR A;  3FKM X;  4QYD A;  5AME A;  2DVV A;  5G4S A;  3MB4 A;  4BJX A;  5F2P A;  4A9K A;  5D3H A;  3U5P A;  4LC2 A;  5D3P A;  3UV4 A;  4QEW A;  2RNY A;  5E9M A;  5CQ7 A;  5F60 A;  3I3J A;  3SVH A;  5DYC A;  5I29 A;  2YEL A;  5HLS A;  5F1H A;  4TU6 A;  5CZG A;  4QSS A;  4MEO A;  5DLX A;  5DW2 A;  5FG5 A;  5FE0 A;  4LRG A;  5HQ5 A;  1EQF A;  5FG4 A;  5HRV A;  3HME A;  5CGP A;  2E7N A;  5HCL A;  4YY6 A;  4O78 A;  5E0R A;  4HXS A;  5EPB A;  4A9N A;  4WHU A;  4MR4 A;  4X2I A;  2RFJ A;  4O7E A;  4A9E A;  5FFY A;  4ZW1 A;  3O33 A;  4YH4 A;  5A5N A;  4YYM A;  4QZS A;  3U5M A;  4LYI A;  2F6N A;  5IBN A;  4TT2 A;  4Z93 A;  5CQ4 A;  5AD2 A;  4YBM A;  3IU5 A;  2MJV B;  5EWD A;  5FE2 A;  3MB3 A;  3HMF A;  4BHW A;  3ONI A;  4ALH A;  5HM0 A;  5C89 A;  5LVQ A;  5CPE A;  5CS8 A;  5ENG A;  3G0L A;  5ENE A;  4J0S A;  5CQA A;  5JI8 A;  4NR7 A;  2WP2 A;  4PTB A;  4AKN A;  5II1 A;  4BW3 A;  5KTX A;  4NR9 A;  5A7C A;  3UW9 A;  4BW2 A;  5C87 A;  4Q0O A;  2FSA A;  4LZ2 A;  3QZT A;  2OUO A;  5F3A A;  4NXJ A;  5II2 A;  4IOQ A;  5D3L A;  5HQ6 A;  3AAD A;  2D9E A;  4RVR A;  4UIW A;  5ACY A;  5I86 A;  4QR3 A;  2D82 A;  4O74 A;  3HMH A;  4QUU A;  4LDF A;  4NYV A;  5DKD A;  5DKH A;  5L99 A;  2F6J A;  3P1D A;  4YYG A;  5DYU A;  3ZYU A;  5EI4 A;  5DW1 A;  5I7X A;  5BT4 A;  3P1F A;  4Z1Q A;  4QUT A;  4UYF B;  2YEK A;  5IGK A;  4TT4 A;  3Q2E A;  5HFR A;  2H60 A;  4UYE A;  5TCM A;  4IOO A;  5L8T A;  4NYX A;  5IGL A;  2I8N A;  3DWY A;  4N4I A;  4PCE A;  5L96 A;  3TLP A;  4F3I A;  5EM3 A;  4UIV A;  4O7B A;  3UVX A;  5A5O A;  5HRW A;  3QZS A;  4MR5 A;  3U5O A;  5H1U A;  4ALG A;  4O7F A;  5FFV A;  5LJ1 A;  2OO1 A;  5I89 A;  5D3N A;  4A9H A;  4Z1S A;  5EGU A;  5EWV A;  5FE6 A;  3MXF A;  4J3I A;  2G4A A;  5A5P A;  2DAT A;  3UVD A;  5D3T A;  3U5K A;  1F68 A;  4CFK A;  3IU6 A;  1WUM A;  4NUD A;  5AD3 A;  4ZC9 A;  4QEU A;  5CRM A;  5CQT A;  5ETB A;  5HQ7 A;  5ENF A;  5A5Q A;  4IOR A;  5CQ8 A;  5EU1 A;  2I7K A;  5BT5 A;  4QSQ A;  5KHM A;  3JVL A;  4A9I A;  5HJC A;  3MUL A;  4UYD A;  4A9J A;  2WP1 A;  5CQ6 A;  4YYK A;  3MQM A;  5DFB A;  5F62 A;  4QBM A;  1X0J A;  4IR6 A;  4A9L A;  2R10 A;  2YQD A;  2DVS A;  5C4Q A;  4N4H A;  5HFQ A;  4QSX A;  4OGJ A;  2E3K A;  5EIC A;  2YW5 A;  3NXB A;  4YYD A;  5EA1 A;  4O7C A;  4YAX A;  4CUU A;  5E9L A;  3U5N A;  5ENC A;  5EWW A;  5G4R A;  5H1V A;  5EVA A;  4A9M A;  5FE7 A;  4IR3 A;  5LJ2 A;  4UIX A;  5E3D A;  5F1L A;  4UYG A;  4O77 A;  5FG6 A;  5JWM A;  2RNW A;  4NS5 A;  4NQN A;  4TYL A;  5FDZ A;  4TZ8 A;  5DX4 A;  2L85 A;  3O34 A;  5F5Z A;  5IGN A;  4YH3 A;  5FB1 A;  4QR5 A;  4NR4 A;  5COI A;  3LQI A;  4MEP A;  4YC9 A;  5FB0 A;  3K2J A;  5D24 A;  4LZR A;  4A9O A;  3DAI A;  3JVJ A;  5CU8 A;  5HRX A;  5FBX A;  4HBW A;  4KCX A;  5FE3 A;  5H1T A;  3U5J A;  4QST A;  5FE1 A;  3UV5 A;  5C8G A;  3UV2 A;  5CTL A;  5DYA A;  5E9Y A;  3MUK A;  4WHW A;  2L5E A;  5LKT A;  5D25 A;  5IG6 A;  5LUU A;  4HBV A;  5CQ5 A;  5EPS A;  4FLP A;  5A5S A;  4O7A A;  5CY9 A;  4J1P A;  2DVQ A;  5C7N A;  2R0V A;  5LKU A;  4DON A;  2RO1 A;  4E96 A;  2KTB B;  4IR5 A;  5L8U A;  2E7O A;  4NR6 A;  2YYN A;  4O72 A;  5F36 A;  4YYI A;  4XY9 A;  4MR3 A;  5DFD A;  1JM4 B;  4PY6 A;  2YDW A;  3LQH A;  4HXL A;  1N72 A;  4Y03 A;  4HBX A;  5KU3 A;  4MEN A;  5FH8 A;  5CP5 A;  5I7Y A;  4NUC A;  4O76 A;  4TQN A;  2OSS A;  5FE9 A;  2RI7 A;  4UYF A;  5HEN A;  5ENI A;  4J0R A;  5A82 A;  5EWC A;  3JVK A;  2NXB A;  4YBS A;  5EV9 A;  4HXP A;  4QB3 A;  5E9K A;  3SVF A;  3P1E A;  4QR4 A;  4OGI A;  5J0D A;  5L97 A;  4QSV A;  4MEQ A;  5D3J A;  3O35 A;  5E74 A;  5IID A;  4QSP A;  5EPR A;  4YYJ A;  4QSW A;  4WIV A;  4CUP A;  5DBM A;  3JVM A;  4CL9 A;  2DWW A;  4HXM A;  3G0J A;  4TTE A;  5D3S A;  5AMF A;  5H85 A;  5DLZ A;  5DYX A;  4NR8 A;  3SVG A;  4OUF A;  5DFC A;  5ENH A;  4CUS A;  4BW1 A;  5CUD A;  5HEL A;  5DY7 A;  5EWH A;  5FH7 A;  4UIT A;  4QNS A;  4Z6I A;  4YBT A;  4QC1 A;  5E9V A;  4HXN A;  5CUE A;  4NQM A;  4A9F A;  4ZQL A;  5KO4 A;  5ETD A;  5FE8 A;  4O71 A;  3P1C A;  4O70 A;  3LJW A;  5E73 A;  5ENB A;  4QY4 A;  5FE5 A;  3LXJ A;  4N3W A;  5A85 A;  4NRB A;  2R0Y A;  5I40 A;  5CUG A;  4QSU A; 
#chains in the Genus database with same CATH topology
 3UVY A;  5C85 A;  4CUR A;  4UIZ A;  4AI6 A;  5F61 A;  4YY4 A;  5CRZ A;  1ZS5 A;  5CUA A;  1ZKR A;  5EP7 A;  4NUE A;  4XUA A;  4HXK A;  4PKL A;  5IGM A;  2EJN A;  5K29 A;  3D7C A;  2YEM A;  3AQA A;  4IR4 A;  5I1Q A;  5LKZ A;  4XYA A;  5D3R A;  5CUC A;  4KV1 A;  4KV4 A;  5FE4 A;  4O75 A;  4QSR A;  5E3G A;  3GG3 A;  4UYH A;  4QC3 A;  5I88 A;  4Z6H A;  5CUB A;  5BT3 A;  5A81 A;  5LJ0 A;  4TS8 A;  4HBY A;  5E7D A;  5L98 A;  3RCW A;  3S91 A;  3S92 A;  1WUG A;  4QYL A;  1E6I A;  4HXO A;  4LR6 A;  4PS5 A;  5FFW A;  5LVR A;  5EIS A;  4YYN A;  5HEM A;  5I80 A;  3Q2F A;  4YAD A;  5F63 A;  4C66 A;  3UVW A;  5CFW A;  4YAT A;  4HXR A;  5LKX A;  4XUB A;  4C67 A;  4YK0 A;  5D26 A;  5A5R A;  4NRC A;  5D0C A;  2DKW A;  2GRC A;  4MR6 A;  4GPJ A;  4N4F A;  4YAB A;  4NRA A;  4NR5 A;  3U5L A;  3O36 A;  4LYW A;  3O37 A;  2RNX A;  4PCI A;  4XY8 A;  2N9G A;  4BW4 A;  5ENJ A;  4CFL A;  5D7X A;  2L84 A;  4Q0N A;  4TT6 A;  5FH6 A;  5CQ3 A;  4N4G A;  1JSP B;  5I83 A;  4UIY A;  5TB6 A;  4NYW A;  3QZV A;  4CUT A;  2LSP B;  4LZS A;  5E9I A;  5DKC A;  5KTU A;  4TZ2 A;  4TU4 A;  3P5O A;  5EQ1 A;  5A83 A;  2R0S A;  3LQJ A;  4CLB A;  4CUQ A;  5KTW A;  5EK9 A;  2RS9 B;  4QEV A;  4YYH A;  4UIU A;  4LYS A;  5F25 A;  2DVR A;  3FKM X;  4QYD A;  5AME A;  2DVV A;  5G4S A;  3MB4 A;  4BJX A;  5F2P A;  4A9K A;  5D3H A;  3U5P A;  4LC2 A;  5D3P A;  3UV4 A;  4QEW A;  2RNY A;  5E9M A;  5CQ7 A;  5F60 A;  3I3J A;  3SVH A;  5DYC A;  5I29 A;  2YEL A;  5HLS A;  5F1H A;  4TU6 A;  5CZG A;  4QSS A;  4MEO A;  5DLX A;  5DW2 A;  5FG5 A;  5FE0 A;  4LRG A;  5HQ5 A;  1EQF A;  5FG4 A;  5HRV A;  3HME A;  5CGP A;  2E7N A;  5HCL A;  4YY6 A;  4O78 A;  5E0R A;  4HXS A;  5EPB A;  4A9N A;  4WHU A;  4MR4 A;  4X2I A;  2RFJ A;  4O7E A;  4A9E A;  3D1B A;  4AKI A;  5FFY A;  4ZW1 A;  3O33 A;  4YH4 A;  5A5N A;  4YYM A;  4QZS A;  3U5M A;  4LYI A;  2F6N A;  5IBN A;  4TT2 A;  4Z93 A;  5CQ4 A;  5AD2 A;  4YBM A;  2MJV B;  3IU5 A;  5EWD A;  5FE2 A;  3MB3 A;  3HMF A;  4BHW A;  3ONI A;  4ALH A;  5HM0 A;  5C89 A;  5LVQ A;  5CPE A;  5CS8 A;  5ENG A;  3G0L A;  5ENE A;  4J0S A;  5CQA A;  5JI8 A;  4NR7 A;  2WP2 A;  4PTB A;  4AKN A;  5II1 A;  4BW3 A;  5KTX A;  4NR9 A;  5A7C A;  3UW9 A;  4BW2 A;  5C87 A;  4Q0O A;  2FSA A;  4LZ2 A;  3QZT A;  2OUO A;  5F3A A;  1PUO A;  4NXJ A;  5II2 A;  4IOQ A;  5D3L A;  5HQ6 A;  3AAD A;  2D9E A;  4RVR A;  4UIW A;  5ACY A;  5I86 A;  4QR3 A;  2D82 A;  4O74 A;  3HMH A;  4QUU A;  4LDF A;  4NYV A;  5DKD A;  5DKH A;  5L99 A;  2F6J A;  3P1D A;  4YYG A;  5DYU A;  3ZYU A;  5EI4 A;  5DW1 A;  5I7X A;  5BT4 A;  3P1F A;  4Z1Q A;  4QUT A;  4UYF B;  2YEK A;  5IGK A;  4TT4 A;  3Q2E A;  5HFR A;  2H60 A;  3VKG A;  4UYE A;  5TCM A;  4IOO A;  5L8T A;  4NYX A;  5IGL A;  2I8N A;  3DWY A;  4N4I A;  4PCE A;  5L96 A;  3TLP A;  4F3I A;  5EM3 A;  4UIV A;  4O7B A;  3UVX A;  5A5O A;  5HRW A;  3QZS A;  4MR5 A;  3U5O A;  5H1U A;  4ALG A;  4O7F A;  5FFV A;  5LJ1 A;  2OO1 A;  5I89 A;  5D3N A;  4A9H A;  4Z1S A;  5EGU A;  5EWV A;  5FE6 A;  3MXF A;  4J3I A;  2G4A A;  5A5P A;  2DAT A;  3UVD A;  5D3T A;  3U5K A;  1F68 A;  4CFK A;  3IU6 A;  1WUM A;  4NUD A;  5AD3 A;  4ZC9 A;  4QEU A;  5CRM A;  5CQT A;  5ETB A;  5HQ7 A;  5ENF A;  5A5Q A;  4IOR A;  5CQ8 A;  5EU1 A;  2I7K A;  5BT5 A;  4QSQ A;  5KHM A;  4AKG A;  3JVL A;  4A9I A;  5HJC A;  3MUL A;  4UYD A;  4A9J A;  2WP1 A;  5CQ6 A;  4YYK A;  3MQM A;  5DFB A;  5F62 A;  4QBM A;  1X0J A;  3VKH A;  4IR6 A;  4A9L A;  2R10 A;  2YQD A;  2DVS A;  5C4Q A;  4N4H A;  5HFQ A;  4QSX A;  4OGJ A;  2E3K A;  5EIC A;  2YW5 A;  3NXB A;  4YYD A;  5EA1 A;  4O7C A;  4YAX A;  4CUU A;  5E9L A;  3U5N A;  5ENC A;  5EWW A;  5G4R A;  5H1V A;  5EVA A;  4A9M A;  5FE7 A;  4IR3 A;  5LJ2 A;  4UIX A;  5E3D A;  5F1L A;  4UYG A;  4O77 A;  5FG6 A;  5JWM A;  2RNW A;  4NS5 A;  4NQN A;  4TYL A;  5FDZ A;  4TZ8 A;  5DX4 A;  2L85 A;  3O34 A;  5F5Z A;  5IGN A;  4YH3 A;  5FB1 A;  4QR5 A;  4NR4 A;  5COI A;  3LQI A;  4MEP A;  4YC9 A;  5FB0 A;  3K2J A;  5D24 A;  4LZR A;  4A9O A;  3DAI A;  3JVJ A;  5CU8 A;  5HRX A;  5FBX A;  4HBW A;  4KCX A;  5FE3 A;  5H1T A;  3U5J A;  4QST A;  5FE1 A;  3UV5 A;  5C8G A;  3UV2 A;  5CTL A;  5DYA A;  5E9Y A;  3MUK A;  4WHW A;  2L5E A;  5LKT A;  5D25 A;  5IG6 A;  5LUU A;  4HBV A;  5CQ5 A;  5EPS A;  4FLP A;  5A5S A;  4O7A A;  5CY9 A;  4J1P A;  2DVQ A;  5C7N A;  2R0V A;  5LKU A;  4DON A;  2RO1 A;  4E96 A;  2KTB B;  4IR5 A;  5L8U A;  2E7O A;  4NR6 A;  2YYN A;  4O72 A;  5F36 A;  4YYI A;  4XY9 A;  4MR3 A;  5DFD A;  1JM4 B;  4PY6 A;  2YDW A;  3LQH A;  4HXL A;  1N72 A;  4Y03 A;  4HBX A;  5KU3 A;  4MEN A;  5FH8 A;  5CP5 A;  5I7Y A;  4NUC A;  4O76 A;  4TQN A;  2OSS A;  5FE9 A;  2RI7 A;  3D1D A;  4UYF A;  5HEN A;  5ENI A;  4J0R A;  5A82 A;  5EWC A;  3JVK A;  2NXB A;  4YBS A;  4AKH A;  5EV9 A;  4HXP A;  4QB3 A;  5E9K A;  3SVF A;  3P1E A;  4QR4 A;  4OGI A;  5J0D A;  5L97 A;  4QSV A;  4MEQ A;  5D3J A;  3O35 A;  5E74 A;  5IID A;  4QSP A;  5EPR A;  4YYJ A;  4QSW A;  4WIV A;  4CUP A;  5DBM A;  3JVM A;  4CL9 A;  2DWW A;  4HXM A;  3G0J A;  4TTE A;  5D3S A;  5AMF A;  5H85 A;  5DLZ A;  3ERR A;  5DYX A;  4NR8 A;  3SVG A;  4OUF A;  5DFC A;  5ENH A;  4CUS A;  4BW1 A;  5CUD A;  5HEL A;  5DY7 A;  5EWH A;  5FH7 A;  4UIT A;  4QNS A;  4Z6I A;  4YBT A;  4QC1 A;  5E9V A;  4HXN A;  5CUE A;  4NQM A;  4A9F A;  4ZQL A;  5KO4 A;  5ETD A;  5FE8 A;  4O71 A;  3P1C A;  4O70 A;  3LJW A;  5E73 A;  5ENB A;  4QY4 A;  5FE5 A;  3LXJ A;  4N3W A;  5A85 A;  4NRB A;  2R0Y A;  5I40 A;  5CUG A;  4QSU A; 
#chains in the Genus database with same CATH homology
 3UVY A;  5C85 A;  4CUR A;  4UIZ A;  5F61 A;  4YY4 A;  5CRZ A;  1ZS5 A;  5CUA A;  5EP7 A;  4NUE A;  4XUA A;  4HXK A;  4PKL A;  5IGM A;  5K29 A;  3D7C A;  2YEM A;  3AQA A;  4IR4 A;  5I1Q A;  5LKZ A;  4XYA A;  5D3R A;  5CUC A;  4KV1 A;  4KV4 A;  5FE4 A;  4O75 A;  4QSR A;  5E3G A;  3GG3 A;  4UYH A;  4QC3 A;  5I88 A;  4Z6H A;  5CUB A;  5BT3 A;  5A81 A;  5LJ0 A;  4TS8 A;  4HBY A;  5E7D A;  5L98 A;  3RCW A;  3S91 A;  3S92 A;  1WUG A;  4QYL A;  1E6I A;  4HXO A;  4LR6 A;  4PS5 A;  5FFW A;  5LVR A;  5EIS A;  4YYN A;  5HEM A;  5I80 A;  3Q2F A;  4YAD A;  5F63 A;  4C66 A;  3UVW A;  5CFW A;  4YAT A;  4HXR A;  5LKX A;  4XUB A;  4C67 A;  4YK0 A;  5D26 A;  5A5R A;  4NRC A;  5D0C A;  2DKW A;  2GRC A;  4MR6 A;  4GPJ A;  4N4F A;  4YAB A;  4NRA A;  4NR5 A;  3U5L A;  3O36 A;  4LYW A;  3O37 A;  2RNX A;  4PCI A;  4XY8 A;  2N9G A;  4BW4 A;  5ENJ A;  4CFL A;  5D7X A;  2L84 A;  4Q0N A;  4TT6 A;  5FH6 A;  5CQ3 A;  4N4G A;  1JSP B;  5I83 A;  4UIY A;  5TB6 A;  4NYW A;  3QZV A;  4CUT A;  2LSP B;  4LZS A;  5E9I A;  5DKC A;  5KTU A;  4TZ2 A;  4TU4 A;  3P5O A;  5EQ1 A;  5A83 A;  2R0S A;  3LQJ A;  4CLB A;  4CUQ A;  5KTW A;  5EK9 A;  2RS9 B;  4QEV A;  4YYH A;  4UIU A;  4LYS A;  5F25 A;  2DVR A;  3FKM X;  4QYD A;  5AME A;  2DVV A;  5G4S A;  3MB4 A;  4BJX A;  5F2P A;  4A9K A;  5D3H A;  3U5P A;  4LC2 A;  5D3P A;  3UV4 A;  4QEW A;  2RNY A;  5E9M A;  5CQ7 A;  5F60 A;  3I3J A;  3SVH A;  5DYC A;  5I29 A;  2YEL A;  5HLS A;  5F1H A;  4TU6 A;  5CZG A;  4QSS A;  4MEO A;  5DLX A;  5DW2 A;  5FG5 A;  5FE0 A;  4LRG A;  5HQ5 A;  1EQF A;  5FG4 A;  5HRV A;  3HME A;  5CGP A;  2E7N A;  5HCL A;  4YY6 A;  4O78 A;  5E0R A;  4HXS A;  5EPB A;  4A9N A;  4WHU A;  4MR4 A;  4X2I A;  2RFJ A;  4O7E A;  4A9E A;  5FFY A;  4ZW1 A;  3O33 A;  4YH4 A;  5A5N A;  4YYM A;  4QZS A;  3U5M A;  4LYI A;  2F6N A;  5IBN A;  4TT2 A;  4Z93 A;  5CQ4 A;  5AD2 A;  4YBM A;  3IU5 A;  2MJV B;  5EWD A;  5FE2 A;  3MB3 A;  3HMF A;  4BHW A;  3ONI A;  4ALH A;  5HM0 A;  5C89 A;  5LVQ A;  5CPE A;  5CS8 A;  5ENG A;  3G0L A;  5ENE A;  4J0S A;  5CQA A;  5JI8 A;  4NR7 A;  2WP2 A;  4PTB A;  4AKN A;  5II1 A;  4BW3 A;  5KTX A;  4NR9 A;  5A7C A;  3UW9 A;  4BW2 A;  5C87 A;  4Q0O A;  2FSA A;  4LZ2 A;  3QZT A;  2OUO A;  5F3A A;  4NXJ A;  5II2 A;  4IOQ A;  5D3L A;  5HQ6 A;  3AAD A;  2D9E A;  4RVR A;  4UIW A;  5ACY A;  5I86 A;  4QR3 A;  2D82 A;  4O74 A;  3HMH A;  4QUU A;  4LDF A;  4NYV A;  5DKD A;  5DKH A;  5L99 A;  2F6J A;  3P1D A;  4YYG A;  5DYU A;  3ZYU A;  5EI4 A;  5DW1 A;  5I7X A;  5BT4 A;  3P1F A;  4Z1Q A;  4QUT A;  4UYF B;  2YEK A;  5IGK A;  4TT4 A;  3Q2E A;  5HFR A;  2H60 A;  4UYE A;  5TCM A;  4IOO A;  5L8T A;  4NYX A;  5IGL A;  2I8N A;  3DWY A;  4N4I A;  4PCE A;  5L96 A;  3TLP A;  4F3I A;  5EM3 A;  4UIV A;  4O7B A;  3UVX A;  5A5O A;  5HRW A;  3QZS A;  4MR5 A;  3U5O A;  5H1U A;  4ALG A;  4O7F A;  5FFV A;  5LJ1 A;  2OO1 A;  5I89 A;  5D3N A;  4A9H A;  4Z1S A;  5EGU A;  5EWV A;  5FE6 A;  3MXF A;  4J3I A;  2G4A A;  5A5P A;  2DAT A;  3UVD A;  5D3T A;  3U5K A;  1F68 A;  4CFK A;  3IU6 A;  1WUM A;  4NUD A;  5AD3 A;  4ZC9 A;  4QEU A;  5CRM A;  5CQT A;  5ETB A;  5HQ7 A;  5ENF A;  5A5Q A;  4IOR A;  5CQ8 A;  5EU1 A;  2I7K A;  5BT5 A;  4QSQ A;  5KHM A;  3JVL A;  4A9I A;  5HJC A;  3MUL A;  4UYD A;  4A9J A;  2WP1 A;  5CQ6 A;  4YYK A;  3MQM A;  5DFB A;  5F62 A;  4QBM A;  1X0J A;  4IR6 A;  4A9L A;  2R10 A;  2YQD A;  2DVS A;  5C4Q A;  4N4H A;  5HFQ A;  4QSX A;  4OGJ A;  2E3K A;  5EIC A;  2YW5 A;  3NXB A;  4YYD A;  5EA1 A;  4O7C A;  4YAX A;  4CUU A;  5E9L A;  3U5N A;  5ENC A;  5EWW A;  5G4R A;  5H1V A;  5EVA A;  4A9M A;  5FE7 A;  4IR3 A;  5LJ2 A;  4UIX A;  5E3D A;  5F1L A;  4UYG A;  4O77 A;  5FG6 A;  5JWM A;  2RNW A;  4NS5 A;  4NQN A;  4TYL A;  5FDZ A;  4TZ8 A;  5DX4 A;  2L85 A;  3O34 A;  5F5Z A;  5IGN A;  4YH3 A;  5FB1 A;  4QR5 A;  4NR4 A;  5COI A;  3LQI A;  4MEP A;  4YC9 A;  5FB0 A;  3K2J A;  5D24 A;  4LZR A;  4A9O A;  3DAI A;  3JVJ A;  5CU8 A;  5HRX A;  5FBX A;  4HBW A;  4KCX A;  5FE3 A;  5H1T A;  3U5J A;  4QST A;  5FE1 A;  3UV5 A;  5C8G A;  3UV2 A;  5CTL A;  5DYA A;  5E9Y A;  3MUK A;  4WHW A;  2L5E A;  5LKT A;  5D25 A;  5IG6 A;  5LUU A;  4HBV A;  5CQ5 A;  5EPS A;  4FLP A;  5A5S A;  4O7A A;  5CY9 A;  4J1P A;  2DVQ A;  5C7N A;  2R0V A;  5LKU A;  4DON A;  2RO1 A;  4E96 A;  2KTB B;  4IR5 A;  5L8U A;  2E7O A;  4NR6 A;  2YYN A;  4O72 A;  5F36 A;  4YYI A;  4XY9 A;  4MR3 A;  5DFD A;  1JM4 B;  4PY6 A;  2YDW A;  3LQH A;  4HXL A;  1N72 A;  4Y03 A;  4HBX A;  5KU3 A;  4MEN A;  5FH8 A;  5CP5 A;  5I7Y A;  4NUC A;  4O76 A;  4TQN A;  2OSS A;  5FE9 A;  2RI7 A;  4UYF A;  5HEN A;  5ENI A;  4J0R A;  5A82 A;  5EWC A;  3JVK A;  2NXB A;  4YBS A;  5EV9 A;  4HXP A;  4QB3 A;  5E9K A;  3SVF A;  3P1E A;  4QR4 A;  4OGI A;  5J0D A;  5L97 A;  4QSV A;  4MEQ A;  5D3J A;  3O35 A;  5E74 A;  5IID A;  4QSP A;  5EPR A;  4YYJ A;  4QSW A;  4WIV A;  4CUP A;  5DBM A;  3JVM A;  4CL9 A;  2DWW A;  4HXM A;  3G0J A;  4TTE A;  5D3S A;  5AMF A;  5H85 A;  5DLZ A;  5DYX A;  4NR8 A;  3SVG A;  4OUF A;  5DFC A;  5ENH A;  4CUS A;  4BW1 A;  5CUD A;  5HEL A;  5DY7 A;  5EWH A;  5FH7 A;  4UIT A;  4QNS A;  4Z6I A;  4YBT A;  4QC1 A;  5E9V A;  4HXN A;  5CUE A;  4NQM A;  4A9F A;  4ZQL A;  5KO4 A;  5ETD A;  5FE8 A;  4O71 A;  3P1C A;  4O70 A;  3LJW A;  5E73 A;  5ENB A;  4QY4 A;  5FE5 A;  3LXJ A;  4N3W A;  5A85 A;  4NRB A;  2R0Y A;  5I40 A;  5CUG A;  4QSU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...