4XY8A

Crystal structure of the bromodomain of brd9 in complex with a 2-amine-9h-purine ligand
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
113
structure length
113
Chain Sequence
STPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDFGTMKDKIVANEYKSVTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMSKERLLALKRSMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Bromodomain-containing protein 9
publication title 9H-Purine Scaffold Reveals Induced-Fit Pocket Plasticity of the BRD9 Bromodomain.
pubmed doi rcsb
source organism Homo sapiens
total genus 42
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2015-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4xy8A00
2YQDA 4BJXA 5F1HA 4BW1A 5CQ3A 4TS8A 5CQ4A 5E9LA 5E3DA 3U5OA 3UV2A 2KTBB 4QSRA 3P1DA 3Q2FA 4ZQLA 5DKHA 4YBSA 5ENHA 1X0JA 5D0CA 5FFYA 5DFCA 3MXFA 4N4GA 4YYKA 3SVHA 4A9IA 4MEQA 5CUDA 5KHMA 3U5PA 4N4FA 5A7CA 4J0SA 4QZSA 3I3JA 5F63A 2GRCA 4UIYA 4UYDA 4HXLA 4PKLA 3MB3A 3QZSA 1EQFA 5ENIA 2RNWA 4UYFA 4QSTA 4O7AA 2OSSA 4X2IA 5F25A 4YBMA 5CQ5A 5I88A 5FB1A 2DATA 5DYXA 5FG5A 4YYIA 1N72A 5FBXA 5H1UA 5HELA 5AD2A 4NRCA 4MR5A 5CY9A 4N4HA 3JVJA 3SVFA 5AD3A 5LJ1A 4O78A 2MJVB 4MEOA 5EWWA 4LRGA 5KTXA 4TU4A 5F60A 5D3RA 5I7XA 5A83A 5DBMA 4NUCA 5L96A 5A82A 2I8NA 4HXOA 5EU1A 3U5LA 1F68A 4QEVA 3JVLA 5BT4A 2G4AA 3ONIA 5I29A 4UITA 4NRBA 3K2JA 5ETBA 4CFKA 4KV4A 5CP5A 5E3GA 3UVYA 3MUKA 4UIXA 4LDFA 4MENA 4BW3A 4MR6A 3FKMX 4LZSA 5LKTA 4IR6A 5I89A 5D3JA 4J1PA 5H85A 5CU8A 3LXJA 4PCEA 5CUGA 5L8TA 4YYNA 4QYLA 4CLBA 3QZTA 4O74A 5I40A 4QUUA 4N3WA 5EVAA 3UW9A 4QYDA 4MR3A 4O7CA 5CPEA 3U5NA 5ETDA 5C4QA 5F2PA 5KU3A 5FE8A 2L84A 5FFVA 3O37A 5DYCA 4IR3A 4BHWA 4J3IA 5DLXA 5DX4A 3O34A 5HJCA 4BW2A 3MULA 4O7FA 4TTEA 4HXMA 4TT6A 5FB0A 4QSXA 4HXRA 4UYGA 4LYWA 5EM3A 4O77A 5D25A 4CUTA 2RNYA 3UV5A 2I7KA 4YADA 5FG6A 3IU5A 5F5ZA 5A5QA 5JWMA 4A9LA 5FE0A 3AADA 4O76A 5L97A 4A9JA 2DVRA 4QSSA 5DKDA 5CGPA 4WHWA 4NUEA 5EISA 4NR9A 4UIZA 5CRMA 3U5KA 2H60A 4IOOA 4C67A 4QBMA 4YY6A 3QZVA 4ALGA 5ENJA 4PS5A 3JVKA 4E96A 4QNSA 2L5EA 5E9IA 5CTLA 5D26A 5ACYA 4QSQA 5DYAA 3LQHA 5L8UA 4WIVA 2L85A 5FE9A 4WHUA 5F62A 4NUDA 2D82A 5AMFA 4IOQA 4YH4A 5C89A 4NR4A 4PY6A 2E7OA 4C66A 5EQ1A 4OUFA 4Z6IA 5BT3A 5E74A 5FDZA 5HQ5A 3NXBA 5DFDA 3HMEA 4LR6A 5EWDA 4ALHA 2DVVA 5FFWA 2WP2A 4O75A 2E7NA 4YBTA 5II2A 5I83A 4OGJA 4HBYA 5CUEA 4LC2A 4NQMA 4Q0NA 4YK0A 4YY4A 5FH8A 2F6NA 4O71A 5G4SA 5EI4A 2DVSA 4XUBA 3LJWA 4YC9A 3MB4A 3LQJA 5L99A 1JM4B 4LYSA 4ZW1A 2LSPB 1JSPB 3HMFA 5EWHA 5K29A 4CUSA 3UVXA 4Q0OA 5LKZA 3P1CA 3U5MA 5E9KA 5EGUA 5HRXA 5E7DA 4A9FA 4CURA 5HQ6A 4TQNA 5D3LA 5EPSA 3HMHA 2YEMA 4Y03A 4NR8A 4YYJA 2YELA 3O33A 4UIWA 5ENCA 5EP7A 4YYDA 2YDWA 4YYMA 5LUUA 5FG4A 5D3HA 5HCLA 4F3IA 5CFWA 5IIDA 4TYLA 5FH6A 2FSAA 5EICA 5DYUA 4QEWA 5L98A 4IORA 4UIUA 2YW5A 4TT4A 5FE3A 4KV1A 4LZ2A 5IGKA 3G0JA 5EA1A 4A9OA 4XY9A 2YYNA 5BT5A 1WUGA 5CUBA 4QR4A 5CUAA 4CUUA 4O72A 5FH7A 5CRZA 5HENA 4YABA 5HRWA 5HFRA 5EK9A 5ENEA 4IR5A 4NR5A 4NYXA 5DW1A 5IG6A 4O70A 4UYHA 5JI8A 4UYFB 5IBNA 2DKWA 3RCWA 4Z6HA 5A5SA 4QY4A 5LKXA 3Q2EA 3S92A 5C7NA 5J0DA 5C87A 3U5JA 5I7YA 1ZS5A 5HQ7A 4HXSA 4HXKA 5EPBA 4TT2A 4HXNA 5CQAA 4MEPA 5IGMA 5DW2A 5A85A 5D7XA 4HXPA 4LYIA 5G4RA 3UVDA 4CUQA 3LQIA 3P1EA 2YEKA 3GG3A 4QR5A 5II1A 4YH3A 5CQ8A 4PTBA 4QUTA 2N9GA 4NS5A 4QC1A 4QEUA 5IGNA 4XUAA 5HLSA 4N4IA 3ZYUA 2R10A 5F36A 3G0LA 5LVQA 2R0VA 5A5RA 4Z1QA 5CZGA 5D3TA 3SVGA 3O36A 3DAIA 3IU6A 4QSUA 5ENBA 4FLPA 5E0RA 4A9EA 4A9KA 4Z1SA 4J0RA 4NYWA 4QSWA 5FE1A 4NRAA 5KTWA 4QB3A 3UVWA 4UIVA 2R0SA 2F6JA 5F61A 4NR6A 5TB6A 2DVQA 5A5NA 5FE2A 5DLZA 5D3PA 4PCIA 4CFLA 5A5PA 5H1TA 3P5OA 5CQTA 4QR3A 1WUMA 2OUOA 5CS8A 4HBVA 4GPJA 5E9VA 4YAXA 5FE7A 5LVRA 4Z93A 2NXBA 5D3NA 2D9EA 5I80A 2E3KA 5E73A 3S91A 4A9NA 5F3AA 4NQNA 5CQ6A 4IR4A 4XYAA 2DWWA 5HRVA 4CUPA 4ZC9A 4CL9A 5C8GA 5CQ7A 5I86A 2RO1A 4KCXA 4OGIA 4XY8A 4YYHA 5ENGA 5DY7A 5F1LA 5TCMA 4NR7A 5HEMA 5A5OA 4QSVA 4NXJA 4TZ8A 3DWYA 2RS9B 4YYGA 3O35A 5FE6A 4HBXA 2OO1A 4TU6A 4NYVA 4HBWA 5IGLA 5KO4A 2RI7A 3JVMA 4TZ2A 4LZRA 2R0YA 4O7EA 1E6IA 5C85A 5E9MA 4DONA 2RFJA 4BW4A 4MR4A 4UYEA 5E9YA 5A81A 4QC3A 5DFBA 4AKNA 4QSPA 5LJ2A 5D24A 4YATA 4A9MA 5D3SA 5COIA 5EWVA 5HFQA 4RVRA 3P1FA 5HM0A 3TLPA 4A9HA 5EWCA 5EPRA 5FE5A 3AQAA 5LKUA 3UV4A 3D7CA 5ENFA 3MQMA 2RNXA 5FE4A 5LJ0A 5CUCA 5EV9A 5KTUA 5AMEA 5I1QA 5H1VA 4O7BA 5DKCA 2WP1A
chains in the Genus database with same CATH superfamily
2YQDA 4BJXA 5F1HA 4BW1A 5CQ3A 4TS8A 5CQ4A 5E9LA 5E3DA 3U5OA 3UV2A 2KTBB 4QSRA 3P1DA 3Q2FA 4ZQLA 5DKHA 4YBSA 5ENHA 1X0JA 5D0CA 5FFYA 5DFCA 3MXFA 4N4GA 4YYKA 3SVHA 4A9IA 4MEQA 5CUDA 5KHMA 3U5PA 4N4FA 5A7CA 4J0SA 4QZSA 3I3JA 5F63A 2GRCA 4UIYA 3VKGA 4UYDA 4HXLA 4PKLA 3MB3A 3QZSA 1EQFA 5ENIA 2RNWA 4UYFA 4QSTA 4O7AA 2OSSA 4X2IA 5F25A 4YBMA 3VKHA 5CQ5A 5I88A 5FB1A 2DATA 5DYXA 5FG5A 4YYIA 1N72A 5FBXA 5H1UA 5HELA 5AD2A 4NRCA 4MR5A 5CY9A 4N4HA 3JVJA 3SVFA 5AD3A 5LJ1A 4O78A 2MJVB 4MEOA 5EWWA 4LRGA 5KTXA 4TU4A 5F60A 5D3RA 5I7XA 5A83A 5DBMA 4NUCA 5L96A 5A82A 2I8NA 4HXOA 5EU1A 3U5LA 1F68A 4QEVA 3JVLA 5BT4A 2G4AA 4AKHA 3ONIA 5I29A 4UITA 4NRBA 3K2JA 5ETBA 4CFKA 4KV4A 5CP5A 5E3GA 3UVYA 3MUKA 4UIXA 4LDFA 4MENA 4BW3A 4MR6A 3FKMX 4LZSA 5LKTA 4IR6A 5I89A 5D3JA 4J1PA 5H85A 5CU8A 3LXJA 4PCEA 5CUGA 5L8TA 4YYNA 4QYLA 4CLBA 3QZTA 4O74A 5I40A 4QUUA 4N3WA 5EVAA 3UW9A 4QYDA 4MR3A 4O7CA 5CPEA 3U5NA 5ETDA 5C4QA 5F2PA 5KU3A 5FE8A 2L84A 5FFVA 3O37A 5DYCA 4IR3A 4BHWA 4J3IA 5DLXA 5DX4A 3O34A 5HJCA 4BW2A 3MULA 4O7FA 4TTEA 4HXMA 4TT6A 5FB0A 4QSXA 4HXRA 4UYGA 4LYWA 5EM3A 4O77A 5D25A 4CUTA 2RNYA 3UV5A 2I7KA 4YADA 5FG6A 3IU5A 5F5ZA 5A5QA 5JWMA 4A9LA 5FE0A 3AADA 4O76A 5L97A 4A9JA 2DVRA 4QSSA 5DKDA 5CGPA 4WHWA 4NUEA 5EISA 4NR9A 4UIZA 5CRMA 3U5KA 2H60A 4IOOA 4C67A 4QBMA 4YY6A 3QZVA 4ALGA 5ENJA 4PS5A 3JVKA 4E96A 4QNSA 2L5EA 5E9IA 5CTLA 5D26A 5ACYA 4QSQA 5DYAA 3LQHA 5L8UA 4WIVA 2L85A 5FE9A 4WHUA 5F62A 4NUDA 2D82A 5AMFA 4IOQA 4YH4A 5C89A 4NR4A 4PY6A 2E7OA 4C66A 5EQ1A 4OUFA 4Z6IA 5BT3A 5E74A 5FDZA 5HQ5A 3NXBA 5DFDA 3HMEA 4LR6A 5EWDA 4ALHA 2DVVA 5FFWA 2WP2A 4O75A 2E7NA 4YBTA 5II2A 5I83A 4OGJA 4HBYA 5CUEA 4LC2A 4NQMA 4Q0NA 4YK0A 4YY4A 5FH8A 2F6NA 4O71A 5G4SA 5EI4A 2DVSA 4XUBA 3LJWA 4YC9A 3MB4A 3LQJA 5L99A 1JM4B 4LYSA 4ZW1A 2LSPB 1JSPB 3HMFA 5EWHA 5K29A 4CUSA 3UVXA 4Q0OA 5LKZA 3P1CA 3U5MA 5E9KA 5EGUA 5HRXA 5E7DA 4A9FA 4CURA 5HQ6A 4TQNA 5D3LA 5EPSA 3HMHA 2YEMA 4Y03A 4NR8A 4YYJA 2YELA 3O33A 4UIWA 5ENCA 5EP7A 4YYDA 2YDWA 4YYMA 5LUUA 5FG4A 5D3HA 5HCLA 4F3IA 5CFWA 5IIDA 4TYLA 5FH6A 2FSAA 5EICA 5DYUA 4AKGA 4QEWA 5L98A 4IORA 4UIUA 2YW5A 3D1DA 4TT4A 5FE3A 4KV1A 4LZ2A 1PUOA 5IGKA 3G0JA 5EA1A 4A9OA 4XY9A 2YYNA 5BT5A 1WUGA 5CUBA 4QR4A 5CUAA 4CUUA 4O72A 5FH7A 5CRZA 5HENA 4YABA 5HRWA 5HFRA 5EK9A 5ENEA 4IR5A 4NR5A 4NYXA 5DW1A 5IG6A 4O70A 4UYHA 5JI8A 4UYFB 5IBNA 2DKWA 3RCWA 4Z6HA 5A5SA 4QY4A 2EJNA 5LKXA 3Q2EA 3S92A 5C7NA 5J0DA 5C87A 3U5JA 4AKIA 5I7YA 1ZS5A 5HQ7A 4HXSA 4HXKA 5EPBA 4TT2A 4HXNA 3ERRA 5CQAA 4MEPA 5IGMA 5DW2A 5A85A 5D7XA 4HXPA 4LYIA 5G4RA 3UVDA 4CUQA 3LQIA 3P1EA 2YEKA 3GG3A 4QR5A 5II1A 4YH3A 5CQ8A 4PTBA 4QUTA 2N9GA 4NS5A 4QC1A 4QEUA 5IGNA 4XUAA 5HLSA 4N4IA 3ZYUA 2R10A 5F36A 3G0LA 5LVQA 2R0VA 5A5RA 4Z1QA 5CZGA 5D3TA 3SVGA 3O36A 3DAIA 3IU6A 4QSUA 5ENBA 4FLPA 4AI6A 5E0RA 4A9EA 4A9KA 4Z1SA 4J0RA 4NYWA 4QSWA 5FE1A 4NRAA 1ZKRA 5KTWA 4QB3A 3UVWA 4UIVA 2R0SA 2F6JA 5F61A 4NR6A 5TB6A 2DVQA 5A5NA 5FE2A 5DLZA 5D3PA 4PCIA 4CFLA 5A5PA 5H1TA 3P5OA 5CQTA 4QR3A 1WUMA 2OUOA 5CS8A 4HBVA 4GPJA 5E9VA 4YAXA 5FE7A 5LVRA 4Z93A 2NXBA 5D3NA 2D9EA 5I80A 2E3KA 5E73A 3S91A 4A9NA 5F3AA 4NQNA 5CQ6A 4IR4A 4XYAA 2DWWA 5HRVA 4CUPA 4ZC9A 4CL9A 5C8GA 5CQ7A 5I86A 2RO1A 4KCXA 4OGIA 4XY8A 4YYHA 5ENGA 5DY7A 5F1LA 5TCMA 4NR7A 5HEMA 5A5OA 4QSVA 4NXJA 4TZ8A 3DWYA 2RS9B 4YYGA 3D1BA 3O35A 5FE6A 4HBXA 2OO1A 4TU6A 4NYVA 4HBWA 5IGLA 5KO4A 2RI7A 3JVMA 4TZ2A 4LZRA 2R0YA 4O7EA 1E6IA 5C85A 5E9MA 4DONA 2RFJA 4BW4A 4MR4A 4UYEA 5E9YA 5A81A 4QC3A 5DFBA 4AKNA 4QSPA 5LJ2A 5D24A 4YATA 4A9MA 5D3SA 5COIA 5EWVA 5HFQA 4RVRA 3P1FA 5HM0A 3TLPA 4A9HA 5EWCA 5EPRA 5FE5A 3AQAA 5LKUA 3UV4A 3D7CA 5ENFA 3MQMA 2RNXA 5FE4A 5LJ0A 5CUCA 5EV9A 5KTUA 5AMEA 5I1QA 5H1VA 4O7BA 5DKCA 2WP1A
chains in the Genus database with same CATH topology
2YQDA 4BJXA 5F1HA 4BW1A 5CQ3A 4TS8A 5CQ4A 5E9LA 5E3DA 3U5OA 3UV2A 2KTBB 4QSRA 3P1DA 3Q2FA 4ZQLA 5DKHA 4YBSA 5ENHA 1X0JA 5D0CA 5FFYA 5DFCA 3MXFA 4N4GA 4YYKA 3SVHA 4A9IA 4MEQA 5CUDA 5KHMA 3U5PA 4N4FA 5A7CA 4J0SA 4QZSA 3I3JA 5F63A 2GRCA 4UIYA 4UYDA 4HXLA 4PKLA 3MB3A 3QZSA 1EQFA 5ENIA 2RNWA 4UYFA 4QSTA 4O7AA 2OSSA 4X2IA 5F25A 4YBMA 5CQ5A 5I88A 5FB1A 2DATA 5DYXA 5FG5A 4YYIA 1N72A 5FBXA 5H1UA 5HELA 5AD2A 4NRCA 4MR5A 5CY9A 4N4HA 3JVJA 3SVFA 5AD3A 5LJ1A 4O78A 2MJVB 4MEOA 5EWWA 4LRGA 5KTXA 4TU4A 5F60A 5D3RA 5I7XA 5A83A 5DBMA 4NUCA 5L96A 5A82A 2I8NA 4HXOA 5EU1A 3U5LA 1F68A 4QEVA 3JVLA 5BT4A 2G4AA 3ONIA 5I29A 4UITA 4NRBA 3K2JA 5ETBA 4CFKA 4KV4A 5CP5A 5E3GA 3UVYA 3MUKA 4UIXA 4LDFA 4MENA 4BW3A 4MR6A 3FKMX 4LZSA 5LKTA 4IR6A 5I89A 5D3JA 4J1PA 5H85A 5CU8A 3LXJA 4PCEA 5CUGA 5L8TA 4YYNA 4QYLA 4CLBA 3QZTA 4O74A 5I40A 4QUUA 4N3WA 5EVAA 3UW9A 4QYDA 4MR3A 4O7CA 5CPEA 3U5NA 5ETDA 5C4QA 5F2PA 5KU3A 5FE8A 2L84A 5FFVA 3O37A 5DYCA 4IR3A 4BHWA 4J3IA 5DLXA 5DX4A 3O34A 5HJCA 4BW2A 3MULA 4O7FA 4TTEA 4HXMA 4TT6A 5FB0A 4QSXA 4HXRA 4UYGA 4LYWA 5EM3A 4O77A 5D25A 4CUTA 2RNYA 3UV5A 2I7KA 4YADA 5FG6A 3IU5A 5F5ZA 5A5QA 5JWMA 4A9LA 5FE0A 3AADA 4O76A 5L97A 4A9JA 2DVRA 4QSSA 5DKDA 5CGPA 4WHWA 4NUEA 5EISA 4NR9A 4UIZA 5CRMA 3U5KA 2H60A 4IOOA 4C67A 4QBMA 4YY6A 3QZVA 4ALGA 5ENJA 4PS5A 3JVKA 4E96A 4QNSA 2L5EA 5E9IA 5CTLA 5D26A 5ACYA 4QSQA 5DYAA 3LQHA 5L8UA 4WIVA 2L85A 5FE9A 4WHUA 5F62A 4NUDA 2D82A 5AMFA 4IOQA 4YH4A 5C89A 4NR4A 4PY6A 2E7OA 4C66A 5EQ1A 4OUFA 4Z6IA 5BT3A 5E74A 5FDZA 5HQ5A 3NXBA 5DFDA 3HMEA 4LR6A 5EWDA 4ALHA 2DVVA 5FFWA 2WP2A 4O75A 2E7NA 4YBTA 5II2A 5I83A 4OGJA 4HBYA 5CUEA 4LC2A 4NQMA 4Q0NA 4YK0A 4YY4A 5FH8A 2F6NA 4O71A 5G4SA 5EI4A 2DVSA 4XUBA 3LJWA 4YC9A 3MB4A 3LQJA 5L99A 1JM4B 4LYSA 4ZW1A 2LSPB 1JSPB 3HMFA 5EWHA 5K29A 4CUSA 3UVXA 4Q0OA 5LKZA 3P1CA 3U5MA 5E9KA 5EGUA 5HRXA 5E7DA 4A9FA 4CURA 5HQ6A 4TQNA 5D3LA 5EPSA 3HMHA 2YEMA 4Y03A 4NR8A 4YYJA 2YELA 3O33A 4UIWA 5ENCA 5EP7A 4YYDA 2YDWA 4YYMA 5LUUA 5FG4A 5D3HA 5HCLA 4F3IA 5CFWA 5IIDA 4TYLA 5FH6A 2FSAA 5EICA 5DYUA 4QEWA 5L98A 4IORA 4UIUA 2YW5A 4TT4A 5FE3A 4KV1A 4LZ2A 5IGKA 3G0JA 5EA1A 4A9OA 4XY9A 2YYNA 5BT5A 1WUGA 5CUBA 4QR4A 5CUAA 4CUUA 4O72A 5FH7A 5CRZA 5HENA 4YABA 5HRWA 5HFRA 5EK9A 5ENEA 4IR5A 4NR5A 4NYXA 5DW1A 5IG6A 4O70A 4UYHA 5JI8A 4UYFB 5IBNA 2DKWA 3RCWA 4Z6HA 5A5SA 4QY4A 5LKXA 3Q2EA 3S92A 5C7NA 5J0DA 5C87A 3U5JA 5I7YA 1ZS5A 5HQ7A 4HXSA 4HXKA 5EPBA 4TT2A 4HXNA 5CQAA 4MEPA 5IGMA 5DW2A 5A85A 5D7XA 4HXPA 4LYIA 5G4RA 3UVDA 4CUQA 3LQIA 3P1EA 2YEKA 3GG3A 4QR5A 5II1A 4YH3A 5CQ8A 4PTBA 4QUTA 2N9GA 4NS5A 4QC1A 4QEUA 5IGNA 4XUAA 5HLSA 4N4IA 3ZYUA 2R10A 5F36A 3G0LA 5LVQA 2R0VA 5A5RA 4Z1QA 5CZGA 5D3TA 3SVGA 3O36A 3DAIA 3IU6A 4QSUA 5ENBA 4FLPA 5E0RA 4A9EA 4A9KA 4Z1SA 4J0RA 4NYWA 4QSWA 5FE1A 4NRAA 5KTWA 4QB3A 3UVWA 4UIVA 2R0SA 2F6JA 5F61A 4NR6A 5TB6A 2DVQA 5A5NA 5FE2A 5DLZA 5D3PA 4PCIA 4CFLA 5A5PA 5H1TA 3P5OA 5CQTA 4QR3A 1WUMA 2OUOA 5CS8A 4HBVA 4GPJA 5E9VA 4YAXA 5FE7A 5LVRA 4Z93A 2NXBA 5D3NA 2D9EA 5I80A 2E3KA 5E73A 3S91A 4A9NA 5F3AA 4NQNA 5CQ6A 4IR4A 4XYAA 2DWWA 5HRVA 4CUPA 4ZC9A 4CL9A 5C8GA 5CQ7A 5I86A 2RO1A 4KCXA 4OGIA 4XY8A 4YYHA 5ENGA 5DY7A 5F1LA 5TCMA 4NR7A 5HEMA 5A5OA 4QSVA 4NXJA 4TZ8A 3DWYA 2RS9B 4YYGA 3O35A 5FE6A 4HBXA 2OO1A 4TU6A 4NYVA 4HBWA 5IGLA 5KO4A 2RI7A 3JVMA 4TZ2A 4LZRA 2R0YA 4O7EA 1E6IA 5C85A 5E9MA 4DONA 2RFJA 4BW4A 4MR4A 4UYEA 5E9YA 5A81A 4QC3A 5DFBA 4AKNA 4QSPA 5LJ2A 5D24A 4YATA 4A9MA 5D3SA 5COIA 5EWVA 5HFQA 4RVRA 3P1FA 5HM0A 3TLPA 4A9HA 5EWCA 5EPRA 5FE5A 3AQAA 5LKUA 3UV4A 3D7CA 5ENFA 3MQMA 2RNXA 5FE4A 5LJ0A 5CUCA 5EV9A 5KTUA 5AMEA 5I1QA 5H1VA 4O7BA 5DKCA 2WP1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YQD A;  4BJX A;  5F1H A;  4BW1 A;  5CQ3 A;  4TS8 A;  5CQ4 A;  5E9L A;  5E3D A;  3U5O A;  3UV2 A;  2KTB B;  4QSR A;  3P1D A;  3Q2F A;  4ZQL A;  5DKH A;  4YBS A;  5ENH A;  1X0J A;  5D0C A;  5FFY A;  5DFC A;  3MXF A;  4N4G A;  4YYK A;  3SVH A;  4A9I A;  4MEQ A;  5CUD A;  5KHM A;  3U5P A;  4N4F A;  5A7C A;  4J0S A;  4QZS A;  3I3J A;  5F63 A;  2GRC A;  4UIY A;  4UYD A;  4HXL A;  4PKL A;  3MB3 A;  3QZS A;  1EQF A;  5ENI A;  2RNW A;  4UYF A;  4QST A;  4O7A A;  2OSS A;  4X2I A;  5F25 A;  4YBM A;  5CQ5 A;  5I88 A;  5FB1 A;  2DAT A;  5DYX A;  5FG5 A;  4YYI A;  1N72 A;  5FBX A;  5H1U A;  5HEL A;  5AD2 A;  4NRC A;  4MR5 A;  5CY9 A;  4N4H A;  3JVJ A;  3SVF A;  5AD3 A;  5LJ1 A;  4O78 A;  2MJV B;  4MEO A;  5EWW A;  4LRG A;  5KTX A;  4TU4 A;  5F60 A;  5D3R A;  5I7X A;  5A83 A;  5DBM A;  4NUC A;  5L96 A;  5A82 A;  2I8N A;  4HXO A;  5EU1 A;  3U5L A;  1F68 A;  4QEV A;  3JVL A;  5BT4 A;  2G4A A;  3ONI A;  5I29 A;  4UIT A;  4NRB A;  3K2J A;  5ETB A;  4CFK A;  4KV4 A;  5CP5 A;  5E3G A;  3UVY A;  3MUK A;  4UIX A;  4LDF A;  4MEN A;  4BW3 A;  4MR6 A;  3FKM X;  4LZS A;  5LKT A;  4IR6 A;  5I89 A;  5D3J A;  4J1P A;  5H85 A;  5CU8 A;  3LXJ A;  4PCE A;  5CUG A;  5L8T A;  4YYN A;  4QYL A;  4CLB A;  3QZT A;  4O74 A;  5I40 A;  4QUU A;  4N3W A;  5EVA A;  3UW9 A;  4QYD A;  4MR3 A;  4O7C A;  5CPE A;  3U5N A;  5ETD A;  5C4Q A;  5F2P A;  5KU3 A;  5FE8 A;  2L84 A;  5FFV A;  3O37 A;  5DYC A;  4IR3 A;  4BHW A;  4J3I A;  5DLX A;  5DX4 A;  3O34 A;  5HJC A;  4BW2 A;  3MUL A;  4O7F A;  4TTE A;  4HXM A;  4TT6 A;  5FB0 A;  4QSX A;  4HXR A;  4UYG A;  4LYW A;  5EM3 A;  4O77 A;  5D25 A;  4CUT A;  2RNY A;  3UV5 A;  2I7K A;  4YAD A;  5FG6 A;  3IU5 A;  5F5Z A;  5A5Q A;  5JWM A;  4A9L A;  5FE0 A;  3AAD A;  4O76 A;  5L97 A;  4A9J A;  2DVR A;  4QSS A;  5DKD A;  5CGP A;  4WHW A;  4NUE A;  5EIS A;  4NR9 A;  4UIZ A;  5CRM A;  3U5K A;  2H60 A;  4IOO A;  4C67 A;  4QBM A;  4YY6 A;  3QZV A;  4ALG A;  5ENJ A;  4PS5 A;  3JVK A;  4E96 A;  4QNS A;  2L5E A;  5E9I A;  5CTL A;  5D26 A;  5ACY A;  4QSQ A;  5DYA A;  3LQH A;  5L8U A;  4WIV A;  2L85 A;  5FE9 A;  4WHU A;  5F62 A;  4NUD A;  2D82 A;  5AMF A;  4IOQ A;  4YH4 A;  5C89 A;  4NR4 A;  4PY6 A;  2E7O A;  4C66 A;  5EQ1 A;  4OUF A;  4Z6I A;  5BT3 A;  5E74 A;  5FDZ A;  5HQ5 A;  3NXB A;  5DFD A;  3HME A;  4LR6 A;  5EWD A;  4ALH A;  2DVV A;  5FFW A;  2WP2 A;  4O75 A;  2E7N A;  4YBT A;  5II2 A;  5I83 A;  4OGJ A;  4HBY A;  5CUE A;  4LC2 A;  4NQM A;  4Q0N A;  4YK0 A;  4YY4 A;  5FH8 A;  2F6N A;  4O71 A;  5G4S A;  5EI4 A;  2DVS A;  4XUB A;  3LJW A;  4YC9 A;  3MB4 A;  3LQJ A;  5L99 A;  1JM4 B;  4LYS A;  4ZW1 A;  2LSP B;  1JSP B;  3HMF A;  5EWH A;  5K29 A;  4CUS A;  3UVX A;  4Q0O A;  5LKZ A;  3P1C A;  3U5M A;  5E9K A;  5EGU A;  5HRX A;  5E7D A;  4A9F A;  4CUR A;  5HQ6 A;  4TQN A;  5D3L A;  5EPS A;  3HMH A;  2YEM A;  4Y03 A;  4NR8 A;  4YYJ A;  2YEL A;  3O33 A;  4UIW A;  5ENC A;  5EP7 A;  4YYD A;  2YDW A;  4YYM A;  5LUU A;  5FG4 A;  5D3H A;  5HCL A;  4F3I A;  5CFW A;  5IID A;  4TYL A;  5FH6 A;  2FSA A;  5EIC A;  5DYU A;  4QEW A;  5L98 A;  4IOR A;  4UIU A;  2YW5 A;  4TT4 A;  5FE3 A;  4KV1 A;  4LZ2 A;  5IGK A;  3G0J A;  5EA1 A;  4A9O A;  4XY9 A;  2YYN A;  5BT5 A;  1WUG A;  5CUB A;  4QR4 A;  5CUA A;  4CUU A;  4O72 A;  5FH7 A;  5CRZ A;  5HEN A;  4YAB A;  5HRW A;  5HFR A;  5EK9 A;  5ENE A;  4IR5 A;  4NR5 A;  4NYX A;  5DW1 A;  5IG6 A;  4O70 A;  4UYH A;  5JI8 A;  4UYF B;  5IBN A;  2DKW A;  3RCW A;  4Z6H A;  5A5S A;  4QY4 A;  5LKX A;  3Q2E A;  3S92 A;  5C7N A;  5J0D A;  5C87 A;  3U5J A;  5I7Y A;  1ZS5 A;  5HQ7 A;  4HXS A;  4HXK A;  5EPB A;  4TT2 A;  4HXN A;  5CQA A;  4MEP A;  5IGM A;  5DW2 A;  5A85 A;  5D7X A;  4HXP A;  4LYI A;  5G4R A;  3UVD A;  4CUQ A;  3LQI A;  3P1E A;  2YEK A;  3GG3 A;  4QR5 A;  5II1 A;  4YH3 A;  5CQ8 A;  4PTB A;  4QUT A;  2N9G A;  4NS5 A;  4QC1 A;  4QEU A;  5IGN A;  4XUA A;  5HLS A;  4N4I A;  3ZYU A;  2R10 A;  5F36 A;  3G0L A;  5LVQ A;  2R0V A;  5A5R A;  4Z1Q A;  5CZG A;  5D3T A;  3SVG A;  3O36 A;  3DAI A;  3IU6 A;  4QSU A;  5ENB A;  4FLP A;  5E0R A;  4A9E A;  4A9K A;  4Z1S A;  4J0R A;  4NYW A;  4QSW A;  5FE1 A;  4NRA A;  5KTW A;  4QB3 A;  3UVW A;  4UIV A;  2R0S A;  2F6J A;  5F61 A;  4NR6 A;  5TB6 A;  2DVQ A;  5A5N A;  5FE2 A;  5DLZ A;  5D3P A;  4PCI A;  4CFL A;  5A5P A;  5H1T A;  3P5O A;  5CQT A;  4QR3 A;  1WUM A;  2OUO A;  5CS8 A;  4HBV A;  4GPJ A;  5E9V A;  4YAX A;  5FE7 A;  5LVR A;  4Z93 A;  2NXB A;  5D3N A;  2D9E A;  5I80 A;  2E3K A;  5E73 A;  3S91 A;  4A9N A;  5F3A A;  4NQN A;  5CQ6 A;  4IR4 A;  4XYA A;  2DWW A;  5HRV A;  4CUP A;  4ZC9 A;  4CL9 A;  5C8G A;  5CQ7 A;  5I86 A;  2RO1 A;  4KCX A;  4OGI A;  4XY8 A;  4YYH A;  5ENG A;  5DY7 A;  5F1L A;  5TCM A;  4NR7 A;  5HEM A;  5A5O A;  4QSV A;  4NXJ A;  4TZ8 A;  3DWY A;  2RS9 B;  4YYG A;  3O35 A;  5FE6 A;  4HBX A;  2OO1 A;  4TU6 A;  4NYV A;  4HBW A;  5IGL A;  5KO4 A;  2RI7 A;  3JVM A;  4TZ2 A;  4LZR A;  2R0Y A;  4O7E A;  1E6I A;  5C85 A;  5E9M A;  4DON A;  2RFJ A;  4BW4 A;  4MR4 A;  4UYE A;  5E9Y A;  5A81 A;  4QC3 A;  5DFB A;  4AKN A;  4QSP A;  5LJ2 A;  5D24 A;  4YAT A;  4A9M A;  5D3S A;  5COI A;  5EWV A;  5HFQ A;  4RVR A;  3P1F A;  5HM0 A;  3TLP A;  4A9H A;  5EWC A;  5EPR A;  5FE5 A;  3AQA A;  5LKU A;  3UV4 A;  3D7C A;  5ENF A;  3MQM A;  2RNX A;  5FE4 A;  5LJ0 A;  5CUC A;  5EV9 A;  5KTU A;  5AME A;  5I1Q A;  5H1V A;  4O7B A;  5DKC A;  2WP1 A; 
#chains in the Genus database with same CATH topology
 2YQD A;  4BJX A;  5F1H A;  4BW1 A;  5CQ3 A;  4TS8 A;  5CQ4 A;  5E9L A;  5E3D A;  3U5O A;  3UV2 A;  2KTB B;  4QSR A;  3P1D A;  3Q2F A;  4ZQL A;  5DKH A;  4YBS A;  5ENH A;  1X0J A;  5D0C A;  5FFY A;  5DFC A;  3MXF A;  4N4G A;  4YYK A;  3SVH A;  4A9I A;  4MEQ A;  5CUD A;  5KHM A;  3U5P A;  4N4F A;  5A7C A;  4J0S A;  4QZS A;  3I3J A;  5F63 A;  2GRC A;  4UIY A;  3VKG A;  4UYD A;  4HXL A;  4PKL A;  3MB3 A;  3QZS A;  1EQF A;  5ENI A;  2RNW A;  4UYF A;  4QST A;  4O7A A;  2OSS A;  4X2I A;  5F25 A;  4YBM A;  3VKH A;  5CQ5 A;  5I88 A;  5FB1 A;  2DAT A;  5DYX A;  5FG5 A;  4YYI A;  1N72 A;  5FBX A;  5H1U A;  5HEL A;  5AD2 A;  4NRC A;  4MR5 A;  5CY9 A;  4N4H A;  3JVJ A;  3SVF A;  5AD3 A;  5LJ1 A;  4O78 A;  2MJV B;  4MEO A;  5EWW A;  4LRG A;  5KTX A;  4TU4 A;  5F60 A;  5D3R A;  5I7X A;  5A83 A;  5DBM A;  4NUC A;  5L96 A;  5A82 A;  2I8N A;  4HXO A;  5EU1 A;  3U5L A;  1F68 A;  4QEV A;  3JVL A;  5BT4 A;  2G4A A;  4AKH A;  3ONI A;  5I29 A;  4UIT A;  4NRB A;  3K2J A;  5ETB A;  4CFK A;  4KV4 A;  5CP5 A;  5E3G A;  3UVY A;  3MUK A;  4UIX A;  4LDF A;  4MEN A;  4BW3 A;  4MR6 A;  3FKM X;  4LZS A;  5LKT A;  4IR6 A;  5I89 A;  5D3J A;  4J1P A;  5H85 A;  5CU8 A;  3LXJ A;  4PCE A;  5CUG A;  5L8T A;  4YYN A;  4QYL A;  4CLB A;  3QZT A;  4O74 A;  5I40 A;  4QUU A;  4N3W A;  5EVA A;  3UW9 A;  4QYD A;  4MR3 A;  4O7C A;  5CPE A;  3U5N A;  5ETD A;  5C4Q A;  5F2P A;  5KU3 A;  5FE8 A;  2L84 A;  5FFV A;  3O37 A;  5DYC A;  4IR3 A;  4BHW A;  4J3I A;  5DLX A;  5DX4 A;  3O34 A;  5HJC A;  4BW2 A;  3MUL A;  4O7F A;  4TTE A;  4HXM A;  4TT6 A;  5FB0 A;  4QSX A;  4HXR A;  4UYG A;  4LYW A;  5EM3 A;  4O77 A;  5D25 A;  4CUT A;  2RNY A;  3UV5 A;  2I7K A;  4YAD A;  5FG6 A;  3IU5 A;  5F5Z A;  5A5Q A;  5JWM A;  4A9L A;  5FE0 A;  3AAD A;  4O76 A;  5L97 A;  4A9J A;  2DVR A;  4QSS A;  5DKD A;  5CGP A;  4WHW A;  4NUE A;  5EIS A;  4NR9 A;  4UIZ A;  5CRM A;  3U5K A;  2H60 A;  4IOO A;  4C67 A;  4QBM A;  4YY6 A;  3QZV A;  4ALG A;  5ENJ A;  4PS5 A;  3JVK A;  4E96 A;  4QNS A;  2L5E A;  5E9I A;  5CTL A;  5D26 A;  5ACY A;  4QSQ A;  5DYA A;  3LQH A;  5L8U A;  4WIV A;  2L85 A;  5FE9 A;  4WHU A;  5F62 A;  4NUD A;  2D82 A;  5AMF A;  4IOQ A;  4YH4 A;  5C89 A;  4NR4 A;  4PY6 A;  2E7O A;  4C66 A;  5EQ1 A;  4OUF A;  4Z6I A;  5BT3 A;  5E74 A;  5FDZ A;  5HQ5 A;  3NXB A;  5DFD A;  3HME A;  4LR6 A;  5EWD A;  4ALH A;  2DVV A;  5FFW A;  2WP2 A;  4O75 A;  2E7N A;  4YBT A;  5II2 A;  5I83 A;  4OGJ A;  4HBY A;  5CUE A;  4LC2 A;  4NQM A;  4Q0N A;  4YK0 A;  4YY4 A;  5FH8 A;  2F6N A;  4O71 A;  5G4S A;  5EI4 A;  2DVS A;  4XUB A;  3LJW A;  4YC9 A;  3MB4 A;  3LQJ A;  5L99 A;  1JM4 B;  4LYS A;  4ZW1 A;  2LSP B;  1JSP B;  3HMF A;  5EWH A;  5K29 A;  4CUS A;  3UVX A;  4Q0O A;  5LKZ A;  3P1C A;  3U5M A;  5E9K A;  5EGU A;  5HRX A;  5E7D A;  4A9F A;  4CUR A;  5HQ6 A;  4TQN A;  5D3L A;  5EPS A;  3HMH A;  2YEM A;  4Y03 A;  4NR8 A;  4YYJ A;  2YEL A;  3O33 A;  4UIW A;  5ENC A;  5EP7 A;  4YYD A;  2YDW A;  4YYM A;  5LUU A;  5FG4 A;  5D3H A;  5HCL A;  4F3I A;  5CFW A;  5IID A;  4TYL A;  5FH6 A;  2FSA A;  5EIC A;  5DYU A;  4AKG A;  4QEW A;  5L98 A;  4IOR A;  4UIU A;  2YW5 A;  3D1D A;  4TT4 A;  5FE3 A;  4KV1 A;  4LZ2 A;  1PUO A;  5IGK A;  3G0J A;  5EA1 A;  4A9O A;  4XY9 A;  2YYN A;  5BT5 A;  1WUG A;  5CUB A;  4QR4 A;  5CUA A;  4CUU A;  4O72 A;  5FH7 A;  5CRZ A;  5HEN A;  4YAB A;  5HRW A;  5HFR A;  5EK9 A;  5ENE A;  4IR5 A;  4NR5 A;  4NYX A;  5DW1 A;  5IG6 A;  4O70 A;  4UYH A;  5JI8 A;  4UYF B;  5IBN A;  2DKW A;  3RCW A;  4Z6H A;  5A5S A;  4QY4 A;  2EJN A;  5LKX A;  3Q2E A;  3S92 A;  5C7N A;  5J0D A;  5C87 A;  3U5J A;  4AKI A;  5I7Y A;  1ZS5 A;  5HQ7 A;  4HXS A;  4HXK A;  5EPB A;  4TT2 A;  4HXN A;  3ERR A;  5CQA A;  4MEP A;  5IGM A;  5DW2 A;  5A85 A;  5D7X A;  4HXP A;  4LYI A;  5G4R A;  3UVD A;  4CUQ A;  3LQI A;  3P1E A;  2YEK A;  3GG3 A;  4QR5 A;  5II1 A;  4YH3 A;  5CQ8 A;  4PTB A;  4QUT A;  2N9G A;  4NS5 A;  4QC1 A;  4QEU A;  5IGN A;  4XUA A;  5HLS A;  4N4I A;  3ZYU A;  2R10 A;  5F36 A;  3G0L A;  5LVQ A;  2R0V A;  5A5R A;  4Z1Q A;  5CZG A;  5D3T A;  3SVG A;  3O36 A;  3DAI A;  3IU6 A;  4QSU A;  5ENB A;  4FLP A;  4AI6 A;  5E0R A;  4A9E A;  4A9K A;  4Z1S A;  4J0R A;  4NYW A;  4QSW A;  5FE1 A;  4NRA A;  1ZKR A;  5KTW A;  4QB3 A;  3UVW A;  4UIV A;  2R0S A;  2F6J A;  5F61 A;  4NR6 A;  5TB6 A;  2DVQ A;  5A5N A;  5FE2 A;  5DLZ A;  5D3P A;  4PCI A;  4CFL A;  5A5P A;  5H1T A;  3P5O A;  5CQT A;  4QR3 A;  1WUM A;  2OUO A;  5CS8 A;  4HBV A;  4GPJ A;  5E9V A;  4YAX A;  5FE7 A;  5LVR A;  4Z93 A;  2NXB A;  5D3N A;  2D9E A;  5I80 A;  2E3K A;  5E73 A;  3S91 A;  4A9N A;  5F3A A;  4NQN A;  5CQ6 A;  4IR4 A;  4XYA A;  2DWW A;  5HRV A;  4CUP A;  4ZC9 A;  4CL9 A;  5C8G A;  5CQ7 A;  5I86 A;  2RO1 A;  4KCX A;  4OGI A;  4XY8 A;  4YYH A;  5ENG A;  5DY7 A;  5F1L A;  5TCM A;  4NR7 A;  5HEM A;  5A5O A;  4QSV A;  4NXJ A;  4TZ8 A;  3DWY A;  2RS9 B;  4YYG A;  3D1B A;  3O35 A;  5FE6 A;  4HBX A;  2OO1 A;  4TU6 A;  4NYV A;  4HBW A;  5IGL A;  5KO4 A;  2RI7 A;  3JVM A;  4TZ2 A;  4LZR A;  2R0Y A;  4O7E A;  1E6I A;  5C85 A;  5E9M A;  4DON A;  2RFJ A;  4BW4 A;  4MR4 A;  4UYE A;  5E9Y A;  5A81 A;  4QC3 A;  5DFB A;  4AKN A;  4QSP A;  5LJ2 A;  5D24 A;  4YAT A;  4A9M A;  5D3S A;  5COI A;  5EWV A;  5HFQ A;  4RVR A;  3P1F A;  5HM0 A;  3TLP A;  4A9H A;  5EWC A;  5EPR A;  5FE5 A;  3AQA A;  5LKU A;  3UV4 A;  3D7C A;  5ENF A;  3MQM A;  2RNX A;  5FE4 A;  5LJ0 A;  5CUC A;  5EV9 A;  5KTU A;  5AME A;  5I1Q A;  5H1V A;  4O7B A;  5DKC A;  2WP1 A; 
#chains in the Genus database with same CATH homology
 2YQD A;  4BJX A;  5F1H A;  4BW1 A;  5CQ3 A;  4TS8 A;  5CQ4 A;  5E9L A;  5E3D A;  3U5O A;  3UV2 A;  2KTB B;  4QSR A;  3P1D A;  3Q2F A;  4ZQL A;  5DKH A;  4YBS A;  5ENH A;  1X0J A;  5D0C A;  5FFY A;  5DFC A;  3MXF A;  4N4G A;  4YYK A;  3SVH A;  4A9I A;  4MEQ A;  5CUD A;  5KHM A;  3U5P A;  4N4F A;  5A7C A;  4J0S A;  4QZS A;  3I3J A;  5F63 A;  2GRC A;  4UIY A;  4UYD A;  4HXL A;  4PKL A;  3MB3 A;  3QZS A;  1EQF A;  5ENI A;  2RNW A;  4UYF A;  4QST A;  4O7A A;  2OSS A;  4X2I A;  5F25 A;  4YBM A;  5CQ5 A;  5I88 A;  5FB1 A;  2DAT A;  5DYX A;  5FG5 A;  4YYI A;  1N72 A;  5FBX A;  5H1U A;  5HEL A;  5AD2 A;  4NRC A;  4MR5 A;  5CY9 A;  4N4H A;  3JVJ A;  3SVF A;  5AD3 A;  5LJ1 A;  4O78 A;  2MJV B;  4MEO A;  5EWW A;  4LRG A;  5KTX A;  4TU4 A;  5F60 A;  5D3R A;  5I7X A;  5A83 A;  5DBM A;  4NUC A;  5L96 A;  5A82 A;  2I8N A;  4HXO A;  5EU1 A;  3U5L A;  1F68 A;  4QEV A;  3JVL A;  5BT4 A;  2G4A A;  3ONI A;  5I29 A;  4UIT A;  4NRB A;  3K2J A;  5ETB A;  4CFK A;  4KV4 A;  5CP5 A;  5E3G A;  3UVY A;  3MUK A;  4UIX A;  4LDF A;  4MEN A;  4BW3 A;  4MR6 A;  3FKM X;  4LZS A;  5LKT A;  4IR6 A;  5I89 A;  5D3J A;  4J1P A;  5H85 A;  5CU8 A;  3LXJ A;  4PCE A;  5CUG A;  5L8T A;  4YYN A;  4QYL A;  4CLB A;  3QZT A;  4O74 A;  5I40 A;  4QUU A;  4N3W A;  5EVA A;  3UW9 A;  4QYD A;  4MR3 A;  4O7C A;  5CPE A;  3U5N A;  5ETD A;  5C4Q A;  5F2P A;  5KU3 A;  5FE8 A;  2L84 A;  5FFV A;  3O37 A;  5DYC A;  4IR3 A;  4BHW A;  4J3I A;  5DLX A;  5DX4 A;  3O34 A;  5HJC A;  4BW2 A;  3MUL A;  4O7F A;  4TTE A;  4HXM A;  4TT6 A;  5FB0 A;  4QSX A;  4HXR A;  4UYG A;  4LYW A;  5EM3 A;  4O77 A;  5D25 A;  4CUT A;  2RNY A;  3UV5 A;  2I7K A;  4YAD A;  5FG6 A;  3IU5 A;  5F5Z A;  5A5Q A;  5JWM A;  4A9L A;  5FE0 A;  3AAD A;  4O76 A;  5L97 A;  4A9J A;  2DVR A;  4QSS A;  5DKD A;  5CGP A;  4WHW A;  4NUE A;  5EIS A;  4NR9 A;  4UIZ A;  5CRM A;  3U5K A;  2H60 A;  4IOO A;  4C67 A;  4QBM A;  4YY6 A;  3QZV A;  4ALG A;  5ENJ A;  4PS5 A;  3JVK A;  4E96 A;  4QNS A;  2L5E A;  5E9I A;  5CTL A;  5D26 A;  5ACY A;  4QSQ A;  5DYA A;  3LQH A;  5L8U A;  4WIV A;  2L85 A;  5FE9 A;  4WHU A;  5F62 A;  4NUD A;  2D82 A;  5AMF A;  4IOQ A;  4YH4 A;  5C89 A;  4NR4 A;  4PY6 A;  2E7O A;  4C66 A;  5EQ1 A;  4OUF A;  4Z6I A;  5BT3 A;  5E74 A;  5FDZ A;  5HQ5 A;  3NXB A;  5DFD A;  3HME A;  4LR6 A;  5EWD A;  4ALH A;  2DVV A;  5FFW A;  2WP2 A;  4O75 A;  2E7N A;  4YBT A;  5II2 A;  5I83 A;  4OGJ A;  4HBY A;  5CUE A;  4LC2 A;  4NQM A;  4Q0N A;  4YK0 A;  4YY4 A;  5FH8 A;  2F6N A;  4O71 A;  5G4S A;  5EI4 A;  2DVS A;  4XUB A;  3LJW A;  4YC9 A;  3MB4 A;  3LQJ A;  5L99 A;  1JM4 B;  4LYS A;  4ZW1 A;  2LSP B;  1JSP B;  3HMF A;  5EWH A;  5K29 A;  4CUS A;  3UVX A;  4Q0O A;  5LKZ A;  3P1C A;  3U5M A;  5E9K A;  5EGU A;  5HRX A;  5E7D A;  4A9F A;  4CUR A;  5HQ6 A;  4TQN A;  5D3L A;  5EPS A;  3HMH A;  2YEM A;  4Y03 A;  4NR8 A;  4YYJ A;  2YEL A;  3O33 A;  4UIW A;  5ENC A;  5EP7 A;  4YYD A;  2YDW A;  4YYM A;  5LUU A;  5FG4 A;  5D3H A;  5HCL A;  4F3I A;  5CFW A;  5IID A;  4TYL A;  5FH6 A;  2FSA A;  5EIC A;  5DYU A;  4QEW A;  5L98 A;  4IOR A;  4UIU A;  2YW5 A;  4TT4 A;  5FE3 A;  4KV1 A;  4LZ2 A;  5IGK A;  3G0J A;  5EA1 A;  4A9O A;  4XY9 A;  2YYN A;  5BT5 A;  1WUG A;  5CUB A;  4QR4 A;  5CUA A;  4CUU A;  4O72 A;  5FH7 A;  5CRZ A;  5HEN A;  4YAB A;  5HRW A;  5HFR A;  5EK9 A;  5ENE A;  4IR5 A;  4NR5 A;  4NYX A;  5DW1 A;  5IG6 A;  4O70 A;  4UYH A;  5JI8 A;  4UYF B;  5IBN A;  2DKW A;  3RCW A;  4Z6H A;  5A5S A;  4QY4 A;  5LKX A;  3Q2E A;  3S92 A;  5C7N A;  5J0D A;  5C87 A;  3U5J A;  5I7Y A;  1ZS5 A;  5HQ7 A;  4HXS A;  4HXK A;  5EPB A;  4TT2 A;  4HXN A;  5CQA A;  4MEP A;  5IGM A;  5DW2 A;  5A85 A;  5D7X A;  4HXP A;  4LYI A;  5G4R A;  3UVD A;  4CUQ A;  3LQI A;  3P1E A;  2YEK A;  3GG3 A;  4QR5 A;  5II1 A;  4YH3 A;  5CQ8 A;  4PTB A;  4QUT A;  2N9G A;  4NS5 A;  4QC1 A;  4QEU A;  5IGN A;  4XUA A;  5HLS A;  4N4I A;  3ZYU A;  2R10 A;  5F36 A;  3G0L A;  5LVQ A;  2R0V A;  5A5R A;  4Z1Q A;  5CZG A;  5D3T A;  3SVG A;  3O36 A;  3DAI A;  3IU6 A;  4QSU A;  5ENB A;  4FLP A;  5E0R A;  4A9E A;  4A9K A;  4Z1S A;  4J0R A;  4NYW A;  4QSW A;  5FE1 A;  4NRA A;  5KTW A;  4QB3 A;  3UVW A;  4UIV A;  2R0S A;  2F6J A;  5F61 A;  4NR6 A;  5TB6 A;  2DVQ A;  5A5N A;  5FE2 A;  5DLZ A;  5D3P A;  4PCI A;  4CFL A;  5A5P A;  5H1T A;  3P5O A;  5CQT A;  4QR3 A;  1WUM A;  2OUO A;  5CS8 A;  4HBV A;  4GPJ A;  5E9V A;  4YAX A;  5FE7 A;  5LVR A;  4Z93 A;  2NXB A;  5D3N A;  2D9E A;  5I80 A;  2E3K A;  5E73 A;  3S91 A;  4A9N A;  5F3A A;  4NQN A;  5CQ6 A;  4IR4 A;  4XYA A;  2DWW A;  5HRV A;  4CUP A;  4ZC9 A;  4CL9 A;  5C8G A;  5CQ7 A;  5I86 A;  2RO1 A;  4KCX A;  4OGI A;  4XY8 A;  4YYH A;  5ENG A;  5DY7 A;  5F1L A;  5TCM A;  4NR7 A;  5HEM A;  5A5O A;  4QSV A;  4NXJ A;  4TZ8 A;  3DWY A;  2RS9 B;  4YYG A;  3O35 A;  5FE6 A;  4HBX A;  2OO1 A;  4TU6 A;  4NYV A;  4HBW A;  5IGL A;  5KO4 A;  2RI7 A;  3JVM A;  4TZ2 A;  4LZR A;  2R0Y A;  4O7E A;  1E6I A;  5C85 A;  5E9M A;  4DON A;  2RFJ A;  4BW4 A;  4MR4 A;  4UYE A;  5E9Y A;  5A81 A;  4QC3 A;  5DFB A;  4AKN A;  4QSP A;  5LJ2 A;  5D24 A;  4YAT A;  4A9M A;  5D3S A;  5COI A;  5EWV A;  5HFQ A;  4RVR A;  3P1F A;  5HM0 A;  3TLP A;  4A9H A;  5EWC A;  5EPR A;  5FE5 A;  3AQA A;  5LKU A;  3UV4 A;  3D7C A;  5ENF A;  3MQM A;  2RNX A;  5FE4 A;  5LJ0 A;  5CUC A;  5EV9 A;  5KTU A;  5AME A;  5I1Q A;  5H1V A;  4O7B A;  5DKC A;  2WP1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...