4TU4A

Crystal structure of atad2a bromodomain complexed with 3-(3,5-dimethyl-1,2-oxazol-4-yl)-5-[(phenylsulfonyl)amino]benzoicacid
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
130
structure length
130
Chain Sequence
SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICSNALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Gene regulation
molecule keywords ATPase family AAA domain-containing protein 2
publication title Observed bromodomain flexibility reveals histone peptide- and small molecule ligand-compatible forms of ATAD2.
pubmed doi rcsb
source organism Homo sapiens
total genus 54
structure length 130
sequence length 130
ec nomenclature ec 3.6.1.3: Adenosinetriphosphatase.
pdb deposition date 2014-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4tu4A00
4NRBA 5FE5A 4O7BA 1JM4B 5A7CA 4IOQA 4IR3A 3O37A 1WUMA 4PTBA 4QEWA 3P5OA 4O7AA 2LSPB 5CUDA 5F36A 4YATA 5EP7A 4TZ8A 4O72A 2WP2A 5CQTA 5F62A 4QSTA 5L97A 3P1DA 5CU8A 5HENA 2YDWA 4UYFA 4KV1A 4UIYA 4QR4A 4QC3A 2YEMA 1ZS5A 4NR4A 5ACYA 4NRAA 4YYIA 4IR5A 3ZYUA 4UYFB 5A81A 5H85A 5LVRA 4N4GA 2R10A 5DLXA 5FG6A 4IOOA 5IIDA 4MEOA 4HXLA 4NR5A 4UITA 4UIUA 4PKLA 4A9FA 5C7NA 4F3IA 2DKWA 5I40A 5FE2A 5E3GA 5CGPA 5CQ4A 4BHWA 3O36A 5ENEA 4WIVA 4Z6IA 5FFVA 4LR6A 5D3PA 4QNSA 5FH6A 3MULA 3UV5A 2YQDA 4NUEA 4TU6A 5EM3A 5DBMA 5DLZA 5HELA 5CUAA 4CUPA 4TTEA 4YAXA 2KTBB 5AMFA 5EICA 5AD2A 3U5PA 4LC2A 4YBSA 5K29A 5L99A 4YBTA 5HQ6A 4QB3A 5A82A 3I3JA 3MUKA 5EPRA 4KCXA 4TT2A 4QSUA 5FH8A 5EPSA 5DYXA 3HMFA 5D3NA 5LKZA 4ALHA 5FFWA 4O74A 4C67A 5HCLA 4NR6A 3U5JA 4QYDA 3SVGA 4LZSA 2DVVA 4HXMA 5HJCA 4NRCA 2G4AA 5F5ZA 5CUGA 4HXOA 4LYIA 2R0VA 5FBXA 5D3TA 5I88A 5DY7A 4YH3A 2R0SA 5IBNA 2YELA 5CZGA 4LYSA 4BW1A 3UVDA 5LKTA 4MR6A 4PCEA 2DATA 5HEMA 4N4IA 4NS5A 4TZ2A 5E0RA 5II2A 3UVWA 4A9KA 5C8GA 5FE8A 5I86A 5LKXA 2L84A 5ENHA 2OO1A 2N9GA 5CQ6A 5ENBA 5KTUA 4Y03A 4IR6A 5ENIA 5EK9A 4CUUA 4YK0A 3U5LA 4CURA 5HLSA 3IU6A 5CRZA 2DVRA 5CQAA 4UYEA 4ZQLA 5AMEA 3JVKA 3JVLA 4N4HA 3DAIA 2RO1A 4PY6A 3U5MA 5LJ2A 3UV4A 4NR8A 1N72A 5L8TA 3FKMX 4NQMA 3K2JA 5F25A 5F3AA 3UV2A 4HXNA 2RNXA 3AADA 2F6NA 5DW1A 4YYGA 5I29A 4O76A 4GPJA 5CQ7A 5E3DA 4NR9A 2YEKA 3G0JA 4A9OA 2H60A 5JWMA 5L98A 4LYWA 4O7FA 4NXJA 5IGLA 2FSAA 5E74A 5EVAA 2WP1A 4NYXA 4LZRA 2NXBA 5DYUA 5C4QA 4LRGA 4OGJA 4MEPA 3SVFA 5C89A 5KTWA 5A5PA 5D26A 4QSSA 5EWDA 3SVHA 5I83A 5ENJA 5L8UA 4QSWA 5FE1A 4HXKA 1X0JA 5EGUA 4YH4A 5A5NA 3NXBA 5FB0A 5AD3A 4J3IA 5TCMA 5HM0A 5D7XA 5FFYA 5COIA 4YYJA 5IGNA 5FE3A 5E73A 3UVYA 4A9EA 5CPEA 1E6IA 4YYNA 4Q0NA 3QZTA 5D24A 4Q0OA 5HRVA 5EQ1A 4YABA 5EPBA 5L96A 5TB6A 5FG4A 4YY4A 4UIVA 5FDZA 1F68A 4HBXA 5F2PA 3G0LA 5EI4A 2RS9B 5A5QA 4QEVA 4QUUA 5F63A 2E7NA 3IU5A 2OUOA 5ENFA 4HBYA 2D82A 5IGMA 5H1TA 4A9MA 4AKNA 2DVQA 5F1HA 3P1FA 5I1QA 5EWWA 3DWYA 4MENA 3MXFA 2RNWA 4Z1QA 3O34A 5CQ8A 3GG3A 3D7CA 4XY9A 4HBVA 5D25A 5JI8A 4ZC9A 4YC9A 5LJ1A 5FE4A 3JVJA 5A5SA 4J0RA 5LJ0A 4HXRA 5DKDA 5EA1A 5D3JA 5HRXA 2I8NA 4QSRA 5E9YA 5C87A 5F61A 4QEUA 5DFCA 4ZW1A 4Z6HA 5A85A 5FE6A 4CL9A 5G4SA 5KHMA 4TT4A 4MR4A 4CUTA 4QUTA 3AQAA 4N4FA 2MJVB 2I7KA 4O78A 5G4RA 5CUBA 5I89A 5DKCA 4OUFA 3HMEA 4XUBA 4ALGA 5ENGA 5CTLA 3S91A 2D9EA 4Z93A 4C66A 2L5EA 3S92A 4QZSA 4J0SA 3P1EA 3LQJA 5HRWA 2OSSA 5D3LA 4PCIA 5LVQA 2DVSA 4O77A 2DWWA 3QZVA 4TYLA 4CFLA 5FG5A 4QSVA 5DYAA 5J0DA 4YY6A 4YBMA 3UW9A 4O7CA 5II1A 4NYVA 4QR3A 4IR4A 4UYHA 5EWVA 4XYAA 5FE0A 5H1UA 5KTXA 3LXJA 4UYGA 4YYDA 2YYNA 1EQFA 5D3RA 4NUCA 5HFRA 5ENCA 2YW5A 4TQNA 4A9NA 4A9IA 5KU3A 1JSPB 3TLPA 5IG6A 3Q2FA 5IGKA 4QYLA 4Z1SA 4MR5A 5D3SA 4KV4A 4WHWA 4UIZA 3P1CA 4BW4A 4YYMA 5CFWA 5BT5A 5DFBA 4TS8A 5E9KA 2RFJA 3U5NA 5ETBA 5F1LA 4YYKA 4CUQA 2RI7A 4O71A 5DYCA 4BJXA 4QBMA 4NQNA 4QC1A 5LKUA 3LJWA 4QSQA 3LQHA 5EWCA 3MB4A 5H1VA 3MQMA 5FH7A 5CUEA 5CUCA 4MEQA 4BW2A 4CUSA 5CQ5A 4X2IA 3QZSA 4QR5A 5E9IA 5BT4A 5DKHA 4YYHA 3LQIA 4NYWA 3U5KA 4CFKA 5FE7A 5CP5A 4QSXA 5FB1A 3O35A 2E7OA 2R0YA 5D0CA 3ONIA 4XUAA 4UIXA 5EWHA 4XY8A 4O75A 2RNYA 4HXSA 4TT6A 4WHUA 5CS8A 4HBWA 4A9HA 5I80A 4J1PA 5EU1A 1WUGA 5E9MA 4UIWA 5I7XA 5HFQA 4MR3A 5EV9A 4FLPA 5DX4A 3O33A 4OGIA 5CY9A 5HQ7A 3RCWA 4LZ2A 4QSPA 4PS5A 3MB3A 2F6JA 5DW2A 2L85A 5I7YA 4O7EA 4E96A 3JVMA 5D3HA 5LUUA 4CLBA 4TU4A 5CRMA 5KO4A 3HMHA 4NR7A 5A5RA 5ETDA 4HXPA 4YADA 5E9VA 5C85A 2GRCA 4RVRA 4IORA 4N3WA 4O70A 5F60A 4LDFA 5HQ5A 4NUDA 5EISA 3U5OA 3UVXA 5A5OA 5CQ3A 4UYDA 4A9JA 4BW3A 5E7DA 5FE9A 2E3KA 5A83A 5DFDA 5BT3A 4A9LA 5E9LA 4QY4A 4DONA 3Q2EA
chains in the Genus database with same CATH superfamily
4NRBA 5FE5A 4O7BA 4AKIA 1JM4B 5A7CA 4IOQA 4IR3A 3O37A 1WUMA 4PTBA 4QEWA 3P5OA 4O7AA 2LSPB 5CUDA 5F36A 4YATA 5EP7A 4TZ8A 4O72A 2WP2A 5CQTA 5F62A 4QSTA 5L97A 3P1DA 5CU8A 5HENA 2YDWA 4UYFA 4KV1A 4UIYA 4QR4A 4QC3A 2YEMA 1ZS5A 4NR4A 5ACYA 4NRAA 4YYIA 4IR5A 3ZYUA 4UYFB 5A81A 5H85A 5LVRA 4N4GA 3VKGA 2R10A 5DLXA 5FG6A 4IOOA 5IIDA 4MEOA 4HXLA 4NR5A 4UITA 4UIUA 4PKLA 4A9FA 5C7NA 4F3IA 2DKWA 5I40A 5FE2A 4AKGA 5E3GA 5CGPA 5CQ4A 4BHWA 3O36A 5ENEA 3D1DA 4WIVA 4Z6IA 5FFVA 4LR6A 5D3PA 4QNSA 5FH6A 3MULA 3UV5A 2YQDA 4NUEA 4TU6A 5EM3A 5DBMA 5DLZA 5HELA 5CUAA 4CUPA 4TTEA 4YAXA 2KTBB 5AMFA 5EICA 5AD2A 3U5PA 4LC2A 4YBSA 5K29A 5L99A 4YBTA 5HQ6A 4QB3A 5A82A 3I3JA 3MUKA 5EPRA 4KCXA 4TT2A 4QSUA 5FH8A 5EPSA 5DYXA 4AKHA 3HMFA 5D3NA 5LKZA 4ALHA 5FFWA 4O74A 4C67A 5HCLA 4NR6A 3U5JA 4QYDA 3SVGA 4LZSA 2DVVA 1PUOA 4HXMA 5HJCA 4NRCA 2G4AA 5F5ZA 5CUGA 4HXOA 4LYIA 2R0VA 5FBXA 5D3TA 5I88A 5DY7A 4YH3A 2R0SA 5IBNA 2YELA 5CZGA 4LYSA 4BW1A 3UVDA 5LKTA 4MR6A 4PCEA 2DATA 5HEMA 4N4IA 4NS5A 4TZ2A 5E0RA 5II2A 3UVWA 4A9KA 5C8GA 5FE8A 5I86A 5LKXA 2L84A 5ENHA 2OO1A 2N9GA 5CQ6A 5ENBA 5KTUA 4Y03A 4IR6A 5ENIA 5EK9A 4CUUA 4YK0A 3U5LA 4CURA 5HLSA 3IU6A 5CRZA 2EJNA 2DVRA 5CQAA 4UYEA 4ZQLA 5AMEA 3JVKA 3JVLA 4N4HA 3DAIA 2RO1A 4PY6A 3U5MA 5LJ2A 3UV4A 4NR8A 1N72A 5L8TA 3FKMX 4NQMA 3K2JA 5F25A 5F3AA 3UV2A 4HXNA 2RNXA 3AADA 2F6NA 5DW1A 4YYGA 5I29A 4O76A 4GPJA 5CQ7A 5E3DA 4NR9A 2YEKA 3G0JA 4A9OA 2H60A 5JWMA 5L98A 4LYWA 4O7FA 4NXJA 5IGLA 2FSAA 5E74A 5EVAA 2WP1A 4NYXA 4LZRA 2NXBA 5DYUA 5C4QA 4LRGA 4OGJA 4MEPA 3SVFA 5C89A 5KTWA 5A5PA 5D26A 4QSSA 5EWDA 3SVHA 5I83A 5ENJA 5L8UA 4QSWA 5FE1A 4HXKA 1X0JA 5EGUA 4YH4A 5A5NA 3NXBA 5FB0A 5AD3A 4J3IA 5TCMA 5HM0A 5D7XA 5FFYA 5COIA 4YYJA 5IGNA 5FE3A 5E73A 3UVYA 4A9EA 5CPEA 1E6IA 4YYNA 4Q0NA 3QZTA 5D24A 4Q0OA 5HRVA 5EQ1A 4YABA 5EPBA 5L96A 5TB6A 5FG4A 4YY4A 4UIVA 5FDZA 1F68A 4HBXA 5F2PA 3G0LA 5EI4A 2RS9B 5A5QA 4QEVA 4QUUA 5F63A 2E7NA 3IU5A 2OUOA 5ENFA 4HBYA 2D82A 5IGMA 5H1TA 4A9MA 4AKNA 2DVQA 5F1HA 3P1FA 5I1QA 5EWWA 3DWYA 4MENA 3MXFA 2RNWA 4Z1QA 3O34A 5CQ8A 3GG3A 3D7CA 4XY9A 4HBVA 5D25A 5JI8A 4ZC9A 4YC9A 5LJ1A 5FE4A 3JVJA 5A5SA 4J0RA 5LJ0A 4HXRA 5DKDA 5EA1A 5D3JA 5HRXA 2I8NA 4QSRA 5E9YA 5C87A 5F61A 3D1BA 4QEUA 5DFCA 4ZW1A 4Z6HA 5A85A 5FE6A 4CL9A 3ERRA 5G4SA 5KHMA 4TT4A 4MR4A 4CUTA 4QUTA 3AQAA 4N4FA 2MJVB 2I7KA 4O78A 4AI6A 5G4RA 5CUBA 5I89A 5DKCA 4OUFA 3HMEA 4XUBA 4ALGA 5ENGA 5CTLA 3S91A 2D9EA 4Z93A 4C66A 2L5EA 3S92A 4QZSA 4J0SA 3P1EA 3LQJA 5HRWA 2OSSA 5D3LA 4PCIA 5LVQA 2DVSA 4O77A 2DWWA 3QZVA 4TYLA 4CFLA 5FG5A 4QSVA 5DYAA 5J0DA 4YY6A 4YBMA 3UW9A 4O7CA 5II1A 4NYVA 4QR3A 4IR4A 4UYHA 3VKHA 5EWVA 4XYAA 5FE0A 5H1UA 5KTXA 3LXJA 4UYGA 4YYDA 2YYNA 1EQFA 5D3RA 4NUCA 5HFRA 5ENCA 2YW5A 4TQNA 4A9NA 4A9IA 5KU3A 1JSPB 3TLPA 5IG6A 3Q2FA 5IGKA 4QYLA 4Z1SA 4MR5A 5D3SA 4KV4A 4WHWA 4UIZA 3P1CA 4BW4A 4YYMA 5CFWA 5BT5A 5DFBA 4TS8A 5E9KA 2RFJA 3U5NA 5ETBA 5F1LA 4YYKA 4CUQA 2RI7A 4O71A 5DYCA 4BJXA 4QBMA 4NQNA 4QC1A 5LKUA 3LJWA 4QSQA 3LQHA 5EWCA 3MB4A 5H1VA 3MQMA 5FH7A 5CUEA 5CUCA 4MEQA 4BW2A 4CUSA 5CQ5A 4X2IA 3QZSA 4QR5A 5E9IA 5BT4A 5DKHA 4YYHA 3LQIA 4NYWA 3U5KA 4CFKA 5FE7A 5CP5A 4QSXA 5FB1A 3O35A 2E7OA 2R0YA 5D0CA 3ONIA 4XUAA 4UIXA 5EWHA 4XY8A 4O75A 2RNYA 4HXSA 4TT6A 4WHUA 5CS8A 4HBWA 4A9HA 5I80A 4J1PA 5EU1A 1WUGA 5E9MA 4UIWA 5I7XA 5HFQA 4MR3A 1ZKRA 5EV9A 4FLPA 5DX4A 3O33A 4OGIA 5CY9A 5HQ7A 3RCWA 4LZ2A 4QSPA 4PS5A 3MB3A 2F6JA 5DW2A 2L85A 5I7YA 4O7EA 4E96A 3JVMA 5D3HA 5LUUA 4CLBA 4TU4A 5CRMA 5KO4A 3HMHA 4NR7A 5A5RA 5ETDA 4HXPA 4YADA 5E9VA 5C85A 2GRCA 4RVRA 4IORA 4N3WA 4O70A 5F60A 4LDFA 5HQ5A 4NUDA 5EISA 3U5OA 3UVXA 5A5OA 5CQ3A 4UYDA 4A9JA 4BW3A 5E7DA 5FE9A 2E3KA 5A83A 5DFDA 5BT3A 4A9LA 5E9LA 4QY4A 4DONA 3Q2EA
chains in the Genus database with same CATH topology
4NRBA 5FE5A 4O7BA 1JM4B 5A7CA 4IOQA 4IR3A 3O37A 1WUMA 4PTBA 4QEWA 3P5OA 4O7AA 2LSPB 5CUDA 5F36A 4YATA 5EP7A 4TZ8A 4O72A 2WP2A 5CQTA 5F62A 4QSTA 5L97A 3P1DA 5CU8A 5HENA 2YDWA 4UYFA 4KV1A 4UIYA 4QR4A 4QC3A 2YEMA 1ZS5A 4NR4A 5ACYA 4NRAA 4YYIA 4IR5A 3ZYUA 4UYFB 5A81A 5H85A 5LVRA 4N4GA 2R10A 5DLXA 5FG6A 4IOOA 5IIDA 4MEOA 4HXLA 4NR5A 4UITA 4UIUA 4PKLA 4A9FA 5C7NA 4F3IA 2DKWA 5I40A 5FE2A 5E3GA 5CGPA 5CQ4A 4BHWA 3O36A 5ENEA 4WIVA 4Z6IA 5FFVA 4LR6A 5D3PA 4QNSA 5FH6A 3MULA 3UV5A 2YQDA 4NUEA 4TU6A 5EM3A 5DBMA 5DLZA 5HELA 5CUAA 4CUPA 4TTEA 4YAXA 2KTBB 5AMFA 5EICA 5AD2A 3U5PA 4LC2A 4YBSA 5K29A 5L99A 4YBTA 5HQ6A 4QB3A 5A82A 3I3JA 3MUKA 5EPRA 4KCXA 4TT2A 4QSUA 5FH8A 5EPSA 5DYXA 3HMFA 5D3NA 5LKZA 4ALHA 5FFWA 4O74A 4C67A 5HCLA 4NR6A 3U5JA 4QYDA 3SVGA 4LZSA 2DVVA 4HXMA 5HJCA 4NRCA 2G4AA 5F5ZA 5CUGA 4HXOA 4LYIA 2R0VA 5FBXA 5D3TA 5I88A 5DY7A 4YH3A 2R0SA 5IBNA 2YELA 5CZGA 4LYSA 4BW1A 3UVDA 5LKTA 4MR6A 4PCEA 2DATA 5HEMA 4N4IA 4NS5A 4TZ2A 5E0RA 5II2A 3UVWA 4A9KA 5C8GA 5FE8A 5I86A 5LKXA 2L84A 5ENHA 2OO1A 2N9GA 5CQ6A 5ENBA 5KTUA 4Y03A 4IR6A 5ENIA 5EK9A 4CUUA 4YK0A 3U5LA 4CURA 5HLSA 3IU6A 5CRZA 2DVRA 5CQAA 4UYEA 4ZQLA 5AMEA 3JVKA 3JVLA 4N4HA 3DAIA 2RO1A 4PY6A 3U5MA 5LJ2A 3UV4A 4NR8A 1N72A 5L8TA 3FKMX 4NQMA 3K2JA 5F25A 5F3AA 3UV2A 4HXNA 2RNXA 3AADA 2F6NA 5DW1A 4YYGA 5I29A 4O76A 4GPJA 5CQ7A 5E3DA 4NR9A 2YEKA 3G0JA 4A9OA 2H60A 5JWMA 5L98A 4LYWA 4O7FA 4NXJA 5IGLA 2FSAA 5E74A 5EVAA 2WP1A 4NYXA 4LZRA 2NXBA 5DYUA 5C4QA 4LRGA 4OGJA 4MEPA 3SVFA 5C89A 5KTWA 5A5PA 5D26A 4QSSA 5EWDA 3SVHA 5I83A 5ENJA 5L8UA 4QSWA 5FE1A 4HXKA 1X0JA 5EGUA 4YH4A 5A5NA 3NXBA 5FB0A 5AD3A 4J3IA 5TCMA 5HM0A 5D7XA 5FFYA 5COIA 4YYJA 5IGNA 5FE3A 5E73A 3UVYA 4A9EA 5CPEA 1E6IA 4YYNA 4Q0NA 3QZTA 5D24A 4Q0OA 5HRVA 5EQ1A 4YABA 5EPBA 5L96A 5TB6A 5FG4A 4YY4A 4UIVA 5FDZA 1F68A 4HBXA 5F2PA 3G0LA 5EI4A 2RS9B 5A5QA 4QEVA 4QUUA 5F63A 2E7NA 3IU5A 2OUOA 5ENFA 4HBYA 2D82A 5IGMA 5H1TA 4A9MA 4AKNA 2DVQA 5F1HA 3P1FA 5I1QA 5EWWA 3DWYA 4MENA 3MXFA 2RNWA 4Z1QA 3O34A 5CQ8A 3GG3A 3D7CA 4XY9A 4HBVA 5D25A 5JI8A 4ZC9A 4YC9A 5LJ1A 5FE4A 3JVJA 5A5SA 4J0RA 5LJ0A 4HXRA 5DKDA 5EA1A 5D3JA 5HRXA 2I8NA 4QSRA 5E9YA 5C87A 5F61A 4QEUA 5DFCA 4ZW1A 4Z6HA 5A85A 5FE6A 4CL9A 5G4SA 5KHMA 4TT4A 4MR4A 4CUTA 4QUTA 3AQAA 4N4FA 2MJVB 2I7KA 4O78A 5G4RA 5CUBA 5I89A 5DKCA 4OUFA 3HMEA 4XUBA 4ALGA 5ENGA 5CTLA 3S91A 2D9EA 4Z93A 4C66A 2L5EA 3S92A 4QZSA 4J0SA 3P1EA 3LQJA 5HRWA 2OSSA 5D3LA 4PCIA 5LVQA 2DVSA 4O77A 2DWWA 3QZVA 4TYLA 4CFLA 5FG5A 4QSVA 5DYAA 5J0DA 4YY6A 4YBMA 3UW9A 4O7CA 5II1A 4NYVA 4QR3A 4IR4A 4UYHA 5EWVA 4XYAA 5FE0A 5H1UA 5KTXA 3LXJA 4UYGA 4YYDA 2YYNA 1EQFA 5D3RA 4NUCA 5HFRA 5ENCA 2YW5A 4TQNA 4A9NA 4A9IA 5KU3A 1JSPB 3TLPA 5IG6A 3Q2FA 5IGKA 4QYLA 4Z1SA 4MR5A 5D3SA 4KV4A 4WHWA 4UIZA 3P1CA 4BW4A 4YYMA 5CFWA 5BT5A 5DFBA 4TS8A 5E9KA 2RFJA 3U5NA 5ETBA 5F1LA 4YYKA 4CUQA 2RI7A 4O71A 5DYCA 4BJXA 4QBMA 4NQNA 4QC1A 5LKUA 3LJWA 4QSQA 3LQHA 5EWCA 3MB4A 5H1VA 3MQMA 5FH7A 5CUEA 5CUCA 4MEQA 4BW2A 4CUSA 5CQ5A 4X2IA 3QZSA 4QR5A 5E9IA 5BT4A 5DKHA 4YYHA 3LQIA 4NYWA 3U5KA 4CFKA 5FE7A 5CP5A 4QSXA 5FB1A 3O35A 2E7OA 2R0YA 5D0CA 3ONIA 4XUAA 4UIXA 5EWHA 4XY8A 4O75A 2RNYA 4HXSA 4TT6A 4WHUA 5CS8A 4HBWA 4A9HA 5I80A 4J1PA 5EU1A 1WUGA 5E9MA 4UIWA 5I7XA 5HFQA 4MR3A 5EV9A 4FLPA 5DX4A 3O33A 4OGIA 5CY9A 5HQ7A 3RCWA 4LZ2A 4QSPA 4PS5A 3MB3A 2F6JA 5DW2A 2L85A 5I7YA 4O7EA 4E96A 3JVMA 5D3HA 5LUUA 4CLBA 4TU4A 5CRMA 5KO4A 3HMHA 4NR7A 5A5RA 5ETDA 4HXPA 4YADA 5E9VA 5C85A 2GRCA 4RVRA 4IORA 4N3WA 4O70A 5F60A 4LDFA 5HQ5A 4NUDA 5EISA 3U5OA 3UVXA 5A5OA 5CQ3A 4UYDA 4A9JA 4BW3A 5E7DA 5FE9A 2E3KA 5A83A 5DFDA 5BT3A 4A9LA 5E9LA 4QY4A 4DONA 3Q2EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NRB A;  5FE5 A;  4O7B A;  1JM4 B;  5A7C A;  4IOQ A;  4IR3 A;  3O37 A;  1WUM A;  4PTB A;  4QEW A;  3P5O A;  4O7A A;  2LSP B;  5CUD A;  5F36 A;  4YAT A;  5EP7 A;  4TZ8 A;  4O72 A;  2WP2 A;  5CQT A;  5F62 A;  4QST A;  5L97 A;  3P1D A;  5CU8 A;  5HEN A;  2YDW A;  4UYF A;  4KV1 A;  4UIY A;  4QR4 A;  4QC3 A;  2YEM A;  1ZS5 A;  4NR4 A;  5ACY A;  4NRA A;  4YYI A;  4IR5 A;  3ZYU A;  4UYF B;  5A81 A;  5H85 A;  5LVR A;  4N4G A;  2R10 A;  5DLX A;  5FG6 A;  4IOO A;  5IID A;  4MEO A;  4HXL A;  4NR5 A;  4UIT A;  4UIU A;  4PKL A;  4A9F A;  5C7N A;  4F3I A;  2DKW A;  5I40 A;  5FE2 A;  5E3G A;  5CGP A;  5CQ4 A;  4BHW A;  3O36 A;  5ENE A;  4WIV A;  4Z6I A;  5FFV A;  4LR6 A;  5D3P A;  4QNS A;  5FH6 A;  3MUL A;  3UV5 A;  2YQD A;  4NUE A;  4TU6 A;  5EM3 A;  5DBM A;  5DLZ A;  5HEL A;  5CUA A;  4CUP A;  4TTE A;  4YAX A;  2KTB B;  5AMF A;  5EIC A;  5AD2 A;  3U5P A;  4LC2 A;  4YBS A;  5K29 A;  5L99 A;  4YBT A;  5HQ6 A;  4QB3 A;  5A82 A;  3I3J A;  3MUK A;  5EPR A;  4KCX A;  4TT2 A;  4QSU A;  5FH8 A;  5EPS A;  5DYX A;  3HMF A;  5D3N A;  5LKZ A;  4ALH A;  5FFW A;  4O74 A;  4C67 A;  5HCL A;  4NR6 A;  3U5J A;  4QYD A;  3SVG A;  4LZS A;  2DVV A;  4HXM A;  5HJC A;  4NRC A;  2G4A A;  5F5Z A;  5CUG A;  4HXO A;  4LYI A;  2R0V A;  5FBX A;  5D3T A;  5I88 A;  5DY7 A;  4YH3 A;  2R0S A;  5IBN A;  2YEL A;  5CZG A;  4LYS A;  4BW1 A;  3UVD A;  5LKT A;  4MR6 A;  4PCE A;  2DAT A;  5HEM A;  4N4I A;  4NS5 A;  4TZ2 A;  5E0R A;  5II2 A;  3UVW A;  4A9K A;  5C8G A;  5FE8 A;  5I86 A;  5LKX A;  2L84 A;  5ENH A;  2OO1 A;  2N9G A;  5CQ6 A;  5ENB A;  5KTU A;  4Y03 A;  4IR6 A;  5ENI A;  5EK9 A;  4CUU A;  4YK0 A;  3U5L A;  4CUR A;  5HLS A;  3IU6 A;  5CRZ A;  2DVR A;  5CQA A;  4UYE A;  4ZQL A;  5AME A;  3JVK A;  3JVL A;  4N4H A;  3DAI A;  2RO1 A;  4PY6 A;  3U5M A;  5LJ2 A;  3UV4 A;  4NR8 A;  1N72 A;  5L8T A;  3FKM X;  4NQM A;  3K2J A;  5F25 A;  5F3A A;  3UV2 A;  4HXN A;  2RNX A;  3AAD A;  2F6N A;  5DW1 A;  4YYG A;  5I29 A;  4O76 A;  4GPJ A;  5CQ7 A;  5E3D A;  4NR9 A;  2YEK A;  3G0J A;  4A9O A;  2H60 A;  5JWM A;  5L98 A;  4LYW A;  4O7F A;  4NXJ A;  5IGL A;  2FSA A;  5E74 A;  5EVA A;  2WP1 A;  4NYX A;  4LZR A;  2NXB A;  5DYU A;  5C4Q A;  4LRG A;  4OGJ A;  4MEP A;  3SVF A;  5C89 A;  5KTW A;  5A5P A;  5D26 A;  4QSS A;  5EWD A;  3SVH A;  5I83 A;  5ENJ A;  5L8U A;  4QSW A;  5FE1 A;  4HXK A;  1X0J A;  5EGU A;  4YH4 A;  5A5N A;  3NXB A;  5FB0 A;  5AD3 A;  4J3I A;  5TCM A;  5HM0 A;  5D7X A;  5FFY A;  5COI A;  4YYJ A;  5IGN A;  5FE3 A;  5E73 A;  3UVY A;  4A9E A;  5CPE A;  1E6I A;  4YYN A;  4Q0N A;  3QZT A;  5D24 A;  4Q0O A;  5HRV A;  5EQ1 A;  4YAB A;  5EPB A;  5L96 A;  5TB6 A;  5FG4 A;  4YY4 A;  4UIV A;  5FDZ A;  1F68 A;  4HBX A;  5F2P A;  3G0L A;  5EI4 A;  2RS9 B;  5A5Q A;  4QEV A;  4QUU A;  5F63 A;  2E7N A;  3IU5 A;  2OUO A;  5ENF A;  4HBY A;  2D82 A;  5IGM A;  5H1T A;  4A9M A;  4AKN A;  2DVQ A;  5F1H A;  3P1F A;  5I1Q A;  5EWW A;  3DWY A;  4MEN A;  3MXF A;  2RNW A;  4Z1Q A;  3O34 A;  5CQ8 A;  3GG3 A;  3D7C A;  4XY9 A;  4HBV A;  5D25 A;  5JI8 A;  4ZC9 A;  4YC9 A;  5LJ1 A;  5FE4 A;  3JVJ A;  5A5S A;  4J0R A;  5LJ0 A;  4HXR A;  5DKD A;  5EA1 A;  5D3J A;  5HRX A;  2I8N A;  4QSR A;  5E9Y A;  5C87 A;  5F61 A;  4QEU A;  5DFC A;  4ZW1 A;  4Z6H A;  5A85 A;  5FE6 A;  4CL9 A;  5G4S A;  5KHM A;  4TT4 A;  4MR4 A;  4CUT A;  4QUT A;  3AQA A;  4N4F A;  2MJV B;  2I7K A;  4O78 A;  5G4R A;  5CUB A;  5I89 A;  5DKC A;  4OUF A;  3HME A;  4XUB A;  4ALG A;  5ENG A;  5CTL A;  3S91 A;  2D9E A;  4Z93 A;  4C66 A;  2L5E A;  3S92 A;  4QZS A;  4J0S A;  3P1E A;  3LQJ A;  5HRW A;  2OSS A;  5D3L A;  4PCI A;  5LVQ A;  2DVS A;  4O77 A;  2DWW A;  3QZV A;  4TYL A;  4CFL A;  5FG5 A;  4QSV A;  5DYA A;  5J0D A;  4YY6 A;  4YBM A;  3UW9 A;  4O7C A;  5II1 A;  4NYV A;  4QR3 A;  4IR4 A;  4UYH A;  5EWV A;  4XYA A;  5FE0 A;  5H1U A;  5KTX A;  3LXJ A;  4UYG A;  4YYD A;  2YYN A;  1EQF A;  5D3R A;  4NUC A;  5HFR A;  5ENC A;  2YW5 A;  4TQN A;  4A9N A;  4A9I A;  5KU3 A;  1JSP B;  3TLP A;  5IG6 A;  3Q2F A;  5IGK A;  4QYL A;  4Z1S A;  4MR5 A;  5D3S A;  4KV4 A;  4WHW A;  4UIZ A;  3P1C A;  4BW4 A;  4YYM A;  5CFW A;  5BT5 A;  5DFB A;  4TS8 A;  5E9K A;  2RFJ A;  3U5N A;  5ETB A;  5F1L A;  4YYK A;  4CUQ A;  2RI7 A;  4O71 A;  5DYC A;  4BJX A;  4QBM A;  4NQN A;  4QC1 A;  5LKU A;  3LJW A;  4QSQ A;  3LQH A;  5EWC A;  3MB4 A;  5H1V A;  3MQM A;  5FH7 A;  5CUE A;  5CUC A;  4MEQ A;  4BW2 A;  4CUS A;  5CQ5 A;  4X2I A;  3QZS A;  4QR5 A;  5E9I A;  5BT4 A;  5DKH A;  4YYH A;  3LQI A;  4NYW A;  3U5K A;  4CFK A;  5FE7 A;  5CP5 A;  4QSX A;  5FB1 A;  3O35 A;  2E7O A;  2R0Y A;  5D0C A;  3ONI A;  4XUA A;  4UIX A;  5EWH A;  4XY8 A;  4O75 A;  2RNY A;  4HXS A;  4TT6 A;  4WHU A;  5CS8 A;  4HBW A;  4A9H A;  5I80 A;  4J1P A;  5EU1 A;  1WUG A;  5E9M A;  4UIW A;  5I7X A;  5HFQ A;  4MR3 A;  5EV9 A;  4FLP A;  5DX4 A;  3O33 A;  4OGI A;  5CY9 A;  5HQ7 A;  3RCW A;  4LZ2 A;  4QSP A;  4PS5 A;  3MB3 A;  2F6J A;  5DW2 A;  2L85 A;  5I7Y A;  4O7E A;  4E96 A;  3JVM A;  5D3H A;  5LUU A;  4CLB A;  4TU4 A;  5CRM A;  5KO4 A;  3HMH A;  4NR7 A;  5A5R A;  5ETD A;  4HXP A;  4YAD A;  5E9V A;  5C85 A;  2GRC A;  4RVR A;  4IOR A;  4N3W A;  4O70 A;  5F60 A;  4LDF A;  5HQ5 A;  4NUD A;  5EIS A;  3U5O A;  3UVX A;  5A5O A;  5CQ3 A;  4UYD A;  4A9J A;  4BW3 A;  5E7D A;  5FE9 A;  2E3K A;  5A83 A;  5DFD A;  5BT3 A;  4A9L A;  5E9L A;  4QY4 A;  4DON A;  3Q2E A; 
#chains in the Genus database with same CATH topology
 4NRB A;  5FE5 A;  4O7B A;  4AKI A;  1JM4 B;  5A7C A;  4IOQ A;  4IR3 A;  3O37 A;  1WUM A;  4PTB A;  4QEW A;  3P5O A;  4O7A A;  2LSP B;  5CUD A;  5F36 A;  4YAT A;  5EP7 A;  4TZ8 A;  4O72 A;  2WP2 A;  5CQT A;  5F62 A;  4QST A;  5L97 A;  3P1D A;  5CU8 A;  5HEN A;  2YDW A;  4UYF A;  4KV1 A;  4UIY A;  4QR4 A;  4QC3 A;  2YEM A;  1ZS5 A;  4NR4 A;  5ACY A;  4NRA A;  4YYI A;  4IR5 A;  3ZYU A;  4UYF B;  5A81 A;  5H85 A;  5LVR A;  4N4G A;  3VKG A;  2R10 A;  5DLX A;  5FG6 A;  4IOO A;  5IID A;  4MEO A;  4HXL A;  4NR5 A;  4UIT A;  4UIU A;  4PKL A;  4A9F A;  5C7N A;  4F3I A;  2DKW A;  5I40 A;  5FE2 A;  4AKG A;  5E3G A;  5CGP A;  5CQ4 A;  4BHW A;  3O36 A;  5ENE A;  3D1D A;  4WIV A;  4Z6I A;  5FFV A;  4LR6 A;  5D3P A;  4QNS A;  5FH6 A;  3MUL A;  3UV5 A;  2YQD A;  4NUE A;  4TU6 A;  5EM3 A;  5DBM A;  5DLZ A;  5HEL A;  5CUA A;  4CUP A;  4TTE A;  4YAX A;  2KTB B;  5AMF A;  5EIC A;  5AD2 A;  3U5P A;  4LC2 A;  4YBS A;  5K29 A;  5L99 A;  4YBT A;  5HQ6 A;  4QB3 A;  5A82 A;  3I3J A;  3MUK A;  5EPR A;  4KCX A;  4TT2 A;  4QSU A;  5FH8 A;  5EPS A;  5DYX A;  4AKH A;  3HMF A;  5D3N A;  5LKZ A;  4ALH A;  5FFW A;  4O74 A;  4C67 A;  5HCL A;  4NR6 A;  3U5J A;  4QYD A;  3SVG A;  4LZS A;  2DVV A;  1PUO A;  4HXM A;  5HJC A;  4NRC A;  2G4A A;  5F5Z A;  5CUG A;  4HXO A;  4LYI A;  2R0V A;  5FBX A;  5D3T A;  5I88 A;  5DY7 A;  4YH3 A;  2R0S A;  5IBN A;  2YEL A;  5CZG A;  4LYS A;  4BW1 A;  3UVD A;  5LKT A;  4MR6 A;  4PCE A;  2DAT A;  5HEM A;  4N4I A;  4NS5 A;  4TZ2 A;  5E0R A;  5II2 A;  3UVW A;  4A9K A;  5C8G A;  5FE8 A;  5I86 A;  5LKX A;  2L84 A;  5ENH A;  2OO1 A;  2N9G A;  5CQ6 A;  5ENB A;  5KTU A;  4Y03 A;  4IR6 A;  5ENI A;  5EK9 A;  4CUU A;  4YK0 A;  3U5L A;  4CUR A;  5HLS A;  3IU6 A;  5CRZ A;  2EJN A;  2DVR A;  5CQA A;  4UYE A;  4ZQL A;  5AME A;  3JVK A;  3JVL A;  4N4H A;  3DAI A;  2RO1 A;  4PY6 A;  3U5M A;  5LJ2 A;  3UV4 A;  4NR8 A;  1N72 A;  5L8T A;  3FKM X;  4NQM A;  3K2J A;  5F25 A;  5F3A A;  3UV2 A;  4HXN A;  2RNX A;  3AAD A;  2F6N A;  5DW1 A;  4YYG A;  5I29 A;  4O76 A;  4GPJ A;  5CQ7 A;  5E3D A;  4NR9 A;  2YEK A;  3G0J A;  4A9O A;  2H60 A;  5JWM A;  5L98 A;  4LYW A;  4O7F A;  4NXJ A;  5IGL A;  2FSA A;  5E74 A;  5EVA A;  2WP1 A;  4NYX A;  4LZR A;  2NXB A;  5DYU A;  5C4Q A;  4LRG A;  4OGJ A;  4MEP A;  3SVF A;  5C89 A;  5KTW A;  5A5P A;  5D26 A;  4QSS A;  5EWD A;  3SVH A;  5I83 A;  5ENJ A;  5L8U A;  4QSW A;  5FE1 A;  4HXK A;  1X0J A;  5EGU A;  4YH4 A;  5A5N A;  3NXB A;  5FB0 A;  5AD3 A;  4J3I A;  5TCM A;  5HM0 A;  5D7X A;  5FFY A;  5COI A;  4YYJ A;  5IGN A;  5FE3 A;  5E73 A;  3UVY A;  4A9E A;  5CPE A;  1E6I A;  4YYN A;  4Q0N A;  3QZT A;  5D24 A;  4Q0O A;  5HRV A;  5EQ1 A;  4YAB A;  5EPB A;  5L96 A;  5TB6 A;  5FG4 A;  4YY4 A;  4UIV A;  5FDZ A;  1F68 A;  4HBX A;  5F2P A;  3G0L A;  5EI4 A;  2RS9 B;  5A5Q A;  4QEV A;  4QUU A;  5F63 A;  2E7N A;  3IU5 A;  2OUO A;  5ENF A;  4HBY A;  2D82 A;  5IGM A;  5H1T A;  4A9M A;  4AKN A;  2DVQ A;  5F1H A;  3P1F A;  5I1Q A;  5EWW A;  3DWY A;  4MEN A;  3MXF A;  2RNW A;  4Z1Q A;  3O34 A;  5CQ8 A;  3GG3 A;  3D7C A;  4XY9 A;  4HBV A;  5D25 A;  5JI8 A;  4ZC9 A;  4YC9 A;  5LJ1 A;  5FE4 A;  3JVJ A;  5A5S A;  4J0R A;  5LJ0 A;  4HXR A;  5DKD A;  5EA1 A;  5D3J A;  5HRX A;  2I8N A;  4QSR A;  5E9Y A;  5C87 A;  5F61 A;  3D1B A;  4QEU A;  5DFC A;  4ZW1 A;  4Z6H A;  5A85 A;  5FE6 A;  4CL9 A;  3ERR A;  5G4S A;  5KHM A;  4TT4 A;  4MR4 A;  4CUT A;  4QUT A;  3AQA A;  4N4F A;  2MJV B;  2I7K A;  4O78 A;  4AI6 A;  5G4R A;  5CUB A;  5I89 A;  5DKC A;  4OUF A;  3HME A;  4XUB A;  4ALG A;  5ENG A;  5CTL A;  3S91 A;  2D9E A;  4Z93 A;  4C66 A;  2L5E A;  3S92 A;  4QZS A;  4J0S A;  3P1E A;  3LQJ A;  5HRW A;  2OSS A;  5D3L A;  4PCI A;  5LVQ A;  2DVS A;  4O77 A;  2DWW A;  3QZV A;  4TYL A;  4CFL A;  5FG5 A;  4QSV A;  5DYA A;  5J0D A;  4YY6 A;  4YBM A;  3UW9 A;  4O7C A;  5II1 A;  4NYV A;  4QR3 A;  4IR4 A;  4UYH A;  3VKH A;  5EWV A;  4XYA A;  5FE0 A;  5H1U A;  5KTX A;  3LXJ A;  4UYG A;  4YYD A;  2YYN A;  1EQF A;  5D3R A;  4NUC A;  5HFR A;  5ENC A;  2YW5 A;  4TQN A;  4A9N A;  4A9I A;  5KU3 A;  1JSP B;  3TLP A;  5IG6 A;  3Q2F A;  5IGK A;  4QYL A;  4Z1S A;  4MR5 A;  5D3S A;  4KV4 A;  4WHW A;  4UIZ A;  3P1C A;  4BW4 A;  4YYM A;  5CFW A;  5BT5 A;  5DFB A;  4TS8 A;  5E9K A;  2RFJ A;  3U5N A;  5ETB A;  5F1L A;  4YYK A;  4CUQ A;  2RI7 A;  4O71 A;  5DYC A;  4BJX A;  4QBM A;  4NQN A;  4QC1 A;  5LKU A;  3LJW A;  4QSQ A;  3LQH A;  5EWC A;  3MB4 A;  5H1V A;  3MQM A;  5FH7 A;  5CUE A;  5CUC A;  4MEQ A;  4BW2 A;  4CUS A;  5CQ5 A;  4X2I A;  3QZS A;  4QR5 A;  5E9I A;  5BT4 A;  5DKH A;  4YYH A;  3LQI A;  4NYW A;  3U5K A;  4CFK A;  5FE7 A;  5CP5 A;  4QSX A;  5FB1 A;  3O35 A;  2E7O A;  2R0Y A;  5D0C A;  3ONI A;  4XUA A;  4UIX A;  5EWH A;  4XY8 A;  4O75 A;  2RNY A;  4HXS A;  4TT6 A;  4WHU A;  5CS8 A;  4HBW A;  4A9H A;  5I80 A;  4J1P A;  5EU1 A;  1WUG A;  5E9M A;  4UIW A;  5I7X A;  5HFQ A;  4MR3 A;  1ZKR A;  5EV9 A;  4FLP A;  5DX4 A;  3O33 A;  4OGI A;  5CY9 A;  5HQ7 A;  3RCW A;  4LZ2 A;  4QSP A;  4PS5 A;  3MB3 A;  2F6J A;  5DW2 A;  2L85 A;  5I7Y A;  4O7E A;  4E96 A;  3JVM A;  5D3H A;  5LUU A;  4CLB A;  4TU4 A;  5CRM A;  5KO4 A;  3HMH A;  4NR7 A;  5A5R A;  5ETD A;  4HXP A;  4YAD A;  5E9V A;  5C85 A;  2GRC A;  4RVR A;  4IOR A;  4N3W A;  4O70 A;  5F60 A;  4LDF A;  5HQ5 A;  4NUD A;  5EIS A;  3U5O A;  3UVX A;  5A5O A;  5CQ3 A;  4UYD A;  4A9J A;  4BW3 A;  5E7D A;  5FE9 A;  2E3K A;  5A83 A;  5DFD A;  5BT3 A;  4A9L A;  5E9L A;  4QY4 A;  4DON A;  3Q2E A; 
#chains in the Genus database with same CATH homology
 4NRB A;  5FE5 A;  4O7B A;  1JM4 B;  5A7C A;  4IOQ A;  4IR3 A;  3O37 A;  1WUM A;  4PTB A;  4QEW A;  3P5O A;  4O7A A;  2LSP B;  5CUD A;  5F36 A;  4YAT A;  5EP7 A;  4TZ8 A;  4O72 A;  2WP2 A;  5CQT A;  5F62 A;  4QST A;  5L97 A;  3P1D A;  5CU8 A;  5HEN A;  2YDW A;  4UYF A;  4KV1 A;  4UIY A;  4QR4 A;  4QC3 A;  2YEM A;  1ZS5 A;  4NR4 A;  5ACY A;  4NRA A;  4YYI A;  4IR5 A;  3ZYU A;  4UYF B;  5A81 A;  5H85 A;  5LVR A;  4N4G A;  2R10 A;  5DLX A;  5FG6 A;  4IOO A;  5IID A;  4MEO A;  4HXL A;  4NR5 A;  4UIT A;  4UIU A;  4PKL A;  4A9F A;  5C7N A;  4F3I A;  2DKW A;  5I40 A;  5FE2 A;  5E3G A;  5CGP A;  5CQ4 A;  4BHW A;  3O36 A;  5ENE A;  4WIV A;  4Z6I A;  5FFV A;  4LR6 A;  5D3P A;  4QNS A;  5FH6 A;  3MUL A;  3UV5 A;  2YQD A;  4NUE A;  4TU6 A;  5EM3 A;  5DBM A;  5DLZ A;  5HEL A;  5CUA A;  4CUP A;  4TTE A;  4YAX A;  2KTB B;  5AMF A;  5EIC A;  5AD2 A;  3U5P A;  4LC2 A;  4YBS A;  5K29 A;  5L99 A;  4YBT A;  5HQ6 A;  4QB3 A;  5A82 A;  3I3J A;  3MUK A;  5EPR A;  4KCX A;  4TT2 A;  4QSU A;  5FH8 A;  5EPS A;  5DYX A;  3HMF A;  5D3N A;  5LKZ A;  4ALH A;  5FFW A;  4O74 A;  4C67 A;  5HCL A;  4NR6 A;  3U5J A;  4QYD A;  3SVG A;  4LZS A;  2DVV A;  4HXM A;  5HJC A;  4NRC A;  2G4A A;  5F5Z A;  5CUG A;  4HXO A;  4LYI A;  2R0V A;  5FBX A;  5D3T A;  5I88 A;  5DY7 A;  4YH3 A;  2R0S A;  5IBN A;  2YEL A;  5CZG A;  4LYS A;  4BW1 A;  3UVD A;  5LKT A;  4MR6 A;  4PCE A;  2DAT A;  5HEM A;  4N4I A;  4NS5 A;  4TZ2 A;  5E0R A;  5II2 A;  3UVW A;  4A9K A;  5C8G A;  5FE8 A;  5I86 A;  5LKX A;  2L84 A;  5ENH A;  2OO1 A;  2N9G A;  5CQ6 A;  5ENB A;  5KTU A;  4Y03 A;  4IR6 A;  5ENI A;  5EK9 A;  4CUU A;  4YK0 A;  3U5L A;  4CUR A;  5HLS A;  3IU6 A;  5CRZ A;  2DVR A;  5CQA A;  4UYE A;  4ZQL A;  5AME A;  3JVK A;  3JVL A;  4N4H A;  3DAI A;  2RO1 A;  4PY6 A;  3U5M A;  5LJ2 A;  3UV4 A;  4NR8 A;  1N72 A;  5L8T A;  3FKM X;  4NQM A;  3K2J A;  5F25 A;  5F3A A;  3UV2 A;  4HXN A;  2RNX A;  3AAD A;  2F6N A;  5DW1 A;  4YYG A;  5I29 A;  4O76 A;  4GPJ A;  5CQ7 A;  5E3D A;  4NR9 A;  2YEK A;  3G0J A;  4A9O A;  2H60 A;  5JWM A;  5L98 A;  4LYW A;  4O7F A;  4NXJ A;  5IGL A;  2FSA A;  5E74 A;  5EVA A;  2WP1 A;  4NYX A;  4LZR A;  2NXB A;  5DYU A;  5C4Q A;  4LRG A;  4OGJ A;  4MEP A;  3SVF A;  5C89 A;  5KTW A;  5A5P A;  5D26 A;  4QSS A;  5EWD A;  3SVH A;  5I83 A;  5ENJ A;  5L8U A;  4QSW A;  5FE1 A;  4HXK A;  1X0J A;  5EGU A;  4YH4 A;  5A5N A;  3NXB A;  5FB0 A;  5AD3 A;  4J3I A;  5TCM A;  5HM0 A;  5D7X A;  5FFY A;  5COI A;  4YYJ A;  5IGN A;  5FE3 A;  5E73 A;  3UVY A;  4A9E A;  5CPE A;  1E6I A;  4YYN A;  4Q0N A;  3QZT A;  5D24 A;  4Q0O A;  5HRV A;  5EQ1 A;  4YAB A;  5EPB A;  5L96 A;  5TB6 A;  5FG4 A;  4YY4 A;  4UIV A;  5FDZ A;  1F68 A;  4HBX A;  5F2P A;  3G0L A;  5EI4 A;  2RS9 B;  5A5Q A;  4QEV A;  4QUU A;  5F63 A;  2E7N A;  3IU5 A;  2OUO A;  5ENF A;  4HBY A;  2D82 A;  5IGM A;  5H1T A;  4A9M A;  4AKN A;  2DVQ A;  5F1H A;  3P1F A;  5I1Q A;  5EWW A;  3DWY A;  4MEN A;  3MXF A;  2RNW A;  4Z1Q A;  3O34 A;  5CQ8 A;  3GG3 A;  3D7C A;  4XY9 A;  4HBV A;  5D25 A;  5JI8 A;  4ZC9 A;  4YC9 A;  5LJ1 A;  5FE4 A;  3JVJ A;  5A5S A;  4J0R A;  5LJ0 A;  4HXR A;  5DKD A;  5EA1 A;  5D3J A;  5HRX A;  2I8N A;  4QSR A;  5E9Y A;  5C87 A;  5F61 A;  4QEU A;  5DFC A;  4ZW1 A;  4Z6H A;  5A85 A;  5FE6 A;  4CL9 A;  5G4S A;  5KHM A;  4TT4 A;  4MR4 A;  4CUT A;  4QUT A;  3AQA A;  4N4F A;  2MJV B;  2I7K A;  4O78 A;  5G4R A;  5CUB A;  5I89 A;  5DKC A;  4OUF A;  3HME A;  4XUB A;  4ALG A;  5ENG A;  5CTL A;  3S91 A;  2D9E A;  4Z93 A;  4C66 A;  2L5E A;  3S92 A;  4QZS A;  4J0S A;  3P1E A;  3LQJ A;  5HRW A;  2OSS A;  5D3L A;  4PCI A;  5LVQ A;  2DVS A;  4O77 A;  2DWW A;  3QZV A;  4TYL A;  4CFL A;  5FG5 A;  4QSV A;  5DYA A;  5J0D A;  4YY6 A;  4YBM A;  3UW9 A;  4O7C A;  5II1 A;  4NYV A;  4QR3 A;  4IR4 A;  4UYH A;  5EWV A;  4XYA A;  5FE0 A;  5H1U A;  5KTX A;  3LXJ A;  4UYG A;  4YYD A;  2YYN A;  1EQF A;  5D3R A;  4NUC A;  5HFR A;  5ENC A;  2YW5 A;  4TQN A;  4A9N A;  4A9I A;  5KU3 A;  1JSP B;  3TLP A;  5IG6 A;  3Q2F A;  5IGK A;  4QYL A;  4Z1S A;  4MR5 A;  5D3S A;  4KV4 A;  4WHW A;  4UIZ A;  3P1C A;  4BW4 A;  4YYM A;  5CFW A;  5BT5 A;  5DFB A;  4TS8 A;  5E9K A;  2RFJ A;  3U5N A;  5ETB A;  5F1L A;  4YYK A;  4CUQ A;  2RI7 A;  4O71 A;  5DYC A;  4BJX A;  4QBM A;  4NQN A;  4QC1 A;  5LKU A;  3LJW A;  4QSQ A;  3LQH A;  5EWC A;  3MB4 A;  5H1V A;  3MQM A;  5FH7 A;  5CUE A;  5CUC A;  4MEQ A;  4BW2 A;  4CUS A;  5CQ5 A;  4X2I A;  3QZS A;  4QR5 A;  5E9I A;  5BT4 A;  5DKH A;  4YYH A;  3LQI A;  4NYW A;  3U5K A;  4CFK A;  5FE7 A;  5CP5 A;  4QSX A;  5FB1 A;  3O35 A;  2E7O A;  2R0Y A;  5D0C A;  3ONI A;  4XUA A;  4UIX A;  5EWH A;  4XY8 A;  4O75 A;  2RNY A;  4HXS A;  4TT6 A;  4WHU A;  5CS8 A;  4HBW A;  4A9H A;  5I80 A;  4J1P A;  5EU1 A;  1WUG A;  5E9M A;  4UIW A;  5I7X A;  5HFQ A;  4MR3 A;  5EV9 A;  4FLP A;  5DX4 A;  3O33 A;  4OGI A;  5CY9 A;  5HQ7 A;  3RCW A;  4LZ2 A;  4QSP A;  4PS5 A;  3MB3 A;  2F6J A;  5DW2 A;  2L85 A;  5I7Y A;  4O7E A;  4E96 A;  3JVM A;  5D3H A;  5LUU A;  4CLB A;  4TU4 A;  5CRM A;  5KO4 A;  3HMH A;  4NR7 A;  5A5R A;  5ETD A;  4HXP A;  4YAD A;  5E9V A;  5C85 A;  2GRC A;  4RVR A;  4IOR A;  4N3W A;  4O70 A;  5F60 A;  4LDF A;  5HQ5 A;  4NUD A;  5EIS A;  3U5O A;  3UVX A;  5A5O A;  5CQ3 A;  4UYD A;  4A9J A;  4BW3 A;  5E7D A;  5FE9 A;  2E3K A;  5A83 A;  5DFD A;  5BT3 A;  4A9L A;  5E9L A;  4QY4 A;  4DON A;  3Q2E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...