4TU4A

Crystal structure of atad2a bromodomain complexed with 3-(3,5-dimethyl-1,2-oxazol-4-yl)-5-[(phenylsulfonyl)amino]benzoicacid
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
130
structure length
130
Chain Sequence
SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICSNALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ATPase family AAA domain-containing protein 2
publication title Observed bromodomain flexibility reveals histone peptide- and small molecule ligand-compatible forms of ATAD2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 54
structure length 130
sequence length 130
ec nomenclature ec 3.6.1.3: Adenosinetriphosphatase.
pdb deposition date 2014-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4tu4A00
3P1FA 4IORA 4NR6A 4Y03A 4BW1A 5FH8A 4UIWA 4DONA 5D26A 5LJ0A 4UITA 3O33A 5A82A 5L98A 4MEOA 3O37A 2L5EA 5G4RA 5I86A 4TTEA 3LQIA 5KHMA 5F2PA 4XY8A 3IU6A 4A9IA 4CURA 4CUTA 5BT5A 3AADA 5ENCA 5DKHA 4TT2A 5A5RA 4OGJA 3QZTA 5DYXA 5CY9A 4BW2A 5LKUA 5IBNA 3UVDA 4LYSA 4O7AA 4QC3A 4NXJA 5D3TA 5E9YA 2WP2A 5A85A 4TZ2A 4BHWA 4NS5A 4UYFB 4YY6A 3U5OA 3Q2FA 2YW5A 5CPEA 5CQ7A 4YYGA 3JVMA 5E9LA 4A9JA 5A5QA 4HXLA 5CQ6A 5IGNA 5E0RA 4QSSA 4HXKA 2D9EA 5HCLA 4HBWA 5I7YA 2MJVB 5HRXA 4O75A 4NRCA 5L97A 4Z1SA 4O77A 5FE2A 4PKLA 5E9MA 5HEMA 4O7EA 4XUBA 5E7DA 5D3JA 4NR8A 4LR6A 4YH3A 4HXNA 4NUCA 5EI4A 5FE4A 4LZRA 4QSWA 3P5OA 5HFQA 4O7BA 5H1TA 5A7CA 5ENIA 3O35A 5ENFA 5KO4A 4UYHA 3K2JA 2RNYA 4C67A 5LJ1A 4HBYA 5BT3A 5KTUA 4E96A 5CRZA 3U5JA 5DYCA 5E9VA 5ENJA 4YATA 4QR3A 3AQAA 4KCXA 5LVRA 5LUUA 4ALGA 5E9KA 2E7OA 4BW4A 4QEWA 4MENA 3O36A 5AMEA 4TYLA 3MUKA 5C87A 4LZ2A 2OSSA 5CUEA 3MULA 2I8NA 4TZ8A 5EA1A 5F1LA 4YADA 4Z1QA 3MB3A 5L99A 1E6IA 5FBXA 4PCEA 5HQ6A 2YQDA 3MB4A 3D7CA 2RI7A 4YYKA 4NYXA 5FE8A 4Q0OA 5IGKA 5FE9A 2DVRA 3O34A 5D25A 4QR5A 5FG4A 4HXOA 4A9KA 2DVSA 4QZSA 5D0CA 2L84A 4N4GA 4TU4A 4QYDA 2E3KA 3GG3A 4QSXA 5HJCA 4MEPA 5I89A 3UW9A 4XUAA 5DFCA 4HXMA 2DWWA 5CU8A 3U5NA 4Z6HA 5C4QA 5II2A 5II1A 4MR3A 5D3RA 5DW2A 5FG5A 5DLZA 2KTBB 3LXJA 5L96A 4YBMA 4LZSA 4IOOA 4RVRA 5HM0A 5LVQA 5FB1A 4YYIA 4QSVA 5F5ZA 3G0LA 4NR4A 1N72A 4J0SA 5ENHA 4PY6A 4X2IA 4LRGA 4UYFA 5FE3A 4YY4A 2N9GA 5EP7A 3JVJA 4PCIA 5EQ1A 5HQ5A 4QB3A 5CS8A 5I40A 5LKZA 4O7FA 4N4FA 4IR4A 5EWDA 5EU1A 5H1UA 4UYGA 2RFJA 4C66A 4IOQA 1EQFA 5I29A 5DBMA 5A5SA 4HBVA 3ZYUA 4O70A 5FE1A 5CQ5A 3FKMX 1WUMA 5ETDA 4HBXA 4HXRA 5HQ7A 4UIZA 5DFBA 4MR6A 3UV2A 5DX4A 4QSQA 2R0SA 3HMHA 2E7NA 4YBTA 4NR7A 4TT6A 2F6NA 4MR5A 3LQHA 5ENBA 4NUDA 5COIA 3SVGA 2RNXA 5CUGA 2R10A 5E3DA 5F61A 4UIVA 5DW1A 5F25A 5FE7A 3LJWA 2YDWA 5CFWA 5E9IA 5AD3A 2OUOA 4A9HA 5HLSA 5LKTA 4IR5A 4QSTA 5F62A 5EWWA 2GRCA 2YEMA 4YYDA 5I83A 4QUUA 5TB6A 4LC2A 3HMEA 5A5OA 5ENGA 3P1EA 4YAXA 5EPBA 2RS9B 2D82A 5FFYA 5F3AA 4Z6IA 4QC1A 2OO1A 5EVAA 3UVWA 5CUAA 5CGPA 5HELA 5JWMA 5HFRA 2R0VA 2DVQA 2L85A 4CUQA 4J3IA 1ZS5A 5DFDA 5FB0A 3MQMA 1JSPB 5HRVA 5IGLA 4NR9A 5J0DA 4F3IA 5E74A 3QZSA 2I7KA 4HXSA 5DYAA 4OUFA 4LYWA 5BT4A 3HMFA 5DYUA 4GPJA 3TLPA 5IIDA 3SVHA 1F68A 2NXBA 4QSUA 3P1DA 5IG6A 4A9FA 4CUSA 4WIVA 4PTBA 4YH4A 4NR5A 5KTWA 3U5PA 4NQMA 2F6JA 5L8UA 5FH7A 5AMFA 5CTLA 5FFVA 5EV9A 3S91A 5F63A 4CL9A 1WUGA 4O74A 5EISA 3DWYA 4UIXA 5D7XA 4QY4A 5EPRA 3IU5A 5F60A 4NRAA 5TCMA 2DVVA 5E3GA 4NRBA 4LYIA 5D3SA 4QEUA 4N4HA 4A9MA 4NUEA 4OGIA 3QZVA 4UYDA 5I80A 4XYAA 3I3JA 4QYLA 3NXBA 3JVLA 5I88A 2WP1A 2RNWA 4ALHA 4FLPA 4WHUA 5H1VA 5FDZA 5F1HA 5A83A 4O71A 3Q2EA 2RO1A 5D3NA 3JVKA 5H85A 4CUUA 5CUDA 4ZW1A 5K29A 4MR4A 4O7CA 4QEVA 4KV4A 5EM3A 4YABA 5EICA 2DATA 5F36A 5FE6A 5CZGA 5JI8A 4XY9A 3UVXA 2YEKA 2DKWA 4BW3A 4Q0NA 4TS8A 5FE5A 2LSPB 3G0JA 4NYVA 3U5MA 5A5NA 5LJ2A 5EWVA 5AD2A 5C85A 4QR4A 5ETBA 5KTXA 4NYWA 5CP5A 2H60A 4NQNA 4CFLA 4J1PA 5C8GA 5I7XA 2YYNA 3DAIA 4YC9A 3P1CA 5DKCA 4CFKA 4YYNA 4UYEA 5EK9A 3U5LA 3MXFA 3UV4A 4CLBA 4YYMA 5FG6A 4YK0A 5KU3A 5D24A 1JM4B 4J0RA 5CQ3A 4CUPA 5HRWA 2R0YA 4BJXA 5C7NA 5L8TA 2YELA 5EWHA 4PS5A 4QSRA 5CQ4A 5G4SA 4YYJA 5CQTA 4IR6A 5CQAA 4O76A 5FE0A 3LQJA 5DLXA 4KV1A 1X0JA 5D3PA 5CUCA 4MEQA 4QSPA 5HENA 5ACYA 4O72A 4TT4A 3S92A 3UVYA 5IGMA 4QNSA 5DKDA 4TQNA 5DY7A 5CUBA 4Z93A 2G4AA 5EPSA 4QBMA 4QUTA 4TU6A 4ZQLA 4A9EA 5I1QA 3U5KA 5A5PA 3ONIA 4IR3A 5E73A 4A9OA 5CQ8A 5D3HA 4WHWA 5D3LA 4AKNA 4YBSA 3UV5A 4HXPA 4UIYA 3SVFA 5FH6A 3RCWA 4YYHA 5ENEA 5CRMA 5LKXA 5C89A 4LDFA 4A9NA 5EWCA 4N3WA 5EGUA 4N4IA 4UIUA 5A81A 2FSAA 5FFWA 4ZC9A 4A9LA 4O78A
chains in the Genus database with same CATH superfamily
3P1FA 4IORA 4NR6A 4Y03A 4BW1A 5FH8A 4UIWA 4DONA 5D26A 5LJ0A 4UITA 3O33A 5A82A 5L98A 4MEOA 3O37A 2L5EA 5G4RA 5I86A 4TTEA 3LQIA 5KHMA 5F2PA 4XY8A 3IU6A 4A9IA 4CURA 4CUTA 5BT5A 3AADA 5ENCA 5DKHA 4TT2A 5A5RA 4OGJA 3QZTA 5DYXA 5CY9A 3ERRA 4BW2A 5LKUA 5IBNA 3UVDA 4LYSA 4O7AA 4QC3A 4NXJA 5D3TA 5E9YA 4AI6A 2WP2A 5A85A 4TZ2A 4BHWA 4NS5A 4UYFB 4YY6A 3U5OA 3Q2FA 2YW5A 5CPEA 5CQ7A 4YYGA 3JVMA 5E9LA 4A9JA 5A5QA 4HXLA 5CQ6A 5IGNA 5E0RA 4QSSA 4HXKA 2D9EA 5HCLA 4HBWA 5I7YA 2MJVB 5HRXA 4O75A 4NRCA 5L97A 4Z1SA 4O77A 5FE2A 4PKLA 5E9MA 5HEMA 4O7EA 4XUBA 5E7DA 5D3JA 4NR8A 4LR6A 4YH3A 4HXNA 4NUCA 5EI4A 5FE4A 4LZRA 4QSWA 3P5OA 5HFQA 4O7BA 5H1TA 5A7CA 5ENIA 3O35A 5ENFA 5KO4A 4UYHA 3K2JA 2RNYA 4C67A 5LJ1A 4HBYA 5BT3A 5KTUA 4E96A 5CRZA 3U5JA 5DYCA 5E9VA 5ENJA 4YATA 4QR3A 3AQAA 4KCXA 5LVRA 5LUUA 4ALGA 5E9KA 2E7OA 4BW4A 4QEWA 4MENA 3O36A 5AMEA 4TYLA 3MUKA 5C87A 4LZ2A 2OSSA 5CUEA 3MULA 2I8NA 4TZ8A 5EA1A 5F1LA 4YADA 4Z1QA 3MB3A 5L99A 1E6IA 5FBXA 4PCEA 5HQ6A 2YQDA 3MB4A 3D7CA 2RI7A 4YYKA 4NYXA 5FE8A 4Q0OA 5IGKA 5FE9A 2DVRA 3O34A 5D25A 4QR5A 5FG4A 4HXOA 4A9KA 2DVSA 4QZSA 5D0CA 2L84A 4N4GA 4TU4A 4QYDA 2E3KA 3GG3A 4QSXA 5HJCA 4MEPA 5I89A 3UW9A 4XUAA 5DFCA 4HXMA 2DWWA 5CU8A 3U5NA 4Z6HA 5C4QA 5II2A 5II1A 4MR3A 5D3RA 5DW2A 5FG5A 5DLZA 2KTBB 3LXJA 5L96A 4YBMA 4LZSA 4IOOA 4RVRA 5HM0A 5LVQA 5FB1A 4YYIA 4QSVA 5F5ZA 3G0LA 4NR4A 1N72A 4J0SA 5ENHA 4PY6A 4X2IA 4LRGA 4UYFA 5FE3A 4YY4A 2N9GA 5EP7A 3JVJA 4PCIA 5EQ1A 5HQ5A 4QB3A 5CS8A 5I40A 5LKZA 4O7FA 4N4FA 4IR4A 5EWDA 5EU1A 5H1UA 4UYGA 2RFJA 4C66A 4IOQA 1EQFA 5I29A 5DBMA 5A5SA 4HBVA 3ZYUA 4O70A 5FE1A 4AKHA 5CQ5A 3FKMX 1WUMA 5ETDA 4HBXA 4HXRA 5HQ7A 4UIZA 5DFBA 4MR6A 3UV2A 5DX4A 4QSQA 2R0SA 3D1DA 3HMHA 2E7NA 4YBTA 4NR7A 4TT6A 2F6NA 4MR5A 3LQHA 5ENBA 4NUDA 5COIA 3SVGA 2RNXA 5CUGA 2R10A 5E3DA 5F61A 4UIVA 5DW1A 5F25A 5FE7A 3LJWA 2YDWA 3VKGA 5CFWA 5E9IA 5AD3A 2OUOA 4A9HA 5HLSA 5LKTA 4IR5A 4QSTA 5F62A 5EWWA 2GRCA 2YEMA 4YYDA 5I83A 4QUUA 5TB6A 4LC2A 3HMEA 5A5OA 5ENGA 3P1EA 4YAXA 5EPBA 3VKHA 2RS9B 2D82A 5FFYA 5F3AA 4Z6IA 4QC1A 2OO1A 5EVAA 3UVWA 5CUAA 5CGPA 5HELA 5JWMA 5HFRA 2R0VA 2DVQA 2L85A 4CUQA 4J3IA 1ZS5A 5DFDA 5FB0A 1ZKRA 3MQMA 1JSPB 5HRVA 5IGLA 4NR9A 5J0DA 4F3IA 5E74A 3QZSA 2I7KA 4HXSA 5DYAA 4OUFA 4LYWA 5BT4A 1PUOA 3HMFA 5DYUA 4GPJA 3TLPA 5IIDA 3SVHA 1F68A 2NXBA 4QSUA 3P1DA 5IG6A 4A9FA 4CUSA 4WIVA 4PTBA 4YH4A 4NR5A 5KTWA 3U5PA 4NQMA 2F6JA 5L8UA 5FH7A 5AMFA 5CTLA 5FFVA 5EV9A 3S91A 5F63A 4CL9A 1WUGA 4O74A 5EISA 3DWYA 4UIXA 5D7XA 4QY4A 5EPRA 3IU5A 5F60A 4NRAA 5TCMA 2DVVA 5E3GA 4NRBA 4LYIA 5D3SA 4AKGA 4QEUA 4N4HA 4A9MA 4NUEA 4OGIA 3QZVA 4UYDA 5I80A 4XYAA 3I3JA 4QYLA 3NXBA 3JVLA 5I88A 2WP1A 2RNWA 4ALHA 4FLPA 4WHUA 5H1VA 5FDZA 5F1HA 5A83A 4O71A 3Q2EA 2RO1A 5D3NA 3JVKA 5H85A 4CUUA 5CUDA 4ZW1A 5K29A 4MR4A 4O7CA 4QEVA 4KV4A 5EM3A 4YABA 5EICA 2DATA 5F36A 5FE6A 5CZGA 5JI8A 4XY9A 3UVXA 2YEKA 2DKWA 4BW3A 4Q0NA 4TS8A 5FE5A 2LSPB 3G0JA 4NYVA 3U5MA 5A5NA 5LJ2A 5EWVA 5AD2A 5C85A 4QR4A 5ETBA 5KTXA 4NYWA 5CP5A 2H60A 4NQNA 4CFLA 4J1PA 5C8GA 5I7XA 2YYNA 3DAIA 4YC9A 3P1CA 5DKCA 4CFKA 4YYNA 4UYEA 5EK9A 3U5LA 3MXFA 3UV4A 4CLBA 4YYMA 5FG6A 4YK0A 5KU3A 5D24A 1JM4B 4J0RA 2EJNA 5CQ3A 4CUPA 5HRWA 2R0YA 4BJXA 5C7NA 5L8TA 2YELA 5EWHA 4PS5A 4QSRA 5CQ4A 5G4SA 4YYJA 5CQTA 4IR6A 4AKIA 5CQAA 4O76A 5FE0A 3LQJA 5DLXA 4KV1A 1X0JA 5D3PA 5CUCA 4MEQA 4QSPA 5HENA 5ACYA 4O72A 4TT4A 3S92A 3UVYA 5IGMA 4QNSA 5DKDA 4TQNA 5DY7A 5CUBA 4Z93A 2G4AA 5EPSA 4QBMA 4QUTA 4TU6A 4ZQLA 4A9EA 5I1QA 3U5KA 5A5PA 3ONIA 4IR3A 5E73A 4A9OA 5CQ8A 5D3HA 4WHWA 5D3LA 4AKNA 4YBSA 3UV5A 4HXPA 4UIYA 3SVFA 5FH6A 3RCWA 4YYHA 5ENEA 5CRMA 5LKXA 5C89A 4LDFA 4A9NA 5EWCA 4N3WA 5EGUA 4N4IA 3D1BA 4UIUA 5A81A 2FSAA 5FFWA 4ZC9A 4A9LA 4O78A
chains in the Genus database with same CATH topology
3P1FA 4IORA 4NR6A 4Y03A 4BW1A 5FH8A 4UIWA 4DONA 5D26A 5LJ0A 4UITA 3O33A 5A82A 5L98A 4MEOA 3O37A 2L5EA 5G4RA 5I86A 4TTEA 3LQIA 5KHMA 5F2PA 4XY8A 3IU6A 4A9IA 4CURA 4CUTA 5BT5A 3AADA 5ENCA 5DKHA 4TT2A 5A5RA 4OGJA 3QZTA 5DYXA 5CY9A 4BW2A 5LKUA 5IBNA 3UVDA 4LYSA 4O7AA 4QC3A 4NXJA 5D3TA 5E9YA 2WP2A 5A85A 4TZ2A 4BHWA 4NS5A 4UYFB 4YY6A 3U5OA 3Q2FA 2YW5A 5CPEA 5CQ7A 4YYGA 3JVMA 5E9LA 4A9JA 5A5QA 4HXLA 5CQ6A 5IGNA 5E0RA 4QSSA 4HXKA 2D9EA 5HCLA 4HBWA 5I7YA 2MJVB 5HRXA 4O75A 4NRCA 5L97A 4Z1SA 4O77A 5FE2A 4PKLA 5E9MA 5HEMA 4O7EA 4XUBA 5E7DA 5D3JA 4NR8A 4LR6A 4YH3A 4HXNA 4NUCA 5EI4A 5FE4A 4LZRA 4QSWA 3P5OA 5HFQA 4O7BA 5H1TA 5A7CA 5ENIA 3O35A 5ENFA 5KO4A 4UYHA 3K2JA 2RNYA 4C67A 5LJ1A 4HBYA 5BT3A 5KTUA 4E96A 5CRZA 3U5JA 5DYCA 5E9VA 5ENJA 4YATA 4QR3A 3AQAA 4KCXA 5LVRA 5LUUA 4ALGA 5E9KA 2E7OA 4BW4A 4QEWA 4MENA 3O36A 5AMEA 4TYLA 3MUKA 5C87A 4LZ2A 2OSSA 5CUEA 3MULA 2I8NA 4TZ8A 5EA1A 5F1LA 4YADA 4Z1QA 3MB3A 5L99A 1E6IA 5FBXA 4PCEA 5HQ6A 2YQDA 3MB4A 3D7CA 2RI7A 4YYKA 4NYXA 5FE8A 4Q0OA 5IGKA 5FE9A 2DVRA 3O34A 5D25A 4QR5A 5FG4A 4HXOA 4A9KA 2DVSA 4QZSA 5D0CA 2L84A 4N4GA 4TU4A 4QYDA 2E3KA 3GG3A 4QSXA 5HJCA 4MEPA 5I89A 3UW9A 4XUAA 5DFCA 4HXMA 2DWWA 5CU8A 3U5NA 4Z6HA 5C4QA 5II2A 5II1A 4MR3A 5D3RA 5DW2A 5FG5A 5DLZA 2KTBB 3LXJA 5L96A 4YBMA 4LZSA 4IOOA 4RVRA 5HM0A 5LVQA 5FB1A 4YYIA 4QSVA 5F5ZA 3G0LA 4NR4A 1N72A 4J0SA 5ENHA 4PY6A 4X2IA 4LRGA 4UYFA 5FE3A 4YY4A 2N9GA 5EP7A 3JVJA 4PCIA 5EQ1A 5HQ5A 4QB3A 5CS8A 5I40A 5LKZA 4O7FA 4N4FA 4IR4A 5EWDA 5EU1A 5H1UA 4UYGA 2RFJA 4C66A 4IOQA 1EQFA 5I29A 5DBMA 5A5SA 4HBVA 3ZYUA 4O70A 5FE1A 5CQ5A 3FKMX 1WUMA 5ETDA 4HBXA 4HXRA 5HQ7A 4UIZA 5DFBA 4MR6A 3UV2A 5DX4A 4QSQA 2R0SA 3HMHA 2E7NA 4YBTA 4NR7A 4TT6A 2F6NA 4MR5A 3LQHA 5ENBA 4NUDA 5COIA 3SVGA 2RNXA 5CUGA 2R10A 5E3DA 5F61A 4UIVA 5DW1A 5F25A 5FE7A 3LJWA 2YDWA 5CFWA 5E9IA 5AD3A 2OUOA 4A9HA 5HLSA 5LKTA 4IR5A 4QSTA 5F62A 5EWWA 2GRCA 2YEMA 4YYDA 5I83A 4QUUA 5TB6A 4LC2A 3HMEA 5A5OA 5ENGA 3P1EA 4YAXA 5EPBA 2RS9B 2D82A 5FFYA 5F3AA 4Z6IA 4QC1A 2OO1A 5EVAA 3UVWA 5CUAA 5CGPA 5HELA 5JWMA 5HFRA 2R0VA 2DVQA 2L85A 4CUQA 4J3IA 1ZS5A 5DFDA 5FB0A 3MQMA 1JSPB 5HRVA 5IGLA 4NR9A 5J0DA 4F3IA 5E74A 3QZSA 2I7KA 4HXSA 5DYAA 4OUFA 4LYWA 5BT4A 3HMFA 5DYUA 4GPJA 3TLPA 5IIDA 3SVHA 1F68A 2NXBA 4QSUA 3P1DA 5IG6A 4A9FA 4CUSA 4WIVA 4PTBA 4YH4A 4NR5A 5KTWA 3U5PA 4NQMA 2F6JA 5L8UA 5FH7A 5AMFA 5CTLA 5FFVA 5EV9A 3S91A 5F63A 4CL9A 1WUGA 4O74A 5EISA 3DWYA 4UIXA 5D7XA 4QY4A 5EPRA 3IU5A 5F60A 4NRAA 5TCMA 2DVVA 5E3GA 4NRBA 4LYIA 5D3SA 4QEUA 4N4HA 4A9MA 4NUEA 4OGIA 3QZVA 4UYDA 5I80A 4XYAA 3I3JA 4QYLA 3NXBA 3JVLA 5I88A 2WP1A 2RNWA 4ALHA 4FLPA 4WHUA 5H1VA 5FDZA 5F1HA 5A83A 4O71A 3Q2EA 2RO1A 5D3NA 3JVKA 5H85A 4CUUA 5CUDA 4ZW1A 5K29A 4MR4A 4O7CA 4QEVA 4KV4A 5EM3A 4YABA 5EICA 2DATA 5F36A 5FE6A 5CZGA 5JI8A 4XY9A 3UVXA 2YEKA 2DKWA 4BW3A 4Q0NA 4TS8A 5FE5A 2LSPB 3G0JA 4NYVA 3U5MA 5A5NA 5LJ2A 5EWVA 5AD2A 5C85A 4QR4A 5ETBA 5KTXA 4NYWA 5CP5A 2H60A 4NQNA 4CFLA 4J1PA 5C8GA 5I7XA 2YYNA 3DAIA 4YC9A 3P1CA 5DKCA 4CFKA 4YYNA 4UYEA 5EK9A 3U5LA 3MXFA 3UV4A 4CLBA 4YYMA 5FG6A 4YK0A 5KU3A 5D24A 1JM4B 4J0RA 5CQ3A 4CUPA 5HRWA 2R0YA 4BJXA 5C7NA 5L8TA 2YELA 5EWHA 4PS5A 4QSRA 5CQ4A 5G4SA 4YYJA 5CQTA 4IR6A 5CQAA 4O76A 5FE0A 3LQJA 5DLXA 4KV1A 1X0JA 5D3PA 5CUCA 4MEQA 4QSPA 5HENA 5ACYA 4O72A 4TT4A 3S92A 3UVYA 5IGMA 4QNSA 5DKDA 4TQNA 5DY7A 5CUBA 4Z93A 2G4AA 5EPSA 4QBMA 4QUTA 4TU6A 4ZQLA 4A9EA 5I1QA 3U5KA 5A5PA 3ONIA 4IR3A 5E73A 4A9OA 5CQ8A 5D3HA 4WHWA 5D3LA 4AKNA 4YBSA 3UV5A 4HXPA 4UIYA 3SVFA 5FH6A 3RCWA 4YYHA 5ENEA 5CRMA 5LKXA 5C89A 4LDFA 4A9NA 5EWCA 4N3WA 5EGUA 4N4IA 4UIUA 5A81A 2FSAA 5FFWA 4ZC9A 4A9LA 4O78A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P1F A;  4IOR A;  4NR6 A;  4Y03 A;  4BW1 A;  5FH8 A;  4UIW A;  4DON A;  5D26 A;  5LJ0 A;  4UIT A;  3O33 A;  5A82 A;  5L98 A;  4MEO A;  3O37 A;  2L5E A;  5G4R A;  5I86 A;  4TTE A;  3LQI A;  5KHM A;  5F2P A;  4XY8 A;  3IU6 A;  4A9I A;  4CUR A;  4CUT A;  5BT5 A;  3AAD A;  5ENC A;  5DKH A;  4TT2 A;  5A5R A;  4OGJ A;  3QZT A;  5DYX A;  5CY9 A;  4BW2 A;  5LKU A;  5IBN A;  3UVD A;  4LYS A;  4O7A A;  4QC3 A;  4NXJ A;  5D3T A;  5E9Y A;  2WP2 A;  5A85 A;  4TZ2 A;  4BHW A;  4NS5 A;  4UYF B;  4YY6 A;  3U5O A;  3Q2F A;  2YW5 A;  5CPE A;  5CQ7 A;  4YYG A;  3JVM A;  5E9L A;  4A9J A;  5A5Q A;  4HXL A;  5CQ6 A;  5IGN A;  5E0R A;  4QSS A;  4HXK A;  2D9E A;  5HCL A;  4HBW A;  5I7Y A;  2MJV B;  5HRX A;  4O75 A;  4NRC A;  5L97 A;  4Z1S A;  4O77 A;  5FE2 A;  4PKL A;  5E9M A;  5HEM A;  4O7E A;  4XUB A;  5E7D A;  5D3J A;  4NR8 A;  4LR6 A;  4YH3 A;  4HXN A;  4NUC A;  5EI4 A;  5FE4 A;  4LZR A;  4QSW A;  3P5O A;  5HFQ A;  4O7B A;  5H1T A;  5A7C A;  5ENI A;  3O35 A;  5ENF A;  5KO4 A;  4UYH A;  3K2J A;  2RNY A;  4C67 A;  5LJ1 A;  4HBY A;  5BT3 A;  5KTU A;  4E96 A;  5CRZ A;  3U5J A;  5DYC A;  5E9V A;  5ENJ A;  4YAT A;  4QR3 A;  3AQA A;  4KCX A;  5LVR A;  5LUU A;  4ALG A;  5E9K A;  2E7O A;  4BW4 A;  4QEW A;  4MEN A;  3O36 A;  5AME A;  4TYL A;  3MUK A;  5C87 A;  4LZ2 A;  2OSS A;  5CUE A;  3MUL A;  2I8N A;  4TZ8 A;  5EA1 A;  5F1L A;  4YAD A;  4Z1Q A;  3MB3 A;  5L99 A;  1E6I A;  5FBX A;  4PCE A;  5HQ6 A;  2YQD A;  3MB4 A;  3D7C A;  2RI7 A;  4YYK A;  4NYX A;  5FE8 A;  4Q0O A;  5IGK A;  5FE9 A;  2DVR A;  3O34 A;  5D25 A;  4QR5 A;  5FG4 A;  4HXO A;  4A9K A;  2DVS A;  4QZS A;  5D0C A;  2L84 A;  4N4G A;  4TU4 A;  4QYD A;  2E3K A;  3GG3 A;  4QSX A;  5HJC A;  4MEP A;  5I89 A;  3UW9 A;  4XUA A;  5DFC A;  4HXM A;  2DWW A;  5CU8 A;  3U5N A;  4Z6H A;  5C4Q A;  5II2 A;  5II1 A;  4MR3 A;  5D3R A;  5DW2 A;  5FG5 A;  5DLZ A;  2KTB B;  3LXJ A;  5L96 A;  4YBM A;  4LZS A;  4IOO A;  4RVR A;  5HM0 A;  5LVQ A;  5FB1 A;  4YYI A;  4QSV A;  5F5Z A;  3G0L A;  4NR4 A;  1N72 A;  4J0S A;  5ENH A;  4PY6 A;  4X2I A;  4LRG A;  4UYF A;  5FE3 A;  4YY4 A;  2N9G A;  5EP7 A;  3JVJ A;  4PCI A;  5EQ1 A;  5HQ5 A;  4QB3 A;  5CS8 A;  5I40 A;  5LKZ A;  4O7F A;  4N4F A;  4IR4 A;  5EWD A;  5EU1 A;  5H1U A;  4UYG A;  2RFJ A;  4C66 A;  4IOQ A;  1EQF A;  5I29 A;  5DBM A;  5A5S A;  4HBV A;  3ZYU A;  4O70 A;  5FE1 A;  5CQ5 A;  3FKM X;  1WUM A;  5ETD A;  4HBX A;  4HXR A;  5HQ7 A;  4UIZ A;  5DFB A;  4MR6 A;  3UV2 A;  5DX4 A;  4QSQ A;  2R0S A;  3HMH A;  2E7N A;  4YBT A;  4NR7 A;  4TT6 A;  2F6N A;  4MR5 A;  3LQH A;  5ENB A;  4NUD A;  5COI A;  3SVG A;  2RNX A;  5CUG A;  2R10 A;  5E3D A;  5F61 A;  4UIV A;  5DW1 A;  5F25 A;  5FE7 A;  3LJW A;  2YDW A;  5CFW A;  5E9I A;  5AD3 A;  2OUO A;  4A9H A;  5HLS A;  5LKT A;  4IR5 A;  4QST A;  5F62 A;  5EWW A;  2GRC A;  2YEM A;  4YYD A;  5I83 A;  4QUU A;  5TB6 A;  4LC2 A;  3HME A;  5A5O A;  5ENG A;  3P1E A;  4YAX A;  5EPB A;  2RS9 B;  2D82 A;  5FFY A;  5F3A A;  4Z6I A;  4QC1 A;  2OO1 A;  5EVA A;  3UVW A;  5CUA A;  5CGP A;  5HEL A;  5JWM A;  5HFR A;  2R0V A;  2DVQ A;  2L85 A;  4CUQ A;  4J3I A;  1ZS5 A;  5DFD A;  5FB0 A;  3MQM A;  1JSP B;  5HRV A;  5IGL A;  4NR9 A;  5J0D A;  4F3I A;  5E74 A;  3QZS A;  2I7K A;  4HXS A;  5DYA A;  4OUF A;  4LYW A;  5BT4 A;  3HMF A;  5DYU A;  4GPJ A;  3TLP A;  5IID A;  3SVH A;  1F68 A;  2NXB A;  4QSU A;  3P1D A;  5IG6 A;  4A9F A;  4CUS A;  4WIV A;  4PTB A;  4YH4 A;  4NR5 A;  5KTW A;  3U5P A;  4NQM A;  2F6J A;  5L8U A;  5FH7 A;  5AMF A;  5CTL A;  5FFV A;  5EV9 A;  3S91 A;  5F63 A;  4CL9 A;  1WUG A;  4O74 A;  5EIS A;  3DWY A;  4UIX A;  5D7X A;  4QY4 A;  5EPR A;  3IU5 A;  5F60 A;  4NRA A;  5TCM A;  2DVV A;  5E3G A;  4NRB A;  4LYI A;  5D3S A;  4QEU A;  4N4H A;  4A9M A;  4NUE A;  4OGI A;  3QZV A;  4UYD A;  5I80 A;  4XYA A;  3I3J A;  4QYL A;  3NXB A;  3JVL A;  5I88 A;  2WP1 A;  2RNW A;  4ALH A;  4FLP A;  4WHU A;  5H1V A;  5FDZ A;  5F1H A;  5A83 A;  4O71 A;  3Q2E A;  2RO1 A;  5D3N A;  3JVK A;  5H85 A;  4CUU A;  5CUD A;  4ZW1 A;  5K29 A;  4MR4 A;  4O7C A;  4QEV A;  4KV4 A;  5EM3 A;  4YAB A;  5EIC A;  2DAT A;  5F36 A;  5FE6 A;  5CZG A;  5JI8 A;  4XY9 A;  3UVX A;  2YEK A;  2DKW A;  4BW3 A;  4Q0N A;  4TS8 A;  5FE5 A;  2LSP B;  3G0J A;  4NYV A;  3U5M A;  5A5N A;  5LJ2 A;  5EWV A;  5AD2 A;  5C85 A;  4QR4 A;  5ETB A;  5KTX A;  4NYW A;  5CP5 A;  2H60 A;  4NQN A;  4CFL A;  4J1P A;  5C8G A;  5I7X A;  2YYN A;  3DAI A;  4YC9 A;  3P1C A;  5DKC A;  4CFK A;  4YYN A;  4UYE A;  5EK9 A;  3U5L A;  3MXF A;  3UV4 A;  4CLB A;  4YYM A;  5FG6 A;  4YK0 A;  5KU3 A;  5D24 A;  1JM4 B;  4J0R A;  5CQ3 A;  4CUP A;  5HRW A;  2R0Y A;  4BJX A;  5C7N A;  5L8T A;  2YEL A;  5EWH A;  4PS5 A;  4QSR A;  5CQ4 A;  5G4S A;  4YYJ A;  5CQT A;  4IR6 A;  5CQA A;  4O76 A;  5FE0 A;  3LQJ A;  5DLX A;  4KV1 A;  1X0J A;  5D3P A;  5CUC A;  4MEQ A;  4QSP A;  5HEN A;  5ACY A;  4O72 A;  4TT4 A;  3S92 A;  3UVY A;  5IGM A;  4QNS A;  5DKD A;  4TQN A;  5DY7 A;  5CUB A;  4Z93 A;  2G4A A;  5EPS A;  4QBM A;  4QUT A;  4TU6 A;  4ZQL A;  4A9E A;  5I1Q A;  3U5K A;  5A5P A;  3ONI A;  4IR3 A;  5E73 A;  4A9O A;  5CQ8 A;  5D3H A;  4WHW A;  5D3L A;  4AKN A;  4YBS A;  3UV5 A;  4HXP A;  4UIY A;  3SVF A;  5FH6 A;  3RCW A;  4YYH A;  5ENE A;  5CRM A;  5LKX A;  5C89 A;  4LDF A;  4A9N A;  5EWC A;  4N3W A;  5EGU A;  4N4I A;  4UIU A;  5A81 A;  2FSA A;  5FFW A;  4ZC9 A;  4A9L A;  4O78 A; 
#chains in the Genus database with same CATH topology
 3P1F A;  4IOR A;  4NR6 A;  4Y03 A;  4BW1 A;  5FH8 A;  4UIW A;  4DON A;  5D26 A;  5LJ0 A;  4UIT A;  3O33 A;  5A82 A;  5L98 A;  4MEO A;  3O37 A;  2L5E A;  5G4R A;  5I86 A;  4TTE A;  3LQI A;  5KHM A;  5F2P A;  4XY8 A;  3IU6 A;  4A9I A;  4CUR A;  4CUT A;  5BT5 A;  3AAD A;  5ENC A;  5DKH A;  4TT2 A;  5A5R A;  4OGJ A;  3QZT A;  5DYX A;  5CY9 A;  3ERR A;  4BW2 A;  5LKU A;  5IBN A;  3UVD A;  4LYS A;  4O7A A;  4QC3 A;  4NXJ A;  5D3T A;  5E9Y A;  4AI6 A;  2WP2 A;  5A85 A;  4TZ2 A;  4BHW A;  4NS5 A;  4UYF B;  4YY6 A;  3U5O A;  3Q2F A;  2YW5 A;  5CPE A;  5CQ7 A;  4YYG A;  3JVM A;  5E9L A;  4A9J A;  5A5Q A;  4HXL A;  5CQ6 A;  5IGN A;  5E0R A;  4QSS A;  4HXK A;  2D9E A;  5HCL A;  4HBW A;  5I7Y A;  2MJV B;  5HRX A;  4O75 A;  4NRC A;  5L97 A;  4Z1S A;  4O77 A;  5FE2 A;  4PKL A;  5E9M A;  5HEM A;  4O7E A;  4XUB A;  5E7D A;  5D3J A;  4NR8 A;  4LR6 A;  4YH3 A;  4HXN A;  4NUC A;  5EI4 A;  5FE4 A;  4LZR A;  4QSW A;  3P5O A;  5HFQ A;  4O7B A;  5H1T A;  5A7C A;  5ENI A;  3O35 A;  5ENF A;  5KO4 A;  4UYH A;  3K2J A;  2RNY A;  4C67 A;  5LJ1 A;  4HBY A;  5BT3 A;  5KTU A;  4E96 A;  5CRZ A;  3U5J A;  5DYC A;  5E9V A;  5ENJ A;  4YAT A;  4QR3 A;  3AQA A;  4KCX A;  5LVR A;  5LUU A;  4ALG A;  5E9K A;  2E7O A;  4BW4 A;  4QEW A;  4MEN A;  3O36 A;  5AME A;  4TYL A;  3MUK A;  5C87 A;  4LZ2 A;  2OSS A;  5CUE A;  3MUL A;  2I8N A;  4TZ8 A;  5EA1 A;  5F1L A;  4YAD A;  4Z1Q A;  3MB3 A;  5L99 A;  1E6I A;  5FBX A;  4PCE A;  5HQ6 A;  2YQD A;  3MB4 A;  3D7C A;  2RI7 A;  4YYK A;  4NYX A;  5FE8 A;  4Q0O A;  5IGK A;  5FE9 A;  2DVR A;  3O34 A;  5D25 A;  4QR5 A;  5FG4 A;  4HXO A;  4A9K A;  2DVS A;  4QZS A;  5D0C A;  2L84 A;  4N4G A;  4TU4 A;  4QYD A;  2E3K A;  3GG3 A;  4QSX A;  5HJC A;  4MEP A;  5I89 A;  3UW9 A;  4XUA A;  5DFC A;  4HXM A;  2DWW A;  5CU8 A;  3U5N A;  4Z6H A;  5C4Q A;  5II2 A;  5II1 A;  4MR3 A;  5D3R A;  5DW2 A;  5FG5 A;  5DLZ A;  2KTB B;  3LXJ A;  5L96 A;  4YBM A;  4LZS A;  4IOO A;  4RVR A;  5HM0 A;  5LVQ A;  5FB1 A;  4YYI A;  4QSV A;  5F5Z A;  3G0L A;  4NR4 A;  1N72 A;  4J0S A;  5ENH A;  4PY6 A;  4X2I A;  4LRG A;  4UYF A;  5FE3 A;  4YY4 A;  2N9G A;  5EP7 A;  3JVJ A;  4PCI A;  5EQ1 A;  5HQ5 A;  4QB3 A;  5CS8 A;  5I40 A;  5LKZ A;  4O7F A;  4N4F A;  4IR4 A;  5EWD A;  5EU1 A;  5H1U A;  4UYG A;  2RFJ A;  4C66 A;  4IOQ A;  1EQF A;  5I29 A;  5DBM A;  5A5S A;  4HBV A;  3ZYU A;  4O70 A;  5FE1 A;  4AKH A;  5CQ5 A;  3FKM X;  1WUM A;  5ETD A;  4HBX A;  4HXR A;  5HQ7 A;  4UIZ A;  5DFB A;  4MR6 A;  3UV2 A;  5DX4 A;  4QSQ A;  2R0S A;  3D1D A;  3HMH A;  2E7N A;  4YBT A;  4NR7 A;  4TT6 A;  2F6N A;  4MR5 A;  3LQH A;  5ENB A;  4NUD A;  5COI A;  3SVG A;  2RNX A;  5CUG A;  2R10 A;  5E3D A;  5F61 A;  4UIV A;  5DW1 A;  5F25 A;  5FE7 A;  3LJW A;  2YDW A;  3VKG A;  5CFW A;  5E9I A;  5AD3 A;  2OUO A;  4A9H A;  5HLS A;  5LKT A;  4IR5 A;  4QST A;  5F62 A;  5EWW A;  2GRC A;  2YEM A;  4YYD A;  5I83 A;  4QUU A;  5TB6 A;  4LC2 A;  3HME A;  5A5O A;  5ENG A;  3P1E A;  4YAX A;  5EPB A;  3VKH A;  2RS9 B;  2D82 A;  5FFY A;  5F3A A;  4Z6I A;  4QC1 A;  2OO1 A;  5EVA A;  3UVW A;  5CUA A;  5CGP A;  5HEL A;  5JWM A;  5HFR A;  2R0V A;  2DVQ A;  2L85 A;  4CUQ A;  4J3I A;  1ZS5 A;  5DFD A;  5FB0 A;  1ZKR A;  3MQM A;  1JSP B;  5HRV A;  5IGL A;  4NR9 A;  5J0D A;  4F3I A;  5E74 A;  3QZS A;  2I7K A;  4HXS A;  5DYA A;  4OUF A;  4LYW A;  5BT4 A;  1PUO A;  3HMF A;  5DYU A;  4GPJ A;  3TLP A;  5IID A;  3SVH A;  1F68 A;  2NXB A;  4QSU A;  3P1D A;  5IG6 A;  4A9F A;  4CUS A;  4WIV A;  4PTB A;  4YH4 A;  4NR5 A;  5KTW A;  3U5P A;  4NQM A;  2F6J A;  5L8U A;  5FH7 A;  5AMF A;  5CTL A;  5FFV A;  5EV9 A;  3S91 A;  5F63 A;  4CL9 A;  1WUG A;  4O74 A;  5EIS A;  3DWY A;  4UIX A;  5D7X A;  4QY4 A;  5EPR A;  3IU5 A;  5F60 A;  4NRA A;  5TCM A;  2DVV A;  5E3G A;  4NRB A;  4LYI A;  5D3S A;  4AKG A;  4QEU A;  4N4H A;  4A9M A;  4NUE A;  4OGI A;  3QZV A;  4UYD A;  5I80 A;  4XYA A;  3I3J A;  4QYL A;  3NXB A;  3JVL A;  5I88 A;  2WP1 A;  2RNW A;  4ALH A;  4FLP A;  4WHU A;  5H1V A;  5FDZ A;  5F1H A;  5A83 A;  4O71 A;  3Q2E A;  2RO1 A;  5D3N A;  3JVK A;  5H85 A;  4CUU A;  5CUD A;  4ZW1 A;  5K29 A;  4MR4 A;  4O7C A;  4QEV A;  4KV4 A;  5EM3 A;  4YAB A;  5EIC A;  2DAT A;  5F36 A;  5FE6 A;  5CZG A;  5JI8 A;  4XY9 A;  3UVX A;  2YEK A;  2DKW A;  4BW3 A;  4Q0N A;  4TS8 A;  5FE5 A;  2LSP B;  3G0J A;  4NYV A;  3U5M A;  5A5N A;  5LJ2 A;  5EWV A;  5AD2 A;  5C85 A;  4QR4 A;  5ETB A;  5KTX A;  4NYW A;  5CP5 A;  2H60 A;  4NQN A;  4CFL A;  4J1P A;  5C8G A;  5I7X A;  2YYN A;  3DAI A;  4YC9 A;  3P1C A;  5DKC A;  4CFK A;  4YYN A;  4UYE A;  5EK9 A;  3U5L A;  3MXF A;  3UV4 A;  4CLB A;  4YYM A;  5FG6 A;  4YK0 A;  5KU3 A;  5D24 A;  1JM4 B;  4J0R A;  2EJN A;  5CQ3 A;  4CUP A;  5HRW A;  2R0Y A;  4BJX A;  5C7N A;  5L8T A;  2YEL A;  5EWH A;  4PS5 A;  4QSR A;  5CQ4 A;  5G4S A;  4YYJ A;  5CQT A;  4IR6 A;  4AKI A;  5CQA A;  4O76 A;  5FE0 A;  3LQJ A;  5DLX A;  4KV1 A;  1X0J A;  5D3P A;  5CUC A;  4MEQ A;  4QSP A;  5HEN A;  5ACY A;  4O72 A;  4TT4 A;  3S92 A;  3UVY A;  5IGM A;  4QNS A;  5DKD A;  4TQN A;  5DY7 A;  5CUB A;  4Z93 A;  2G4A A;  5EPS A;  4QBM A;  4QUT A;  4TU6 A;  4ZQL A;  4A9E A;  5I1Q A;  3U5K A;  5A5P A;  3ONI A;  4IR3 A;  5E73 A;  4A9O A;  5CQ8 A;  5D3H A;  4WHW A;  5D3L A;  4AKN A;  4YBS A;  3UV5 A;  4HXP A;  4UIY A;  3SVF A;  5FH6 A;  3RCW A;  4YYH A;  5ENE A;  5CRM A;  5LKX A;  5C89 A;  4LDF A;  4A9N A;  5EWC A;  4N3W A;  5EGU A;  4N4I A;  3D1B A;  4UIU A;  5A81 A;  2FSA A;  5FFW A;  4ZC9 A;  4A9L A;  4O78 A; 
#chains in the Genus database with same CATH homology
 3P1F A;  4IOR A;  4NR6 A;  4Y03 A;  4BW1 A;  5FH8 A;  4UIW A;  4DON A;  5D26 A;  5LJ0 A;  4UIT A;  3O33 A;  5A82 A;  5L98 A;  4MEO A;  3O37 A;  2L5E A;  5G4R A;  5I86 A;  4TTE A;  3LQI A;  5KHM A;  5F2P A;  4XY8 A;  3IU6 A;  4A9I A;  4CUR A;  4CUT A;  5BT5 A;  3AAD A;  5ENC A;  5DKH A;  4TT2 A;  5A5R A;  4OGJ A;  3QZT A;  5DYX A;  5CY9 A;  4BW2 A;  5LKU A;  5IBN A;  3UVD A;  4LYS A;  4O7A A;  4QC3 A;  4NXJ A;  5D3T A;  5E9Y A;  2WP2 A;  5A85 A;  4TZ2 A;  4BHW A;  4NS5 A;  4UYF B;  4YY6 A;  3U5O A;  3Q2F A;  2YW5 A;  5CPE A;  5CQ7 A;  4YYG A;  3JVM A;  5E9L A;  4A9J A;  5A5Q A;  4HXL A;  5CQ6 A;  5IGN A;  5E0R A;  4QSS A;  4HXK A;  2D9E A;  5HCL A;  4HBW A;  5I7Y A;  2MJV B;  5HRX A;  4O75 A;  4NRC A;  5L97 A;  4Z1S A;  4O77 A;  5FE2 A;  4PKL A;  5E9M A;  5HEM A;  4O7E A;  4XUB A;  5E7D A;  5D3J A;  4NR8 A;  4LR6 A;  4YH3 A;  4HXN A;  4NUC A;  5EI4 A;  5FE4 A;  4LZR A;  4QSW A;  3P5O A;  5HFQ A;  4O7B A;  5H1T A;  5A7C A;  5ENI A;  3O35 A;  5ENF A;  5KO4 A;  4UYH A;  3K2J A;  2RNY A;  4C67 A;  5LJ1 A;  4HBY A;  5BT3 A;  5KTU A;  4E96 A;  5CRZ A;  3U5J A;  5DYC A;  5E9V A;  5ENJ A;  4YAT A;  4QR3 A;  3AQA A;  4KCX A;  5LVR A;  5LUU A;  4ALG A;  5E9K A;  2E7O A;  4BW4 A;  4QEW A;  4MEN A;  3O36 A;  5AME A;  4TYL A;  3MUK A;  5C87 A;  4LZ2 A;  2OSS A;  5CUE A;  3MUL A;  2I8N A;  4TZ8 A;  5EA1 A;  5F1L A;  4YAD A;  4Z1Q A;  3MB3 A;  5L99 A;  1E6I A;  5FBX A;  4PCE A;  5HQ6 A;  2YQD A;  3MB4 A;  3D7C A;  2RI7 A;  4YYK A;  4NYX A;  5FE8 A;  4Q0O A;  5IGK A;  5FE9 A;  2DVR A;  3O34 A;  5D25 A;  4QR5 A;  5FG4 A;  4HXO A;  4A9K A;  2DVS A;  4QZS A;  5D0C A;  2L84 A;  4N4G A;  4TU4 A;  4QYD A;  2E3K A;  3GG3 A;  4QSX A;  5HJC A;  4MEP A;  5I89 A;  3UW9 A;  4XUA A;  5DFC A;  4HXM A;  2DWW A;  5CU8 A;  3U5N A;  4Z6H A;  5C4Q A;  5II2 A;  5II1 A;  4MR3 A;  5D3R A;  5DW2 A;  5FG5 A;  5DLZ A;  2KTB B;  3LXJ A;  5L96 A;  4YBM A;  4LZS A;  4IOO A;  4RVR A;  5HM0 A;  5LVQ A;  5FB1 A;  4YYI A;  4QSV A;  5F5Z A;  3G0L A;  4NR4 A;  1N72 A;  4J0S A;  5ENH A;  4PY6 A;  4X2I A;  4LRG A;  4UYF A;  5FE3 A;  4YY4 A;  2N9G A;  5EP7 A;  3JVJ A;  4PCI A;  5EQ1 A;  5HQ5 A;  4QB3 A;  5CS8 A;  5I40 A;  5LKZ A;  4O7F A;  4N4F A;  4IR4 A;  5EWD A;  5EU1 A;  5H1U A;  4UYG A;  2RFJ A;  4C66 A;  4IOQ A;  1EQF A;  5I29 A;  5DBM A;  5A5S A;  4HBV A;  3ZYU A;  4O70 A;  5FE1 A;  5CQ5 A;  3FKM X;  1WUM A;  5ETD A;  4HBX A;  4HXR A;  5HQ7 A;  4UIZ A;  5DFB A;  4MR6 A;  3UV2 A;  5DX4 A;  4QSQ A;  2R0S A;  3HMH A;  2E7N A;  4YBT A;  4NR7 A;  4TT6 A;  2F6N A;  4MR5 A;  3LQH A;  5ENB A;  4NUD A;  5COI A;  3SVG A;  2RNX A;  5CUG A;  2R10 A;  5E3D A;  5F61 A;  4UIV A;  5DW1 A;  5F25 A;  5FE7 A;  3LJW A;  2YDW A;  5CFW A;  5E9I A;  5AD3 A;  2OUO A;  4A9H A;  5HLS A;  5LKT A;  4IR5 A;  4QST A;  5F62 A;  5EWW A;  2GRC A;  2YEM A;  4YYD A;  5I83 A;  4QUU A;  5TB6 A;  4LC2 A;  3HME A;  5A5O A;  5ENG A;  3P1E A;  4YAX A;  5EPB A;  2RS9 B;  2D82 A;  5FFY A;  5F3A A;  4Z6I A;  4QC1 A;  2OO1 A;  5EVA A;  3UVW A;  5CUA A;  5CGP A;  5HEL A;  5JWM A;  5HFR A;  2R0V A;  2DVQ A;  2L85 A;  4CUQ A;  4J3I A;  1ZS5 A;  5DFD A;  5FB0 A;  3MQM A;  1JSP B;  5HRV A;  5IGL A;  4NR9 A;  5J0D A;  4F3I A;  5E74 A;  3QZS A;  2I7K A;  4HXS A;  5DYA A;  4OUF A;  4LYW A;  5BT4 A;  3HMF A;  5DYU A;  4GPJ A;  3TLP A;  5IID A;  3SVH A;  1F68 A;  2NXB A;  4QSU A;  3P1D A;  5IG6 A;  4A9F A;  4CUS A;  4WIV A;  4PTB A;  4YH4 A;  4NR5 A;  5KTW A;  3U5P A;  4NQM A;  2F6J A;  5L8U A;  5FH7 A;  5AMF A;  5CTL A;  5FFV A;  5EV9 A;  3S91 A;  5F63 A;  4CL9 A;  1WUG A;  4O74 A;  5EIS A;  3DWY A;  4UIX A;  5D7X A;  4QY4 A;  5EPR A;  3IU5 A;  5F60 A;  4NRA A;  5TCM A;  2DVV A;  5E3G A;  4NRB A;  4LYI A;  5D3S A;  4QEU A;  4N4H A;  4A9M A;  4NUE A;  4OGI A;  3QZV A;  4UYD A;  5I80 A;  4XYA A;  3I3J A;  4QYL A;  3NXB A;  3JVL A;  5I88 A;  2WP1 A;  2RNW A;  4ALH A;  4FLP A;  4WHU A;  5H1V A;  5FDZ A;  5F1H A;  5A83 A;  4O71 A;  3Q2E A;  2RO1 A;  5D3N A;  3JVK A;  5H85 A;  4CUU A;  5CUD A;  4ZW1 A;  5K29 A;  4MR4 A;  4O7C A;  4QEV A;  4KV4 A;  5EM3 A;  4YAB A;  5EIC A;  2DAT A;  5F36 A;  5FE6 A;  5CZG A;  5JI8 A;  4XY9 A;  3UVX A;  2YEK A;  2DKW A;  4BW3 A;  4Q0N A;  4TS8 A;  5FE5 A;  2LSP B;  3G0J A;  4NYV A;  3U5M A;  5A5N A;  5LJ2 A;  5EWV A;  5AD2 A;  5C85 A;  4QR4 A;  5ETB A;  5KTX A;  4NYW A;  5CP5 A;  2H60 A;  4NQN A;  4CFL A;  4J1P A;  5C8G A;  5I7X A;  2YYN A;  3DAI A;  4YC9 A;  3P1C A;  5DKC A;  4CFK A;  4YYN A;  4UYE A;  5EK9 A;  3U5L A;  3MXF A;  3UV4 A;  4CLB A;  4YYM A;  5FG6 A;  4YK0 A;  5KU3 A;  5D24 A;  1JM4 B;  4J0R A;  5CQ3 A;  4CUP A;  5HRW A;  2R0Y A;  4BJX A;  5C7N A;  5L8T A;  2YEL A;  5EWH A;  4PS5 A;  4QSR A;  5CQ4 A;  5G4S A;  4YYJ A;  5CQT A;  4IR6 A;  5CQA A;  4O76 A;  5FE0 A;  3LQJ A;  5DLX A;  4KV1 A;  1X0J A;  5D3P A;  5CUC A;  4MEQ A;  4QSP A;  5HEN A;  5ACY A;  4O72 A;  4TT4 A;  3S92 A;  3UVY A;  5IGM A;  4QNS A;  5DKD A;  4TQN A;  5DY7 A;  5CUB A;  4Z93 A;  2G4A A;  5EPS A;  4QBM A;  4QUT A;  4TU6 A;  4ZQL A;  4A9E A;  5I1Q A;  3U5K A;  5A5P A;  3ONI A;  4IR3 A;  5E73 A;  4A9O A;  5CQ8 A;  5D3H A;  4WHW A;  5D3L A;  4AKN A;  4YBS A;  3UV5 A;  4HXP A;  4UIY A;  3SVF A;  5FH6 A;  3RCW A;  4YYH A;  5ENE A;  5CRM A;  5LKX A;  5C89 A;  4LDF A;  4A9N A;  5EWC A;  4N3W A;  5EGU A;  4N4I A;  4UIU A;  5A81 A;  2FSA A;  5FFW A;  4ZC9 A;  4A9L A;  4O78 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...