5A5SA

Nn-terminal bromodomain of human brd4 with 5-5-methoxypyridin-3-yl-3- methyl-8-piperidin-4-ylamino-1,2-dihydro-1,7-naphthyridin-2-one
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
127
structure length
127
Chain Sequence
SMNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHKFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELPTEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BROMODOMAIN-CONTAINING PROTEIN 4
publication title Fragment-Based Discovery of Low-Micromolar Atad2 Bromodomain Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 44
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2015-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5a5sA01
2D82A 4QZSA 4NRBA 4HXNA 1X0JA 5LKUA 5F62A 2D9EA 3I3JA 5C89A 2WP2A 4IR4A 4YH3A 4YYIA 1ZS5A 4QSXA 3QZSA 4BHWA 3U5OA 3MQMA 4BW3A 5H1TA 5FFVA 2YDWA 1JM4B 5LVRA 5A5SA 5CPEA 2FSAA 5C8GA 4NQNA 5IGMA 4HXLA 1JSPB 5EWHA 4YYKA 4NUCA 4QY4A 5HQ7A 5I86A 5LVQA 5KHMA 5EWDA 5FB0A 4O75A 5CQ5A 3U5KA 4UITA 3U5MA 5FE9A 4MEOA 3MULA 2E7NA 5CQ4A 4CUSA 3LJWA 4F3IA 5HRWA 4YABA 4QSPA 2YEKA 2RNYA 5E0RA 5CS8A 4TYLA 4UIUA 5IG6A 5EISA 4N4FA 4LDFA 5E9IA 5F2PA 5IGNA 5FE2A 4PCIA 1WUGA 5CUGA 4QBMA 4TU4A 4YBMA 5II2A 5DW2A 4HXMA 2DWWA 4O71A 2DVVA 2L5EA 3MB4A 5EK9A 5IIDA 5FE5A 4QUTA 3UVDA 4Q0OA 4XYAA 3U5JA 4UYDA 5A83A 3P1FA 4CL9A 4BW4A 5CRMA 5HLSA 5LJ0A 4O7AA 3QZVA 2WP1A 4LC2A 5ENGA 2E3KA 5CQ7A 5BT5A 5C7NA 5FE7A 4HXKA 3TLPA 5AD3A 5DX4A 5DBMA 4QSWA 5H1UA 4TT6A 3IU6A 4O7CA 4UIYA 5HEMA 5BT3A 5HQ5A 4WHUA 5G4RA 4NXJA 5CP5A 5EPSA 4NRAA 4CUPA 5FH8A 5FG6A 5FH7A 4UIWA 5E9VA 5C85A 5KO4A 5F5ZA 4TT4A 5IGKA 4TTEA 5I83A 4NR6A 5CUDA 2MJVB 5D3TA 5DYUA 3P5OA 4J1PA 5D26A 5JI8A 3UVXA 5CZGA 5FE8A 5AD2A 2DATA 5A81A 5D24A 4KV1A 5LKTA 3LQIA 5TCMA 4TT2A 4UYGA 4MENA 5FFWA 5LJ2A 2L85A 4HXSA 5L99A 3UV5A 3HMEA 5EGUA 5CUCA 4Z6IA 2RNXA 5I88A 5FB1A 5EWWA 4YBSA 5FBXA 4A9KA 4FLPA 5D3SA 2F6JA 4IR5A 2I7KA 4QR3A 4YC9A 3G0LA 5F60A 4OUFA 5ENFA 5KTUA 4YYMA 5CQAA 4YYGA 5IGLA 5F1HA 5HCLA 5HM0A 2R0VA 5ACYA 5AMEA 4O76A 5E9MA 4LZ2A 3ONIA 5ENEA 4TZ8A 4LYIA 4PY6A 5CTLA 5L8TA 2DVRA 5D3RA 5ENJA 3S92A 5L8UA 4KV4A 2H60A 5EWVA 3SVGA 5D7XA 5LJ1A 4ZC9A 5A85A 4MR6A 3O37A 5I1QA 2R0SA 4QSSA 2YQDA 5DYAA 1N72A 4Z1SA 4J0RA 4QNSA 4UYHA 2R10A 4NR8A 3SVFA 4C66A 1F68A 4UYFB 5E74A 4A9LA 5J0DA 5CRZA 4QC3A 5EPRA 4GPJA 5D3PA 4QYLA 5CUBA 5CUAA 5HFRA 5I7YA 4ZW1A 4HXPA 4TS8A 3JVMA 3D7CA 4LRGA 5AMFA 3Q2EA 4BW2A 4KCXA 5A5QA 5FE3A 4CLBA 4MR5A 3MXFA 5ENCA 4PKLA 5CQ6A 4YADA 3P1DA 4YAXA 2OSSA 4N4HA 4ALGA 4BJXA 5FE0A 3LQJA 4A9EA 5DY7A 2NXBA 5H85A 4O74A 5A5RA 3LXJA 4NRCA 5HRVA 5F3AA 4N4IA 5F25A 5FG4A 4CUUA 5BT4A 3FKMX 4MEPA 4XUBA 4UIVA 4XUAA 5D3HA 5A5NA 5DFDA 5E3DA 4CFKA 4YYNA 3JVKA 4QR4A 5EU1A 5ENHA 4LYWA 5CQ3A 3O36A 5E3GA 2DVQA 3O34A 5HENA 4ZQLA 5EICA 4HBXA 4YBTA 2RS9B 3UVWA 2YELA 5CGPA 5II1A 3JVJA 4HXRA 3GG3A 2N9GA 4UYFA 4HBVA 5EP7A 2RO1A 3AQAA 2YW5A 4CFLA 1EQFA 5CFWA 4OGJA 5EV9A 5CQ8A 3UV4A 5CUEA 3S91A 5EWCA 4QEWA 5EQ1A 5D3JA 4YH4A 2OO1A 4NQMA 4Z6HA 4J3IA 4Q0NA 5EI4A 3K2JA 5CU8A 4QB3A 1E6IA 4UIXA 2LSPB 4QSUA 3U5LA 5LKZA 4HBYA 5FG5A 3RCWA 4A9OA 5HRXA 5E9YA 2YEMA 5A7CA 4N3WA 3ZYUA 5FE6A 5D0CA 4HXOA 4LZSA 4NR4A 4NUDA 5ETDA 3SVHA 2E7OA 4QSTA 3MB3A 4IOQA 4LZRA 4QUUA 4QSQA 5C4QA 4YY6A 3Q2FA 5E9KA 4CURA 4UYEA 5H1VA 3DWYA 5HFQA 4NYVA 4N4GA 5CY9A 5DYCA 5EPBA 2DKWA 4NR7A 5I7XA 2RI7A 3JVLA 4MR3A 5G4SA 2G4AA 2L84A 5I89A 4TZ2A 4OGIA 4IOOA 5DYXA 2GRCA 4Z93A 5L96A 5FH6A 5COIA 4MR4A 4A9HA 4Z1QA 5FDZA 1WUMA 2DVSA 4TU6A 4O7EA 5C87A 3P1CA 4E96A 4QR5A 2R0YA 5HJCA 3G0JA 4C67A 4O77A 4QSRA 5DFBA 5HELA 5F63A 5TB6A 5F1LA 4PS5A 4YYDA 5K29A 2I8NA 2OUOA 4A9MA 3HMHA 3P1EA 4QYDA 5HQ6A 4A9FA 3HMFA 2YYNA 4NR9A 3QZTA 4A9IA 4CUQA 5I80A 5DW1A 4BW1A 3LQHA 4CUTA 4HBWA 4QC1A 5KTWA 4IR3A 4QEUA 5A5PA 5DKCA 5I40A 3MUKA 5F36A 5LKXA 3O35A 5EM3A 5EA1A 4O7BA 4TQNA 5CQTA 3AADA 4J0SA 4WIVA 4YYJA 4O72A 5JWMA 5DKHA 3U5PA 4NYWA 4PTBA 5ENBA 4LYSA 4O7FA 5D25A 5A5OA 4O78A 5DFCA 4A9NA 3IU5A 4YY4A 4X2IA 5FFYA 5FE4A 5E73A 4NS5A 5KU3A 4IR6A 5DKDA 5F61A 4AKNA 4YYHA 3UW9A 5D3NA 4RVRA 4O70A 5IBNA 4A9JA 5I29A 4QEVA 3NXBA 4DONA 4MEQA 4PCEA 5DLXA 5LUUA 5ENIA 2RNWA 4UIZA 5FE1A 5L98A 5D3LA 5E9LA 4ALHA 4LR6A 2RFJA 5DLZA 5ETBA 3DAIA 2KTBB 5KTXA 2F6NA 4WHWA 5E7DA 3UVYA 4NYXA 4NR5A 5L97A 3U5NA 3UV2A 4XY9A 4YK0A 4NUEA 4QSVA 4YATA 4IORA 4Y03A 3O33A 5A82A 4XY8A 5EVAA
chains in the Genus database with same CATH superfamily
2D82A 4QZSA 4NRBA 4HXNA 1X0JA 5LKUA 5F62A 2D9EA 3I3JA 5C89A 2WP2A 4IR4A 4YH3A 4YYIA 1ZS5A 4QSXA 3QZSA 4BHWA 3U5OA 3MQMA 4BW3A 5H1TA 5FFVA 2YDWA 1JM4B 5LVRA 5A5SA 5CPEA 2FSAA 5C8GA 4NQNA 5IGMA 4HXLA 1JSPB 5EWHA 4YYKA 4NUCA 4QY4A 5HQ7A 5I86A 5LVQA 5KHMA 5EWDA 5FB0A 4O75A 5CQ5A 3U5KA 4UITA 3U5MA 5FE9A 4MEOA 3MULA 2E7NA 5CQ4A 4CUSA 3LJWA 4F3IA 5HRWA 4YABA 4QSPA 2YEKA 3D1DA 2RNYA 5E0RA 5CS8A 4TYLA 4UIUA 5IG6A 5EISA 4N4FA 4LDFA 5E9IA 5F2PA 5IGNA 5FE2A 4PCIA 1WUGA 5CUGA 4QBMA 4TU4A 4YBMA 5II2A 5DW2A 4HXMA 2DWWA 4O71A 2DVVA 2L5EA 3MB4A 5EK9A 5IIDA 5FE5A 4QUTA 3UVDA 4Q0OA 4XYAA 3U5JA 4UYDA 5A83A 3P1FA 4CL9A 4BW4A 5CRMA 5HLSA 5LJ0A 4O7AA 3VKHA 3QZVA 2WP1A 4LC2A 5ENGA 2E3KA 5CQ7A 5BT5A 5C7NA 5FE7A 4HXKA 3TLPA 5AD3A 5DX4A 5DBMA 4QSWA 5H1UA 4TT6A 3IU6A 4O7CA 4UIYA 5HEMA 5BT3A 5HQ5A 4WHUA 5G4RA 4NXJA 5CP5A 5EPSA 4NRAA 4CUPA 5FH8A 5FG6A 5FH7A 4UIWA 5E9VA 5C85A 5KO4A 5F5ZA 4TT4A 5IGKA 4TTEA 5I83A 4NR6A 5CUDA 2MJVB 5D3TA 5DYUA 3P5OA 4J1PA 5D26A 5JI8A 3UVXA 5CZGA 5FE8A 5AD2A 2DATA 5A81A 5D24A 4KV1A 5LKTA 3LQIA 5TCMA 4TT2A 4UYGA 4MENA 5FFWA 5LJ2A 2L85A 4HXSA 5L99A 3UV5A 3HMEA 5EGUA 5CUCA 4AKIA 4Z6IA 2RNXA 3VKGA 5I88A 5FB1A 5EWWA 4YBSA 5FBXA 4A9KA 4FLPA 5D3SA 2F6JA 4IR5A 2I7KA 4QR3A 4YC9A 3G0LA 5F60A 4OUFA 5ENFA 5KTUA 4YYMA 5CQAA 4YYGA 5IGLA 5F1HA 5HCLA 5HM0A 2R0VA 5ACYA 5AMEA 4O76A 5E9MA 4LZ2A 3ONIA 5ENEA 4TZ8A 4LYIA 4PY6A 5CTLA 5L8TA 2DVRA 5D3RA 5ENJA 3S92A 5L8UA 4KV4A 2H60A 5EWVA 3SVGA 5D7XA 5LJ1A 4ZC9A 5A85A 4MR6A 3O37A 5I1QA 2R0SA 4QSSA 2YQDA 5DYAA 1N72A 4Z1SA 4J0RA 4QNSA 4UYHA 2R10A 4NR8A 3SVFA 4C66A 1F68A 4UYFB 5E74A 4A9LA 5J0DA 5CRZA 4QC3A 5EPRA 4GPJA 5D3PA 4QYLA 5CUBA 5CUAA 5HFRA 5I7YA 4ZW1A 4HXPA 4TS8A 3JVMA 3D7CA 4LRGA 5AMFA 3Q2EA 4BW2A 4KCXA 5A5QA 5FE3A 4CLBA 4MR5A 3MXFA 5ENCA 4PKLA 5CQ6A 4YADA 3P1DA 4YAXA 2OSSA 4N4HA 4ALGA 4BJXA 5FE0A 3LQJA 4A9EA 5DY7A 2NXBA 5H85A 4O74A 5A5RA 3LXJA 4NRCA 5HRVA 5F3AA 4N4IA 5F25A 5FG4A 4CUUA 5BT4A 3FKMX 4MEPA 4XUBA 4UIVA 4XUAA 5D3HA 5A5NA 5DFDA 5E3DA 4CFKA 4YYNA 3JVKA 4QR4A 5EU1A 5ENHA 4LYWA 5CQ3A 3O36A 5E3GA 2DVQA 3O34A 5HENA 4ZQLA 5EICA 3ERRA 4HBXA 4YBTA 2RS9B 3UVWA 2YELA 5CGPA 5II1A 3JVJA 4HXRA 3GG3A 2N9GA 4UYFA 4HBVA 5EP7A 2RO1A 3AQAA 2YW5A 4CFLA 1EQFA 5CFWA 4OGJA 5EV9A 5CQ8A 3UV4A 5CUEA 3S91A 5EWCA 4QEWA 5EQ1A 5D3JA 4YH4A 2OO1A 4NQMA 4Z6HA 4J3IA 4Q0NA 5EI4A 3K2JA 5CU8A 4QB3A 1E6IA 4UIXA 2LSPB 4QSUA 3U5LA 5LKZA 4AI6A 4HBYA 5FG5A 3RCWA 4AKHA 4A9OA 5HRXA 5E9YA 2YEMA 5A7CA 4N3WA 3ZYUA 5FE6A 5D0CA 4HXOA 4LZSA 4NR4A 4NUDA 5ETDA 3SVHA 2E7OA 4QSTA 3MB3A 4IOQA 4LZRA 4QUUA 4QSQA 5C4QA 4YY6A 3Q2FA 5E9KA 4CURA 4UYEA 5H1VA 3DWYA 5HFQA 4NYVA 4N4GA 5CY9A 5DYCA 5EPBA 2DKWA 4NR7A 5I7XA 2RI7A 3JVLA 4MR3A 5G4SA 2G4AA 2L84A 1ZKRA 5I89A 4TZ2A 4OGIA 4IOOA 5DYXA 2GRCA 4Z93A 5L96A 5FH6A 5COIA 4MR4A 4A9HA 4Z1QA 5FDZA 1WUMA 2DVSA 4TU6A 4O7EA 5C87A 3P1CA 4E96A 4QR5A 2EJNA 2R0YA 5HJCA 3G0JA 4C67A 4O77A 4QSRA 5DFBA 5HELA 5F63A 5TB6A 5F1LA 4PS5A 4YYDA 5K29A 2I8NA 2OUOA 4A9MA 3HMHA 3P1EA 4QYDA 5HQ6A 4A9FA 1PUOA 3HMFA 2YYNA 4NR9A 3QZTA 4A9IA 4CUQA 5I80A 5DW1A 4BW1A 3LQHA 4CUTA 4HBWA 4QC1A 5KTWA 4IR3A 4QEUA 5A5PA 5DKCA 5I40A 3MUKA 5F36A 5LKXA 3O35A 5EM3A 5EA1A 4O7BA 4TQNA 5CQTA 3AADA 4J0SA 4WIVA 4YYJA 4O72A 5JWMA 5DKHA 3U5PA 4NYWA 4PTBA 5ENBA 4LYSA 4O7FA 5D25A 5A5OA 4O78A 3D1BA 5DFCA 4A9NA 3IU5A 4YY4A 4X2IA 5FFYA 5FE4A 5E73A 4NS5A 5KU3A 4IR6A 5DKDA 5F61A 4AKNA 4YYHA 3UW9A 5D3NA 4RVRA 4O70A 5IBNA 4A9JA 5I29A 4QEVA 3NXBA 4DONA 4MEQA 4PCEA 5DLXA 5LUUA 5ENIA 2RNWA 4UIZA 5FE1A 5L98A 5D3LA 5E9LA 4ALHA 4LR6A 2RFJA 5DLZA 5ETBA 3DAIA 4AKGA 2KTBB 5KTXA 2F6NA 4WHWA 5E7DA 3UVYA 4NYXA 4NR5A 5L97A 3U5NA 3UV2A 4XY9A 4YK0A 4NUEA 4QSVA 4YATA 4IORA 4Y03A 3O33A 5A82A 4XY8A 5EVAA
chains in the Genus database with same CATH topology
2D82A 4QZSA 4NRBA 4HXNA 1X0JA 5LKUA 5F62A 2D9EA 3I3JA 5C89A 2WP2A 4IR4A 4YH3A 4YYIA 1ZS5A 4QSXA 3QZSA 4BHWA 3U5OA 3MQMA 4BW3A 5H1TA 5FFVA 2YDWA 1JM4B 5LVRA 5A5SA 5CPEA 2FSAA 5C8GA 4NQNA 5IGMA 4HXLA 1JSPB 5EWHA 4YYKA 4NUCA 4QY4A 5HQ7A 5I86A 5LVQA 5KHMA 5EWDA 5FB0A 4O75A 5CQ5A 3U5KA 4UITA 3U5MA 5FE9A 4MEOA 3MULA 2E7NA 5CQ4A 4CUSA 3LJWA 4F3IA 5HRWA 4YABA 4QSPA 2YEKA 2RNYA 5E0RA 5CS8A 4TYLA 4UIUA 5IG6A 5EISA 4N4FA 4LDFA 5E9IA 5F2PA 5IGNA 5FE2A 4PCIA 1WUGA 5CUGA 4QBMA 4TU4A 4YBMA 5II2A 5DW2A 4HXMA 2DWWA 4O71A 2DVVA 2L5EA 3MB4A 5EK9A 5IIDA 5FE5A 4QUTA 3UVDA 4Q0OA 4XYAA 3U5JA 4UYDA 5A83A 3P1FA 4CL9A 4BW4A 5CRMA 5HLSA 5LJ0A 4O7AA 3QZVA 2WP1A 4LC2A 5ENGA 2E3KA 5CQ7A 5BT5A 5C7NA 5FE7A 4HXKA 3TLPA 5AD3A 5DX4A 5DBMA 4QSWA 5H1UA 4TT6A 3IU6A 4O7CA 4UIYA 5HEMA 5BT3A 5HQ5A 4WHUA 5G4RA 4NXJA 5CP5A 5EPSA 4NRAA 4CUPA 5FH8A 5FG6A 5FH7A 4UIWA 5E9VA 5C85A 5KO4A 5F5ZA 4TT4A 5IGKA 4TTEA 5I83A 4NR6A 5CUDA 2MJVB 5D3TA 5DYUA 3P5OA 4J1PA 5D26A 5JI8A 3UVXA 5CZGA 5FE8A 5AD2A 2DATA 5A81A 5D24A 4KV1A 5LKTA 3LQIA 5TCMA 4TT2A 4UYGA 4MENA 5FFWA 5LJ2A 2L85A 4HXSA 5L99A 3UV5A 3HMEA 5EGUA 5CUCA 4Z6IA 2RNXA 5I88A 5FB1A 5EWWA 4YBSA 5FBXA 4A9KA 4FLPA 5D3SA 2F6JA 4IR5A 2I7KA 4QR3A 4YC9A 3G0LA 5F60A 4OUFA 5ENFA 5KTUA 4YYMA 5CQAA 4YYGA 5IGLA 5F1HA 5HCLA 5HM0A 2R0VA 5ACYA 5AMEA 4O76A 5E9MA 4LZ2A 3ONIA 5ENEA 4TZ8A 4LYIA 4PY6A 5CTLA 5L8TA 2DVRA 5D3RA 5ENJA 3S92A 5L8UA 4KV4A 2H60A 5EWVA 3SVGA 5D7XA 5LJ1A 4ZC9A 5A85A 4MR6A 3O37A 5I1QA 2R0SA 4QSSA 2YQDA 5DYAA 1N72A 4Z1SA 4J0RA 4QNSA 4UYHA 2R10A 4NR8A 3SVFA 4C66A 1F68A 4UYFB 5E74A 4A9LA 5J0DA 5CRZA 4QC3A 5EPRA 4GPJA 5D3PA 4QYLA 5CUBA 5CUAA 5HFRA 5I7YA 4ZW1A 4HXPA 4TS8A 3JVMA 3D7CA 4LRGA 5AMFA 3Q2EA 4BW2A 4KCXA 5A5QA 5FE3A 4CLBA 4MR5A 3MXFA 5ENCA 4PKLA 5CQ6A 4YADA 3P1DA 4YAXA 2OSSA 4N4HA 4ALGA 4BJXA 5FE0A 3LQJA 4A9EA 5DY7A 2NXBA 5H85A 4O74A 5A5RA 3LXJA 4NRCA 5HRVA 5F3AA 4N4IA 5F25A 5FG4A 4CUUA 5BT4A 3FKMX 4MEPA 4XUBA 4UIVA 4XUAA 5D3HA 5A5NA 5DFDA 5E3DA 4CFKA 4YYNA 3JVKA 4QR4A 5EU1A 5ENHA 4LYWA 5CQ3A 3O36A 5E3GA 2DVQA 3O34A 5HENA 4ZQLA 5EICA 4HBXA 4YBTA 2RS9B 3UVWA 2YELA 5CGPA 5II1A 3JVJA 4HXRA 3GG3A 2N9GA 4UYFA 4HBVA 5EP7A 2RO1A 3AQAA 2YW5A 4CFLA 1EQFA 5CFWA 4OGJA 5EV9A 5CQ8A 3UV4A 5CUEA 3S91A 5EWCA 4QEWA 5EQ1A 5D3JA 4YH4A 2OO1A 4NQMA 4Z6HA 4J3IA 4Q0NA 5EI4A 3K2JA 5CU8A 4QB3A 1E6IA 4UIXA 2LSPB 4QSUA 3U5LA 5LKZA 4HBYA 5FG5A 3RCWA 4A9OA 5HRXA 5E9YA 2YEMA 5A7CA 4N3WA 3ZYUA 5FE6A 5D0CA 4HXOA 4LZSA 4NR4A 4NUDA 5ETDA 3SVHA 2E7OA 4QSTA 3MB3A 4IOQA 4LZRA 4QUUA 4QSQA 5C4QA 4YY6A 3Q2FA 5E9KA 4CURA 4UYEA 5H1VA 3DWYA 5HFQA 4NYVA 4N4GA 5CY9A 5DYCA 5EPBA 2DKWA 4NR7A 5I7XA 2RI7A 3JVLA 4MR3A 5G4SA 2G4AA 2L84A 5I89A 4TZ2A 4OGIA 4IOOA 5DYXA 2GRCA 4Z93A 5L96A 5FH6A 5COIA 4MR4A 4A9HA 4Z1QA 5FDZA 1WUMA 2DVSA 4TU6A 4O7EA 5C87A 3P1CA 4E96A 4QR5A 2R0YA 5HJCA 3G0JA 4C67A 4O77A 4QSRA 5DFBA 5HELA 5F63A 5TB6A 5F1LA 4PS5A 4YYDA 5K29A 2I8NA 2OUOA 4A9MA 3HMHA 3P1EA 4QYDA 5HQ6A 4A9FA 3HMFA 2YYNA 4NR9A 3QZTA 4A9IA 4CUQA 5I80A 5DW1A 4BW1A 3LQHA 4CUTA 4HBWA 4QC1A 5KTWA 4IR3A 4QEUA 5A5PA 5DKCA 5I40A 3MUKA 5F36A 5LKXA 3O35A 5EM3A 5EA1A 4O7BA 4TQNA 5CQTA 3AADA 4J0SA 4WIVA 4YYJA 4O72A 5JWMA 5DKHA 3U5PA 4NYWA 4PTBA 5ENBA 4LYSA 4O7FA 5D25A 5A5OA 4O78A 5DFCA 4A9NA 3IU5A 4YY4A 4X2IA 5FFYA 5FE4A 5E73A 4NS5A 5KU3A 4IR6A 5DKDA 5F61A 4AKNA 4YYHA 3UW9A 5D3NA 4RVRA 4O70A 5IBNA 4A9JA 5I29A 4QEVA 3NXBA 4DONA 4MEQA 4PCEA 5DLXA 5LUUA 5ENIA 2RNWA 4UIZA 5FE1A 5L98A 5D3LA 5E9LA 4ALHA 4LR6A 2RFJA 5DLZA 5ETBA 3DAIA 2KTBB 5KTXA 2F6NA 4WHWA 5E7DA 3UVYA 4NYXA 4NR5A 5L97A 3U5NA 3UV2A 4XY9A 4YK0A 4NUEA 4QSVA 4YATA 4IORA 4Y03A 3O33A 5A82A 4XY8A 5EVAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D82 A;  4QZS A;  4NRB A;  4HXN A;  1X0J A;  5LKU A;  5F62 A;  2D9E A;  3I3J A;  5C89 A;  2WP2 A;  4IR4 A;  4YH3 A;  4YYI A;  1ZS5 A;  4QSX A;  3QZS A;  4BHW A;  3U5O A;  3MQM A;  4BW3 A;  5H1T A;  5FFV A;  2YDW A;  1JM4 B;  5LVR A;  5A5S A;  5CPE A;  2FSA A;  5C8G A;  4NQN A;  5IGM A;  4HXL A;  1JSP B;  5EWH A;  4YYK A;  4NUC A;  4QY4 A;  5HQ7 A;  5I86 A;  5LVQ A;  5KHM A;  5EWD A;  5FB0 A;  4O75 A;  5CQ5 A;  3U5K A;  4UIT A;  3U5M A;  5FE9 A;  4MEO A;  3MUL A;  2E7N A;  5CQ4 A;  4CUS A;  3LJW A;  4F3I A;  5HRW A;  4YAB A;  4QSP A;  2YEK A;  2RNY A;  5E0R A;  5CS8 A;  4TYL A;  4UIU A;  5IG6 A;  5EIS A;  4N4F A;  4LDF A;  5E9I A;  5F2P A;  5IGN A;  5FE2 A;  4PCI A;  1WUG A;  5CUG A;  4QBM A;  4TU4 A;  4YBM A;  5II2 A;  5DW2 A;  4HXM A;  2DWW A;  4O71 A;  2DVV A;  2L5E A;  3MB4 A;  5EK9 A;  5IID A;  5FE5 A;  4QUT A;  3UVD A;  4Q0O A;  4XYA A;  3U5J A;  4UYD A;  5A83 A;  3P1F A;  4CL9 A;  4BW4 A;  5CRM A;  5HLS A;  5LJ0 A;  4O7A A;  3QZV A;  2WP1 A;  4LC2 A;  5ENG A;  2E3K A;  5CQ7 A;  5BT5 A;  5C7N A;  5FE7 A;  4HXK A;  3TLP A;  5AD3 A;  5DX4 A;  5DBM A;  4QSW A;  5H1U A;  4TT6 A;  3IU6 A;  4O7C A;  4UIY A;  5HEM A;  5BT3 A;  5HQ5 A;  4WHU A;  5G4R A;  4NXJ A;  5CP5 A;  5EPS A;  4NRA A;  4CUP A;  5FH8 A;  5FG6 A;  5FH7 A;  4UIW A;  5E9V A;  5C85 A;  5KO4 A;  5F5Z A;  4TT4 A;  5IGK A;  4TTE A;  5I83 A;  4NR6 A;  5CUD A;  2MJV B;  5D3T A;  5DYU A;  3P5O A;  4J1P A;  5D26 A;  5JI8 A;  3UVX A;  5CZG A;  5FE8 A;  5AD2 A;  2DAT A;  5A81 A;  5D24 A;  4KV1 A;  5LKT A;  3LQI A;  5TCM A;  4TT2 A;  4UYG A;  4MEN A;  5FFW A;  5LJ2 A;  2L85 A;  4HXS A;  5L99 A;  3UV5 A;  3HME A;  5EGU A;  5CUC A;  4Z6I A;  2RNX A;  5I88 A;  5FB1 A;  5EWW A;  4YBS A;  5FBX A;  4A9K A;  4FLP A;  5D3S A;  2F6J A;  4IR5 A;  2I7K A;  4QR3 A;  4YC9 A;  3G0L A;  5F60 A;  4OUF A;  5ENF A;  5KTU A;  4YYM A;  5CQA A;  4YYG A;  5IGL A;  5F1H A;  5HCL A;  5HM0 A;  2R0V A;  5ACY A;  5AME A;  4O76 A;  5E9M A;  4LZ2 A;  3ONI A;  5ENE A;  4TZ8 A;  4LYI A;  4PY6 A;  5CTL A;  5L8T A;  2DVR A;  5D3R A;  5ENJ A;  3S92 A;  5L8U A;  4KV4 A;  2H60 A;  5EWV A;  3SVG A;  5D7X A;  5LJ1 A;  4ZC9 A;  5A85 A;  4MR6 A;  3O37 A;  5I1Q A;  2R0S A;  4QSS A;  2YQD A;  5DYA A;  1N72 A;  4Z1S A;  4J0R A;  4QNS A;  4UYH A;  2R10 A;  4NR8 A;  3SVF A;  4C66 A;  1F68 A;  4UYF B;  5E74 A;  4A9L A;  5J0D A;  5CRZ A;  4QC3 A;  5EPR A;  4GPJ A;  5D3P A;  4QYL A;  5CUB A;  5CUA A;  5HFR A;  5I7Y A;  4ZW1 A;  4HXP A;  4TS8 A;  3JVM A;  3D7C A;  4LRG A;  5AMF A;  3Q2E A;  4BW2 A;  4KCX A;  5A5Q A;  5FE3 A;  4CLB A;  4MR5 A;  3MXF A;  5ENC A;  4PKL A;  5CQ6 A;  4YAD A;  3P1D A;  4YAX A;  2OSS A;  4N4H A;  4ALG A;  4BJX A;  5FE0 A;  3LQJ A;  4A9E A;  5DY7 A;  2NXB A;  5H85 A;  4O74 A;  5A5R A;  3LXJ A;  4NRC A;  5HRV A;  5F3A A;  4N4I A;  5F25 A;  5FG4 A;  4CUU A;  5BT4 A;  3FKM X;  4MEP A;  4XUB A;  4UIV A;  4XUA A;  5D3H A;  5A5N A;  5DFD A;  5E3D A;  4CFK A;  4YYN A;  3JVK A;  4QR4 A;  5EU1 A;  5ENH A;  4LYW A;  5CQ3 A;  3O36 A;  5E3G A;  2DVQ A;  3O34 A;  5HEN A;  4ZQL A;  5EIC A;  4HBX A;  4YBT A;  2RS9 B;  3UVW A;  2YEL A;  5CGP A;  5II1 A;  3JVJ A;  4HXR A;  3GG3 A;  2N9G A;  4UYF A;  4HBV A;  5EP7 A;  2RO1 A;  3AQA A;  2YW5 A;  4CFL A;  1EQF A;  5CFW A;  4OGJ A;  5EV9 A;  5CQ8 A;  3UV4 A;  5CUE A;  3S91 A;  5EWC A;  4QEW A;  5EQ1 A;  5D3J A;  4YH4 A;  2OO1 A;  4NQM A;  4Z6H A;  4J3I A;  4Q0N A;  5EI4 A;  3K2J A;  5CU8 A;  4QB3 A;  1E6I A;  4UIX A;  2LSP B;  4QSU A;  3U5L A;  5LKZ A;  4HBY A;  5FG5 A;  3RCW A;  4A9O A;  5HRX A;  5E9Y A;  2YEM A;  5A7C A;  4N3W A;  3ZYU A;  5FE6 A;  5D0C A;  4HXO A;  4LZS A;  4NR4 A;  4NUD A;  5ETD A;  3SVH A;  2E7O A;  4QST A;  3MB3 A;  4IOQ A;  4LZR A;  4QUU A;  4QSQ A;  5C4Q A;  4YY6 A;  3Q2F A;  5E9K A;  4CUR A;  4UYE A;  5H1V A;  3DWY A;  5HFQ A;  4NYV A;  4N4G A;  5CY9 A;  5DYC A;  5EPB A;  2DKW A;  4NR7 A;  5I7X A;  2RI7 A;  3JVL A;  4MR3 A;  5G4S A;  2G4A A;  2L84 A;  5I89 A;  4TZ2 A;  4OGI A;  4IOO A;  5DYX A;  2GRC A;  4Z93 A;  5L96 A;  5FH6 A;  5COI A;  4MR4 A;  4A9H A;  4Z1Q A;  5FDZ A;  1WUM A;  2DVS A;  4TU6 A;  4O7E A;  5C87 A;  3P1C A;  4E96 A;  4QR5 A;  2R0Y A;  5HJC A;  3G0J A;  4C67 A;  4O77 A;  4QSR A;  5DFB A;  5HEL A;  5F63 A;  5TB6 A;  5F1L A;  4PS5 A;  4YYD A;  5K29 A;  2I8N A;  2OUO A;  4A9M A;  3HMH A;  3P1E A;  4QYD A;  5HQ6 A;  4A9F A;  3HMF A;  2YYN A;  4NR9 A;  3QZT A;  4A9I A;  4CUQ A;  5I80 A;  5DW1 A;  4BW1 A;  3LQH A;  4CUT A;  4HBW A;  4QC1 A;  5KTW A;  4IR3 A;  4QEU A;  5A5P A;  5DKC A;  5I40 A;  3MUK A;  5F36 A;  5LKX A;  3O35 A;  5EM3 A;  5EA1 A;  4O7B A;  4TQN A;  5CQT A;  3AAD A;  4J0S A;  4WIV A;  4YYJ A;  4O72 A;  5JWM A;  5DKH A;  3U5P A;  4NYW A;  4PTB A;  5ENB A;  4LYS A;  4O7F A;  5D25 A;  5A5O A;  4O78 A;  5DFC A;  4A9N A;  3IU5 A;  4YY4 A;  4X2I A;  5FFY A;  5FE4 A;  5E73 A;  4NS5 A;  5KU3 A;  4IR6 A;  5DKD A;  5F61 A;  4AKN A;  4YYH A;  3UW9 A;  5D3N A;  4RVR A;  4O70 A;  5IBN A;  4A9J A;  5I29 A;  4QEV A;  3NXB A;  4DON A;  4MEQ A;  4PCE A;  5DLX A;  5LUU A;  5ENI A;  2RNW A;  4UIZ A;  5FE1 A;  5L98 A;  5D3L A;  5E9L A;  4ALH A;  4LR6 A;  2RFJ A;  5DLZ A;  5ETB A;  3DAI A;  2KTB B;  5KTX A;  2F6N A;  4WHW A;  5E7D A;  3UVY A;  4NYX A;  4NR5 A;  5L97 A;  3U5N A;  3UV2 A;  4XY9 A;  4YK0 A;  4NUE A;  4QSV A;  4YAT A;  4IOR A;  4Y03 A;  3O33 A;  5A82 A;  4XY8 A;  5EVA A; 
#chains in the Genus database with same CATH topology
 2D82 A;  4QZS A;  4NRB A;  4HXN A;  1X0J A;  5LKU A;  5F62 A;  2D9E A;  3I3J A;  5C89 A;  2WP2 A;  4IR4 A;  4YH3 A;  4YYI A;  1ZS5 A;  4QSX A;  3QZS A;  4BHW A;  3U5O A;  3MQM A;  4BW3 A;  5H1T A;  5FFV A;  2YDW A;  1JM4 B;  5LVR A;  5A5S A;  5CPE A;  2FSA A;  5C8G A;  4NQN A;  5IGM A;  4HXL A;  1JSP B;  5EWH A;  4YYK A;  4NUC A;  4QY4 A;  5HQ7 A;  5I86 A;  5LVQ A;  5KHM A;  5EWD A;  5FB0 A;  4O75 A;  5CQ5 A;  3U5K A;  4UIT A;  3U5M A;  5FE9 A;  4MEO A;  3MUL A;  2E7N A;  5CQ4 A;  4CUS A;  3LJW A;  4F3I A;  5HRW A;  4YAB A;  4QSP A;  2YEK A;  3D1D A;  2RNY A;  5E0R A;  5CS8 A;  4TYL A;  4UIU A;  5IG6 A;  5EIS A;  4N4F A;  4LDF A;  5E9I A;  5F2P A;  5IGN A;  5FE2 A;  4PCI A;  1WUG A;  5CUG A;  4QBM A;  4TU4 A;  4YBM A;  5II2 A;  5DW2 A;  4HXM A;  2DWW A;  4O71 A;  2DVV A;  2L5E A;  3MB4 A;  5EK9 A;  5IID A;  5FE5 A;  4QUT A;  3UVD A;  4Q0O A;  4XYA A;  3U5J A;  4UYD A;  5A83 A;  3P1F A;  4CL9 A;  4BW4 A;  5CRM A;  5HLS A;  5LJ0 A;  4O7A A;  3VKH A;  3QZV A;  2WP1 A;  4LC2 A;  5ENG A;  2E3K A;  5CQ7 A;  5BT5 A;  5C7N A;  5FE7 A;  4HXK A;  3TLP A;  5AD3 A;  5DX4 A;  5DBM A;  4QSW A;  5H1U A;  4TT6 A;  3IU6 A;  4O7C A;  4UIY A;  5HEM A;  5BT3 A;  5HQ5 A;  4WHU A;  5G4R A;  4NXJ A;  5CP5 A;  5EPS A;  4NRA A;  4CUP A;  5FH8 A;  5FG6 A;  5FH7 A;  4UIW A;  5E9V A;  5C85 A;  5KO4 A;  5F5Z A;  4TT4 A;  5IGK A;  4TTE A;  5I83 A;  4NR6 A;  5CUD A;  2MJV B;  5D3T A;  5DYU A;  3P5O A;  4J1P A;  5D26 A;  5JI8 A;  3UVX A;  5CZG A;  5FE8 A;  5AD2 A;  2DAT A;  5A81 A;  5D24 A;  4KV1 A;  5LKT A;  3LQI A;  5TCM A;  4TT2 A;  4UYG A;  4MEN A;  5FFW A;  5LJ2 A;  2L85 A;  4HXS A;  5L99 A;  3UV5 A;  3HME A;  5EGU A;  5CUC A;  4AKI A;  4Z6I A;  2RNX A;  3VKG A;  5I88 A;  5FB1 A;  5EWW A;  4YBS A;  5FBX A;  4A9K A;  4FLP A;  5D3S A;  2F6J A;  4IR5 A;  2I7K A;  4QR3 A;  4YC9 A;  3G0L A;  5F60 A;  4OUF A;  5ENF A;  5KTU A;  4YYM A;  5CQA A;  4YYG A;  5IGL A;  5F1H A;  5HCL A;  5HM0 A;  2R0V A;  5ACY A;  5AME A;  4O76 A;  5E9M A;  4LZ2 A;  3ONI A;  5ENE A;  4TZ8 A;  4LYI A;  4PY6 A;  5CTL A;  5L8T A;  2DVR A;  5D3R A;  5ENJ A;  3S92 A;  5L8U A;  4KV4 A;  2H60 A;  5EWV A;  3SVG A;  5D7X A;  5LJ1 A;  4ZC9 A;  5A85 A;  4MR6 A;  3O37 A;  5I1Q A;  2R0S A;  4QSS A;  2YQD A;  5DYA A;  1N72 A;  4Z1S A;  4J0R A;  4QNS A;  4UYH A;  2R10 A;  4NR8 A;  3SVF A;  4C66 A;  1F68 A;  4UYF B;  5E74 A;  4A9L A;  5J0D A;  5CRZ A;  4QC3 A;  5EPR A;  4GPJ A;  5D3P A;  4QYL A;  5CUB A;  5CUA A;  5HFR A;  5I7Y A;  4ZW1 A;  4HXP A;  4TS8 A;  3JVM A;  3D7C A;  4LRG A;  5AMF A;  3Q2E A;  4BW2 A;  4KCX A;  5A5Q A;  5FE3 A;  4CLB A;  4MR5 A;  3MXF A;  5ENC A;  4PKL A;  5CQ6 A;  4YAD A;  3P1D A;  4YAX A;  2OSS A;  4N4H A;  4ALG A;  4BJX A;  5FE0 A;  3LQJ A;  4A9E A;  5DY7 A;  2NXB A;  5H85 A;  4O74 A;  5A5R A;  3LXJ A;  4NRC A;  5HRV A;  5F3A A;  4N4I A;  5F25 A;  5FG4 A;  4CUU A;  5BT4 A;  3FKM X;  4MEP A;  4XUB A;  4UIV A;  4XUA A;  5D3H A;  5A5N A;  5DFD A;  5E3D A;  4CFK A;  4YYN A;  3JVK A;  4QR4 A;  5EU1 A;  5ENH A;  4LYW A;  5CQ3 A;  3O36 A;  5E3G A;  2DVQ A;  3O34 A;  5HEN A;  4ZQL A;  5EIC A;  3ERR A;  4HBX A;  4YBT A;  2RS9 B;  3UVW A;  2YEL A;  5CGP A;  5II1 A;  3JVJ A;  4HXR A;  3GG3 A;  2N9G A;  4UYF A;  4HBV A;  5EP7 A;  2RO1 A;  3AQA A;  2YW5 A;  4CFL A;  1EQF A;  5CFW A;  4OGJ A;  5EV9 A;  5CQ8 A;  3UV4 A;  5CUE A;  3S91 A;  5EWC A;  4QEW A;  5EQ1 A;  5D3J A;  4YH4 A;  2OO1 A;  4NQM A;  4Z6H A;  4J3I A;  4Q0N A;  5EI4 A;  3K2J A;  5CU8 A;  4QB3 A;  1E6I A;  4UIX A;  2LSP B;  4QSU A;  3U5L A;  5LKZ A;  4AI6 A;  4HBY A;  5FG5 A;  3RCW A;  4AKH A;  4A9O A;  5HRX A;  5E9Y A;  2YEM A;  5A7C A;  4N3W A;  3ZYU A;  5FE6 A;  5D0C A;  4HXO A;  4LZS A;  4NR4 A;  4NUD A;  5ETD A;  3SVH A;  2E7O A;  4QST A;  3MB3 A;  4IOQ A;  4LZR A;  4QUU A;  4QSQ A;  5C4Q A;  4YY6 A;  3Q2F A;  5E9K A;  4CUR A;  4UYE A;  5H1V A;  3DWY A;  5HFQ A;  4NYV A;  4N4G A;  5CY9 A;  5DYC A;  5EPB A;  2DKW A;  4NR7 A;  5I7X A;  2RI7 A;  3JVL A;  4MR3 A;  5G4S A;  2G4A A;  2L84 A;  1ZKR A;  5I89 A;  4TZ2 A;  4OGI A;  4IOO A;  5DYX A;  2GRC A;  4Z93 A;  5L96 A;  5FH6 A;  5COI A;  4MR4 A;  4A9H A;  4Z1Q A;  5FDZ A;  1WUM A;  2DVS A;  4TU6 A;  4O7E A;  5C87 A;  3P1C A;  4E96 A;  4QR5 A;  2EJN A;  2R0Y A;  5HJC A;  3G0J A;  4C67 A;  4O77 A;  4QSR A;  5DFB A;  5HEL A;  5F63 A;  5TB6 A;  5F1L A;  4PS5 A;  4YYD A;  5K29 A;  2I8N A;  2OUO A;  4A9M A;  3HMH A;  3P1E A;  4QYD A;  5HQ6 A;  4A9F A;  1PUO A;  3HMF A;  2YYN A;  4NR9 A;  3QZT A;  4A9I A;  4CUQ A;  5I80 A;  5DW1 A;  4BW1 A;  3LQH A;  4CUT A;  4HBW A;  4QC1 A;  5KTW A;  4IR3 A;  4QEU A;  5A5P A;  5DKC A;  5I40 A;  3MUK A;  5F36 A;  5LKX A;  3O35 A;  5EM3 A;  5EA1 A;  4O7B A;  4TQN A;  5CQT A;  3AAD A;  4J0S A;  4WIV A;  4YYJ A;  4O72 A;  5JWM A;  5DKH A;  3U5P A;  4NYW A;  4PTB A;  5ENB A;  4LYS A;  4O7F A;  5D25 A;  5A5O A;  4O78 A;  3D1B A;  5DFC A;  4A9N A;  3IU5 A;  4YY4 A;  4X2I A;  5FFY A;  5FE4 A;  5E73 A;  4NS5 A;  5KU3 A;  4IR6 A;  5DKD A;  5F61 A;  4AKN A;  4YYH A;  3UW9 A;  5D3N A;  4RVR A;  4O70 A;  5IBN A;  4A9J A;  5I29 A;  4QEV A;  3NXB A;  4DON A;  4MEQ A;  4PCE A;  5DLX A;  5LUU A;  5ENI A;  2RNW A;  4UIZ A;  5FE1 A;  5L98 A;  5D3L A;  5E9L A;  4ALH A;  4LR6 A;  2RFJ A;  5DLZ A;  5ETB A;  3DAI A;  4AKG A;  2KTB B;  5KTX A;  2F6N A;  4WHW A;  5E7D A;  3UVY A;  4NYX A;  4NR5 A;  5L97 A;  3U5N A;  3UV2 A;  4XY9 A;  4YK0 A;  4NUE A;  4QSV A;  4YAT A;  4IOR A;  4Y03 A;  3O33 A;  5A82 A;  4XY8 A;  5EVA A; 
#chains in the Genus database with same CATH homology
 2D82 A;  4QZS A;  4NRB A;  4HXN A;  1X0J A;  5LKU A;  5F62 A;  2D9E A;  3I3J A;  5C89 A;  2WP2 A;  4IR4 A;  4YH3 A;  4YYI A;  1ZS5 A;  4QSX A;  3QZS A;  4BHW A;  3U5O A;  3MQM A;  4BW3 A;  5H1T A;  5FFV A;  2YDW A;  1JM4 B;  5LVR A;  5A5S A;  5CPE A;  2FSA A;  5C8G A;  4NQN A;  5IGM A;  4HXL A;  1JSP B;  5EWH A;  4YYK A;  4NUC A;  4QY4 A;  5HQ7 A;  5I86 A;  5LVQ A;  5KHM A;  5EWD A;  5FB0 A;  4O75 A;  5CQ5 A;  3U5K A;  4UIT A;  3U5M A;  5FE9 A;  4MEO A;  3MUL A;  2E7N A;  5CQ4 A;  4CUS A;  3LJW A;  4F3I A;  5HRW A;  4YAB A;  4QSP A;  2YEK A;  2RNY A;  5E0R A;  5CS8 A;  4TYL A;  4UIU A;  5IG6 A;  5EIS A;  4N4F A;  4LDF A;  5E9I A;  5F2P A;  5IGN A;  5FE2 A;  4PCI A;  1WUG A;  5CUG A;  4QBM A;  4TU4 A;  4YBM A;  5II2 A;  5DW2 A;  4HXM A;  2DWW A;  4O71 A;  2DVV A;  2L5E A;  3MB4 A;  5EK9 A;  5IID A;  5FE5 A;  4QUT A;  3UVD A;  4Q0O A;  4XYA A;  3U5J A;  4UYD A;  5A83 A;  3P1F A;  4CL9 A;  4BW4 A;  5CRM A;  5HLS A;  5LJ0 A;  4O7A A;  3QZV A;  2WP1 A;  4LC2 A;  5ENG A;  2E3K A;  5CQ7 A;  5BT5 A;  5C7N A;  5FE7 A;  4HXK A;  3TLP A;  5AD3 A;  5DX4 A;  5DBM A;  4QSW A;  5H1U A;  4TT6 A;  3IU6 A;  4O7C A;  4UIY A;  5HEM A;  5BT3 A;  5HQ5 A;  4WHU A;  5G4R A;  4NXJ A;  5CP5 A;  5EPS A;  4NRA A;  4CUP A;  5FH8 A;  5FG6 A;  5FH7 A;  4UIW A;  5E9V A;  5C85 A;  5KO4 A;  5F5Z A;  4TT4 A;  5IGK A;  4TTE A;  5I83 A;  4NR6 A;  5CUD A;  2MJV B;  5D3T A;  5DYU A;  3P5O A;  4J1P A;  5D26 A;  5JI8 A;  3UVX A;  5CZG A;  5FE8 A;  5AD2 A;  2DAT A;  5A81 A;  5D24 A;  4KV1 A;  5LKT A;  3LQI A;  5TCM A;  4TT2 A;  4UYG A;  4MEN A;  5FFW A;  5LJ2 A;  2L85 A;  4HXS A;  5L99 A;  3UV5 A;  3HME A;  5EGU A;  5CUC A;  4Z6I A;  2RNX A;  5I88 A;  5FB1 A;  5EWW A;  4YBS A;  5FBX A;  4A9K A;  4FLP A;  5D3S A;  2F6J A;  4IR5 A;  2I7K A;  4QR3 A;  4YC9 A;  3G0L A;  5F60 A;  4OUF A;  5ENF A;  5KTU A;  4YYM A;  5CQA A;  4YYG A;  5IGL A;  5F1H A;  5HCL A;  5HM0 A;  2R0V A;  5ACY A;  5AME A;  4O76 A;  5E9M A;  4LZ2 A;  3ONI A;  5ENE A;  4TZ8 A;  4LYI A;  4PY6 A;  5CTL A;  5L8T A;  2DVR A;  5D3R A;  5ENJ A;  3S92 A;  5L8U A;  4KV4 A;  2H60 A;  5EWV A;  3SVG A;  5D7X A;  5LJ1 A;  4ZC9 A;  5A85 A;  4MR6 A;  3O37 A;  5I1Q A;  2R0S A;  4QSS A;  2YQD A;  5DYA A;  1N72 A;  4Z1S A;  4J0R A;  4QNS A;  4UYH A;  2R10 A;  4NR8 A;  3SVF A;  4C66 A;  1F68 A;  4UYF B;  5E74 A;  4A9L A;  5J0D A;  5CRZ A;  4QC3 A;  5EPR A;  4GPJ A;  5D3P A;  4QYL A;  5CUB A;  5CUA A;  5HFR A;  5I7Y A;  4ZW1 A;  4HXP A;  4TS8 A;  3JVM A;  3D7C A;  4LRG A;  5AMF A;  3Q2E A;  4BW2 A;  4KCX A;  5A5Q A;  5FE3 A;  4CLB A;  4MR5 A;  3MXF A;  5ENC A;  4PKL A;  5CQ6 A;  4YAD A;  3P1D A;  4YAX A;  2OSS A;  4N4H A;  4ALG A;  4BJX A;  5FE0 A;  3LQJ A;  4A9E A;  5DY7 A;  2NXB A;  5H85 A;  4O74 A;  5A5R A;  3LXJ A;  4NRC A;  5HRV A;  5F3A A;  4N4I A;  5F25 A;  5FG4 A;  4CUU A;  5BT4 A;  3FKM X;  4MEP A;  4XUB A;  4UIV A;  4XUA A;  5D3H A;  5A5N A;  5DFD A;  5E3D A;  4CFK A;  4YYN A;  3JVK A;  4QR4 A;  5EU1 A;  5ENH A;  4LYW A;  5CQ3 A;  3O36 A;  5E3G A;  2DVQ A;  3O34 A;  5HEN A;  4ZQL A;  5EIC A;  4HBX A;  4YBT A;  2RS9 B;  3UVW A;  2YEL A;  5CGP A;  5II1 A;  3JVJ A;  4HXR A;  3GG3 A;  2N9G A;  4UYF A;  4HBV A;  5EP7 A;  2RO1 A;  3AQA A;  2YW5 A;  4CFL A;  1EQF A;  5CFW A;  4OGJ A;  5EV9 A;  5CQ8 A;  3UV4 A;  5CUE A;  3S91 A;  5EWC A;  4QEW A;  5EQ1 A;  5D3J A;  4YH4 A;  2OO1 A;  4NQM A;  4Z6H A;  4J3I A;  4Q0N A;  5EI4 A;  3K2J A;  5CU8 A;  4QB3 A;  1E6I A;  4UIX A;  2LSP B;  4QSU A;  3U5L A;  5LKZ A;  4HBY A;  5FG5 A;  3RCW A;  4A9O A;  5HRX A;  5E9Y A;  2YEM A;  5A7C A;  4N3W A;  3ZYU A;  5FE6 A;  5D0C A;  4HXO A;  4LZS A;  4NR4 A;  4NUD A;  5ETD A;  3SVH A;  2E7O A;  4QST A;  3MB3 A;  4IOQ A;  4LZR A;  4QUU A;  4QSQ A;  5C4Q A;  4YY6 A;  3Q2F A;  5E9K A;  4CUR A;  4UYE A;  5H1V A;  3DWY A;  5HFQ A;  4NYV A;  4N4G A;  5CY9 A;  5DYC A;  5EPB A;  2DKW A;  4NR7 A;  5I7X A;  2RI7 A;  3JVL A;  4MR3 A;  5G4S A;  2G4A A;  2L84 A;  5I89 A;  4TZ2 A;  4OGI A;  4IOO A;  5DYX A;  2GRC A;  4Z93 A;  5L96 A;  5FH6 A;  5COI A;  4MR4 A;  4A9H A;  4Z1Q A;  5FDZ A;  1WUM A;  2DVS A;  4TU6 A;  4O7E A;  5C87 A;  3P1C A;  4E96 A;  4QR5 A;  2R0Y A;  5HJC A;  3G0J A;  4C67 A;  4O77 A;  4QSR A;  5DFB A;  5HEL A;  5F63 A;  5TB6 A;  5F1L A;  4PS5 A;  4YYD A;  5K29 A;  2I8N A;  2OUO A;  4A9M A;  3HMH A;  3P1E A;  4QYD A;  5HQ6 A;  4A9F A;  3HMF A;  2YYN A;  4NR9 A;  3QZT A;  4A9I A;  4CUQ A;  5I80 A;  5DW1 A;  4BW1 A;  3LQH A;  4CUT A;  4HBW A;  4QC1 A;  5KTW A;  4IR3 A;  4QEU A;  5A5P A;  5DKC A;  5I40 A;  3MUK A;  5F36 A;  5LKX A;  3O35 A;  5EM3 A;  5EA1 A;  4O7B A;  4TQN A;  5CQT A;  3AAD A;  4J0S A;  4WIV A;  4YYJ A;  4O72 A;  5JWM A;  5DKH A;  3U5P A;  4NYW A;  4PTB A;  5ENB A;  4LYS A;  4O7F A;  5D25 A;  5A5O A;  4O78 A;  5DFC A;  4A9N A;  3IU5 A;  4YY4 A;  4X2I A;  5FFY A;  5FE4 A;  5E73 A;  4NS5 A;  5KU3 A;  4IR6 A;  5DKD A;  5F61 A;  4AKN A;  4YYH A;  3UW9 A;  5D3N A;  4RVR A;  4O70 A;  5IBN A;  4A9J A;  5I29 A;  4QEV A;  3NXB A;  4DON A;  4MEQ A;  4PCE A;  5DLX A;  5LUU A;  5ENI A;  2RNW A;  4UIZ A;  5FE1 A;  5L98 A;  5D3L A;  5E9L A;  4ALH A;  4LR6 A;  2RFJ A;  5DLZ A;  5ETB A;  3DAI A;  2KTB B;  5KTX A;  2F6N A;  4WHW A;  5E7D A;  3UVY A;  4NYX A;  4NR5 A;  5L97 A;  3U5N A;  3UV2 A;  4XY9 A;  4YK0 A;  4NUE A;  4QSV A;  4YAT A;  4IOR A;  4Y03 A;  3O33 A;  5A82 A;  4XY8 A;  5EVA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...