4XY8A

Crystal structure of the bromodomain of brd9 in complex with a 2-amine-9h-purine ligand
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
113
structure length
113
Chain Sequence
b'STPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDFGTMKDKIVANEYKSVTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMSKERLLALKRSMS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bromodomain-containing protein 9
publication title 9H-Purine Scaffold Reveals Induced-Fit Pocket Plasticity of the BRD9 Bromodomain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 42
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2015-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4xy8A00
5CRZA 3LQIA 4MENA 5F2PA 5AD2A 4HXNA 3I3JA 4QSXA 5I89A 5C8GA 5E7DA 4O77A 5FG4A 3ZYUA 3DAIA 5CQTA 5E9KA 3O35A 4UIVA 4O78A 4OGIA 4MR6A 5G4SA 5TCMA 3MUKA 5DYAA 3U5PA 5EWCA 5AMFA 5L98A 5FH7A 5KO4A 4TT4A 4ZC9A 5EQ1A 4C66A 2RNYA 5EPRA 5F3AA 5DFCA 3UV4A 3IU5A 4J0RA 4HBYA 2RFJA 5BT3A 3MULA 5HQ7A 5DY7A 5EWWA 4HBWA 5F60A 5IBNA 5A7CA 5DLZA 4TZ8A 2DWWA 4NS5A 3U5MA 5ETBA 4TS8A 5EU1A 5LJ1A 3DWYA 5A83A 5I80A 4CUTA 5KTXA 2DVVA 5FE7A 4QR5A 4MR4A 5A5QA 5FDZA 4UYFA 1X0JA 2F6JA 3ONIA 4Z93A 4LRGA 5L8UA 4YBSA 3U5OA 4BW3A 5EWVA 5HELA 4UIZA 5DKDA 3G0JA 4BW2A 2I7KA 4QYLA 5F1LA 5FE6A 5L96A 4LDFA 5D3JA 5CS8A 2FSAA 5ENEA 4PS5A 4TTEA 3G0LA 4F3IA 5LJ0A 4QC3A 4HXKA 5CQ4A 4HXPA 5CUGA 4FLPA 5HEMA 3UVWA 5I86A 2YEMA 4CUSA 4QSSA 5BT5A 5CZGA 4WHWA 5FE4A 2R10A 4QEWA 5K29A 5FE1A 3QZTA 1E6IA 4HXLA 4TQNA 5E9MA 4TU6A 5HJCA 4E96A 4YYGA 4BJXA 2R0YA 4NRBA 3UW9A 4A9HA 4MR3A 5CQ5A 4MEQA 4Q0OA 3UV2A 2GRCA 5HQ6A 3O33A 4NR7A 3UV5A 4WHUA 4YH4A 5E9LA 5LVQA 4QYDA 5A5SA 5EVAA 4J1PA 4ZQLA 4Z1QA 3MXFA 4Z6HA 4TU4A 4PKLA 5FH6A 4KV4A 2DATA 4YBTA 4QSVA 3SVHA 3JVLA 5FE8A 4DONA 4BHWA 4QSPA 5HFRA 4YADA 4NQNA 4MEOA 5C87A 4QZSA 4CFLA 4LYIA 5HFQA 4UYHA 5CTLA 5ETDA 3TLPA 4UIWA 4HXRA 5EPSA 5FB0A 4LZ2A 4KCXA 4YBMA 3LQHA 5TB6A 5F36A 2DVRA 5FE0A 5ENHA 2NXBA 5LKXA 5LVRA 4ALGA 4PY6A 5EM3A 2D82A 4NUDA 3JVJA 3S91A 4BW1A 3U5JA 5CQ6A 3HMFA 4QR3A 5H1VA 5C89A 4A9LA 5EWHA 5I88A 5IIDA 2G4AA 5CQ8A 5DYXA 5E0RA 4LZRA 5F62A 4UITA 5F61A 4HXOA 2DVQA 3JVMA 4KV1A 5ENGA 5E74A 4HXMA 5DFDA 5COIA 4O7CA 4UYGA 5CQ7A 4N3WA 5CQAA 5HRXA 4J0SA 3UVDA 4IORA 5ENCA 5LKTA 5DLXA 3SVGA 4YYIA 5LKZA 5C7NA 2L85A 5EA1A 2MJVB 4A9MA 4A9NA 5H1TA 4YYKA 5I1QA 4UIUA 4NR9A 2F6NA 3P1EA 4CFKA 3GG3A 5DW2A 5HENA 5EGUA 5F5ZA 4IR4A 5G4RA 5A81A 4NR4A 5CFWA 1JM4B 5AD3A 5ACYA 5CUAA 5E9VA 4LZSA 4CURA 5HRVA 5LJ2A 4XYAA 2RO1A 5EV9A 4A9FA 5HCLA 4YYJA 4LYWA 2I8NA 3Q2EA 5CUCA 4Z6IA 4AKNA 4O7BA 4PCEA 5CUEA 4QEVA 4CLBA 2RNWA 5HM0A 5C4QA 5CP5A 5KU3A 1F68A 5CRMA 5EICA 4XY8A 5CGPA 2YW5A 4YYMA 5CU8A 2RS9B 5D3RA 4YH3A 5L97A 4N4GA 4O75A 4TT2A 5EWDA 2R0SA 4NRAA 4QNSA 5BT4A 2H60A 4NR8A 2N9GA 5F63A 2E7OA 4QUUA 4XUBA 4NXJA 5KHMA 5E3GA 5L8TA 5CPEA 5E3DA 5FG6A 3U5NA 3Q2FA 4CL9A 3LQJA 3MQMA 5II1A 5D3HA 4OGJA 5FE3A 5A5OA 3SVFA 4PTBA 5LKUA 4OUFA 4IOQA 2DVSA 5CY9A 5A85A 4TYLA 4QSWA 5CUBA 5I40A 3MB3A 3O34A 5II2A 4HXSA 4TZ2A 4YAXA 5AMEA 4PCIA 4YY4A 2WP2A 5I7YA 4QBMA 5CQ3A 4QSTA 5A5RA 4NYVA 5I83A 5E73A 4NYXA 4XUAA 4Z1SA 1WUMA 5EP7A 5C85A 4QR4A 4GPJA 4QEUA 3AADA 3UVYA 5ENJA 5FFWA 3NXBA 4QSQA 4NUCA 4ZW1A 5IGMA 5EK9A 5FE5A 2YELA 2RNXA 4YC9A 4NYWA 5DFBA 4O7EA 4LYSA 5EISA 3RCWA 4LR6A 2OSSA 4J3IA 4UYEA 5I29A 5L99A 2OUOA 4N4HA 4QSRA 4QUTA 5JI8A 4A9OA 3QZSA 5E9YA 5JWMA 4NR5A 5FG5A 2YYNA 3LXJA 4CUQA 3LJWA 5HLSA 5DBMA 5ENIA 5A5NA 5IGLA 4QB3A 4UIYA 4YYNA 5FE9A 3QZVA 2LSPB 5D25A 5F1HA 4RVRA 4A9JA 5FFVA 3HMHA 4LC2A 4O71A 2D9EA 5DX4A 1EQFA 5D24A 1N72A 4QY4A 3JVKA 3P5OA 2R0VA 4CUUA 4A9KA 4Q0NA 5KTUA 4YABA 5D0CA 5FH8A 5FFYA 5D3LA 5D3NA 4O70A 3O36A 5D3TA 4A9IA 1JSPB 2RI7A 4XY9A 4MR5A 3D7CA 5A82A 5FB1A 5I7XA 4UYDA 3P1DA 5F25A 3IU6A 2L84A 5D7XA 4ALHA 2E3KA 4Y03A 5LUUA 5H1UA 5HRWA 3FKMX 2KTBB 5IGNA 4YK0A 3P1CA 2WP1A 2L5EA 5EPBA 3MB4A 5FE2A 2OO1A 2YQDA 3O37A 4WIVA 4BW4A 5D3PA 4X2IA 4YYDA 4IR5A 4QSUA 2E7NA 5A5PA 3U5LA 1WUGA 5IG6A 5EI4A 2YDWA 4IR3A 4NRCA 4YATA 5KTWA 2DKWA 4N4IA 5DYUA 4YY6A 3S92A 4O7AA 5DYCA 5HQ5A 5IGKA 3HMEA 4O72A 4O7FA 4NR6A 4N4FA 4UIXA 4O76A 3AQAA 5H85A 3P1FA 1ZS5A 4MEPA 4A9EA 4UYFB 4NUEA 4HBVA 5DW1A 4IOOA 5ENFA 3K2JA 4NQMA 4IR6A 5E9IA 4HBXA 5ENBA 5J0DA 5DKCA 4CUPA 3UVXA 4C67A 4TT6A 4QC1A 5CUDA 5FBXA 3U5KA 4O74A 5DKHA 5D26A 4YYHA 5D3SA 2YEKA
chains in the Genus database with same CATH superfamily
5CRZA 3LQIA 4MENA 5F2PA 5AD2A 4HXNA 1ZKRA 3I3JA 4QSXA 5I89A 5C8GA 5E7DA 4O77A 5FG4A 3ZYUA 3DAIA 5CQTA 3VKHA 5E9KA 3O35A 4UIVA 4O78A 4OGIA 4MR6A 5G4SA 5TCMA 3MUKA 5DYAA 3U5PA 5EWCA 5AMFA 5L98A 5FH7A 3VKGA 5KO4A 4TT4A 4ZC9A 5EQ1A 4C66A 2RNYA 5EPRA 5F3AA 5DFCA 3UV4A 3IU5A 4J0RA 4HBYA 2RFJA 5BT3A 3MULA 5HQ7A 5DY7A 5EWWA 4HBWA 5F60A 5IBNA 5A7CA 5DLZA 4TZ8A 2DWWA 4NS5A 3U5MA 5ETBA 4TS8A 5EU1A 5LJ1A 3DWYA 5A83A 5I80A 4CUTA 5KTXA 2DVVA 5FE7A 4QR5A 4MR4A 5A5QA 5FDZA 4UYFA 1X0JA 2F6JA 3ONIA 4Z93A 4LRGA 5L8UA 4YBSA 3U5OA 4BW3A 5EWVA 5HELA 4UIZA 5DKDA 3G0JA 4BW2A 2I7KA 4QYLA 5F1LA 5FE6A 5L96A 4LDFA 5D3JA 5CS8A 2FSAA 5ENEA 4PS5A 4TTEA 3G0LA 4F3IA 5LJ0A 4QC3A 4HXKA 5CQ4A 4HXPA 5CUGA 4AKGA 4FLPA 5HEMA 3UVWA 5I86A 2YEMA 4CUSA 4QSSA 4AI6A 5BT5A 5CZGA 4WHWA 5FE4A 2R10A 4QEWA 5K29A 5FE1A 3QZTA 1E6IA 4HXLA 4TQNA 5E9MA 4TU6A 5HJCA 4E96A 4YYGA 4BJXA 2R0YA 3D1DA 4NRBA 3UW9A 4A9HA 4MR3A 5CQ5A 4MEQA 4Q0OA 3UV2A 2GRCA 5HQ6A 3O33A 4NR7A 3UV5A 4WHUA 4YH4A 5E9LA 5LVQA 4QYDA 5A5SA 5EVAA 4J1PA 4ZQLA 4Z1QA 3MXFA 4Z6HA 4TU4A 4PKLA 5FH6A 4KV4A 2DATA 4YBTA 4QSVA 3SVHA 3JVLA 5FE8A 4DONA 4BHWA 4QSPA 5HFRA 4YADA 4NQNA 4MEOA 5C87A 4QZSA 4CFLA 4LYIA 5HFQA 4UYHA 5CTLA 5ETDA 3TLPA 4UIWA 4HXRA 5EPSA 5FB0A 4LZ2A 4KCXA 4YBMA 3LQHA 5TB6A 5F36A 2DVRA 5FE0A 5ENHA 2NXBA 5LKXA 5LVRA 4ALGA 4PY6A 5EM3A 2D82A 4NUDA 3JVJA 3S91A 4BW1A 3U5JA 5CQ6A 3HMFA 4QR3A 5H1VA 5C89A 4AKIA 4A9LA 5EWHA 5I88A 5IIDA 2G4AA 5CQ8A 5DYXA 5E0RA 4LZRA 5F62A 4UITA 5F61A 4HXOA 2DVQA 3JVMA 4KV1A 5ENGA 5E74A 4HXMA 5DFDA 5COIA 4O7CA 4UYGA 5CQ7A 4N3WA 5CQAA 5HRXA 4J0SA 3UVDA 4IORA 5ENCA 5LKTA 5DLXA 3SVGA 4YYIA 5LKZA 5C7NA 2L85A 5EA1A 2MJVB 4A9MA 4A9NA 5H1TA 4YYKA 5I1QA 4UIUA 4NR9A 2F6NA 3P1EA 4CFKA 3GG3A 5DW2A 5HENA 5EGUA 5F5ZA 4IR4A 5G4RA 5A81A 4NR4A 5CFWA 1JM4B 5AD3A 5ACYA 5CUAA 5E9VA 4LZSA 4CURA 5HRVA 5LJ2A 4XYAA 2RO1A 5EV9A 4A9FA 5HCLA 4YYJA 4LYWA 2I8NA 3Q2EA 5CUCA 4Z6IA 4AKNA 4O7BA 4PCEA 5CUEA 4QEVA 4CLBA 2RNWA 5HM0A 5C4QA 5CP5A 5KU3A 1F68A 5CRMA 5EICA 4XY8A 5CGPA 2YW5A 4YYMA 2EJNA 5CU8A 2RS9B 5D3RA 4YH3A 5L97A 4N4GA 4O75A 4TT2A 5EWDA 2R0SA 4NRAA 4QNSA 5BT4A 3D1BA 2H60A 4NR8A 2N9GA 5F63A 2E7OA 4QUUA 4XUBA 4NXJA 3ERRA 5KHMA 5E3GA 5L8TA 5CPEA 5E3DA 5FG6A 3U5NA 3Q2FA 4CL9A 3LQJA 3MQMA 5II1A 5D3HA 4OGJA 5FE3A 5A5OA 3SVFA 4PTBA 5LKUA 4OUFA 4IOQA 2DVSA 5CY9A 5A85A 4TYLA 4QSWA 5CUBA 5I40A 3MB3A 3O34A 5II2A 4HXSA 4TZ2A 4YAXA 5AMEA 4PCIA 4YY4A 2WP2A 5I7YA 4QBMA 5CQ3A 4QSTA 5A5RA 4NYVA 5I83A 5E73A 4NYXA 4XUAA 4Z1SA 1WUMA 5EP7A 5C85A 4QR4A 4GPJA 4QEUA 3AADA 3UVYA 5ENJA 5FFWA 3NXBA 4QSQA 4NUCA 4ZW1A 5IGMA 5EK9A 5FE5A 2YELA 2RNXA 4YC9A 4NYWA 5DFBA 4O7EA 4LYSA 5EISA 3RCWA 4LR6A 2OSSA 4J3IA 4UYEA 5I29A 5L99A 2OUOA 4N4HA 4QSRA 4QUTA 5JI8A 4A9OA 3QZSA 5E9YA 5JWMA 4NR5A 5FG5A 2YYNA 3LXJA 4CUQA 3LJWA 5HLSA 5DBMA 5ENIA 5A5NA 5IGLA 4QB3A 4UIYA 4YYNA 5FE9A 4AKHA 3QZVA 2LSPB 5D25A 5F1HA 4RVRA 4A9JA 5FFVA 3HMHA 4LC2A 4O71A 2D9EA 5DX4A 1EQFA 5D24A 1N72A 4QY4A 3JVKA 3P5OA 2R0VA 4CUUA 4A9KA 4Q0NA 5KTUA 4YABA 5D0CA 5FH8A 5FFYA 5D3LA 5D3NA 4O70A 3O36A 5D3TA 4A9IA 1JSPB 2RI7A 4XY9A 4MR5A 3D7CA 5A82A 5FB1A 5I7XA 4UYDA 3P1DA 5F25A 3IU6A 2L84A 1PUOA 5D7XA 4ALHA 2E3KA 4Y03A 5LUUA 5H1UA 5HRWA 3FKMX 2KTBB 5IGNA 4YK0A 3P1CA 2WP1A 2L5EA 5EPBA 3MB4A 5FE2A 2OO1A 2YQDA 3O37A 4WIVA 4BW4A 5D3PA 4X2IA 4YYDA 4IR5A 4QSUA 2E7NA 5A5PA 3U5LA 1WUGA 5IG6A 5EI4A 2YDWA 4IR3A 4NRCA 4YATA 5KTWA 2DKWA 4N4IA 5DYUA 4YY6A 3S92A 4O7AA 5DYCA 5HQ5A 5IGKA 3HMEA 4O72A 4O7FA 4NR6A 4N4FA 4UIXA 4O76A 3AQAA 5H85A 3P1FA 1ZS5A 4MEPA 4A9EA 4UYFB 4NUEA 4HBVA 5DW1A 4IOOA 5ENFA 3K2JA 4NQMA 4IR6A 5E9IA 4HBXA 5ENBA 5J0DA 5DKCA 4CUPA 3UVXA 4C67A 4TT6A 4QC1A 5CUDA 5FBXA 3U5KA 4O74A 5DKHA 5D26A 4YYHA 5D3SA 2YEKA
chains in the Genus database with same CATH topology
5CRZA 3LQIA 4MENA 5F2PA 5AD2A 4HXNA 3I3JA 4QSXA 5I89A 5C8GA 5E7DA 4O77A 5FG4A 3ZYUA 3DAIA 5CQTA 5E9KA 3O35A 4UIVA 4O78A 4OGIA 4MR6A 5G4SA 5TCMA 3MUKA 5DYAA 3U5PA 5EWCA 5AMFA 5L98A 5FH7A 5KO4A 4TT4A 4ZC9A 5EQ1A 4C66A 2RNYA 5EPRA 5F3AA 5DFCA 3UV4A 3IU5A 4J0RA 4HBYA 2RFJA 5BT3A 3MULA 5HQ7A 5DY7A 5EWWA 4HBWA 5F60A 5IBNA 5A7CA 5DLZA 4TZ8A 2DWWA 4NS5A 3U5MA 5ETBA 4TS8A 5EU1A 5LJ1A 3DWYA 5A83A 5I80A 4CUTA 5KTXA 2DVVA 5FE7A 4QR5A 4MR4A 5A5QA 5FDZA 4UYFA 1X0JA 2F6JA 3ONIA 4Z93A 4LRGA 5L8UA 4YBSA 3U5OA 4BW3A 5EWVA 5HELA 4UIZA 5DKDA 3G0JA 4BW2A 2I7KA 4QYLA 5F1LA 5FE6A 5L96A 4LDFA 5D3JA 5CS8A 2FSAA 5ENEA 4PS5A 4TTEA 3G0LA 4F3IA 5LJ0A 4QC3A 4HXKA 5CQ4A 4HXPA 5CUGA 4FLPA 5HEMA 3UVWA 5I86A 2YEMA 4CUSA 4QSSA 5BT5A 5CZGA 4WHWA 5FE4A 2R10A 4QEWA 5K29A 5FE1A 3QZTA 1E6IA 4HXLA 4TQNA 5E9MA 4TU6A 5HJCA 4E96A 4YYGA 4BJXA 2R0YA 4NRBA 3UW9A 4A9HA 4MR3A 5CQ5A 4MEQA 4Q0OA 3UV2A 2GRCA 5HQ6A 3O33A 4NR7A 3UV5A 4WHUA 4YH4A 5E9LA 5LVQA 4QYDA 5A5SA 5EVAA 4J1PA 4ZQLA 4Z1QA 3MXFA 4Z6HA 4TU4A 4PKLA 5FH6A 4KV4A 2DATA 4YBTA 4QSVA 3SVHA 3JVLA 5FE8A 4DONA 4BHWA 4QSPA 5HFRA 4YADA 4NQNA 4MEOA 5C87A 4QZSA 4CFLA 4LYIA 5HFQA 4UYHA 5CTLA 5ETDA 3TLPA 4UIWA 4HXRA 5EPSA 5FB0A 4LZ2A 4KCXA 4YBMA 3LQHA 5TB6A 5F36A 2DVRA 5FE0A 5ENHA 2NXBA 5LKXA 5LVRA 4ALGA 4PY6A 5EM3A 2D82A 4NUDA 3JVJA 3S91A 4BW1A 3U5JA 5CQ6A 3HMFA 4QR3A 5H1VA 5C89A 4A9LA 5EWHA 5I88A 5IIDA 2G4AA 5CQ8A 5DYXA 5E0RA 4LZRA 5F62A 4UITA 5F61A 4HXOA 2DVQA 3JVMA 4KV1A 5ENGA 5E74A 4HXMA 5DFDA 5COIA 4O7CA 4UYGA 5CQ7A 4N3WA 5CQAA 5HRXA 4J0SA 3UVDA 4IORA 5ENCA 5LKTA 5DLXA 3SVGA 4YYIA 5LKZA 5C7NA 2L85A 5EA1A 2MJVB 4A9MA 4A9NA 5H1TA 4YYKA 5I1QA 4UIUA 4NR9A 2F6NA 3P1EA 4CFKA 3GG3A 5DW2A 5HENA 5EGUA 5F5ZA 4IR4A 5G4RA 5A81A 4NR4A 5CFWA 1JM4B 5AD3A 5ACYA 5CUAA 5E9VA 4LZSA 4CURA 5HRVA 5LJ2A 4XYAA 2RO1A 5EV9A 4A9FA 5HCLA 4YYJA 4LYWA 2I8NA 3Q2EA 5CUCA 4Z6IA 4AKNA 4O7BA 4PCEA 5CUEA 4QEVA 4CLBA 2RNWA 5HM0A 5C4QA 5CP5A 5KU3A 1F68A 5CRMA 5EICA 4XY8A 5CGPA 2YW5A 4YYMA 5CU8A 2RS9B 5D3RA 4YH3A 5L97A 4N4GA 4O75A 4TT2A 5EWDA 2R0SA 4NRAA 4QNSA 5BT4A 2H60A 4NR8A 2N9GA 5F63A 2E7OA 4QUUA 4XUBA 4NXJA 5KHMA 5E3GA 5L8TA 5CPEA 5E3DA 5FG6A 3U5NA 3Q2FA 4CL9A 3LQJA 3MQMA 5II1A 5D3HA 4OGJA 5FE3A 5A5OA 3SVFA 4PTBA 5LKUA 4OUFA 4IOQA 2DVSA 5CY9A 5A85A 4TYLA 4QSWA 5CUBA 5I40A 3MB3A 3O34A 5II2A 4HXSA 4TZ2A 4YAXA 5AMEA 4PCIA 4YY4A 2WP2A 5I7YA 4QBMA 5CQ3A 4QSTA 5A5RA 4NYVA 5I83A 5E73A 4NYXA 4XUAA 4Z1SA 1WUMA 5EP7A 5C85A 4QR4A 4GPJA 4QEUA 3AADA 3UVYA 5ENJA 5FFWA 3NXBA 4QSQA 4NUCA 4ZW1A 5IGMA 5EK9A 5FE5A 2YELA 2RNXA 4YC9A 4NYWA 5DFBA 4O7EA 4LYSA 5EISA 3RCWA 4LR6A 2OSSA 4J3IA 4UYEA 5I29A 5L99A 2OUOA 4N4HA 4QSRA 4QUTA 5JI8A 4A9OA 3QZSA 5E9YA 5JWMA 4NR5A 5FG5A 2YYNA 3LXJA 4CUQA 3LJWA 5HLSA 5DBMA 5ENIA 5A5NA 5IGLA 4QB3A 4UIYA 4YYNA 5FE9A 3QZVA 2LSPB 5D25A 5F1HA 4RVRA 4A9JA 5FFVA 3HMHA 4LC2A 4O71A 2D9EA 5DX4A 1EQFA 5D24A 1N72A 4QY4A 3JVKA 3P5OA 2R0VA 4CUUA 4A9KA 4Q0NA 5KTUA 4YABA 5D0CA 5FH8A 5FFYA 5D3LA 5D3NA 4O70A 3O36A 5D3TA 4A9IA 1JSPB 2RI7A 4XY9A 4MR5A 3D7CA 5A82A 5FB1A 5I7XA 4UYDA 3P1DA 5F25A 3IU6A 2L84A 5D7XA 4ALHA 2E3KA 4Y03A 5LUUA 5H1UA 5HRWA 3FKMX 2KTBB 5IGNA 4YK0A 3P1CA 2WP1A 2L5EA 5EPBA 3MB4A 5FE2A 2OO1A 2YQDA 3O37A 4WIVA 4BW4A 5D3PA 4X2IA 4YYDA 4IR5A 4QSUA 2E7NA 5A5PA 3U5LA 1WUGA 5IG6A 5EI4A 2YDWA 4IR3A 4NRCA 4YATA 5KTWA 2DKWA 4N4IA 5DYUA 4YY6A 3S92A 4O7AA 5DYCA 5HQ5A 5IGKA 3HMEA 4O72A 4O7FA 4NR6A 4N4FA 4UIXA 4O76A 3AQAA 5H85A 3P1FA 1ZS5A 4MEPA 4A9EA 4UYFB 4NUEA 4HBVA 5DW1A 4IOOA 5ENFA 3K2JA 4NQMA 4IR6A 5E9IA 4HBXA 5ENBA 5J0DA 5DKCA 4CUPA 3UVXA 4C67A 4TT6A 4QC1A 5CUDA 5FBXA 3U5KA 4O74A 5DKHA 5D26A 4YYHA 5D3SA 2YEKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CRZ A;  3LQI A;  4MEN A;  5F2P A;  5AD2 A;  4HXN A;  3I3J A;  4QSX A;  5I89 A;  5C8G A;  5E7D A;  4O77 A;  5FG4 A;  3ZYU A;  3DAI A;  5CQT A;  5E9K A;  3O35 A;  4UIV A;  4O78 A;  4OGI A;  4MR6 A;  5G4S A;  5TCM A;  3MUK A;  5DYA A;  3U5P A;  5EWC A;  5AMF A;  5L98 A;  5FH7 A;  5KO4 A;  4TT4 A;  4ZC9 A;  5EQ1 A;  4C66 A;  2RNY A;  5EPR A;  5F3A A;  5DFC A;  3UV4 A;  3IU5 A;  4J0R A;  4HBY A;  2RFJ A;  5BT3 A;  3MUL A;  5HQ7 A;  5DY7 A;  5EWW A;  4HBW A;  5F60 A;  5IBN A;  5A7C A;  5DLZ A;  4TZ8 A;  2DWW A;  4NS5 A;  3U5M A;  5ETB A;  4TS8 A;  5EU1 A;  5LJ1 A;  3DWY A;  5A83 A;  5I80 A;  4CUT A;  5KTX A;  2DVV A;  5FE7 A;  4QR5 A;  4MR4 A;  5A5Q A;  5FDZ A;  4UYF A;  1X0J A;  2F6J A;  3ONI A;  4Z93 A;  4LRG A;  5L8U A;  4YBS A;  3U5O A;  4BW3 A;  5EWV A;  5HEL A;  4UIZ A;  5DKD A;  3G0J A;  4BW2 A;  2I7K A;  4QYL A;  5F1L A;  5FE6 A;  5L96 A;  4LDF A;  5D3J A;  5CS8 A;  2FSA A;  5ENE A;  4PS5 A;  4TTE A;  3G0L A;  4F3I A;  5LJ0 A;  4QC3 A;  4HXK A;  5CQ4 A;  4HXP A;  5CUG A;  4FLP A;  5HEM A;  3UVW A;  5I86 A;  2YEM A;  4CUS A;  4QSS A;  5BT5 A;  5CZG A;  4WHW A;  5FE4 A;  2R10 A;  4QEW A;  5K29 A;  5FE1 A;  3QZT A;  1E6I A;  4HXL A;  4TQN A;  5E9M A;  4TU6 A;  5HJC A;  4E96 A;  4YYG A;  4BJX A;  2R0Y A;  4NRB A;  3UW9 A;  4A9H A;  4MR3 A;  5CQ5 A;  4MEQ A;  4Q0O A;  3UV2 A;  2GRC A;  5HQ6 A;  3O33 A;  4NR7 A;  3UV5 A;  4WHU A;  4YH4 A;  5E9L A;  5LVQ A;  4QYD A;  5A5S A;  5EVA A;  4J1P A;  4ZQL A;  4Z1Q A;  3MXF A;  4Z6H A;  4TU4 A;  4PKL A;  5FH6 A;  4KV4 A;  2DAT A;  4YBT A;  4QSV A;  3SVH A;  3JVL A;  5FE8 A;  4DON A;  4BHW A;  4QSP A;  5HFR A;  4YAD A;  4NQN A;  4MEO A;  5C87 A;  4QZS A;  4CFL A;  4LYI A;  5HFQ A;  4UYH A;  5CTL A;  5ETD A;  3TLP A;  4UIW A;  4HXR A;  5EPS A;  5FB0 A;  4LZ2 A;  4KCX A;  4YBM A;  3LQH A;  5TB6 A;  5F36 A;  2DVR A;  5FE0 A;  5ENH A;  2NXB A;  5LKX A;  5LVR A;  4ALG A;  4PY6 A;  5EM3 A;  2D82 A;  4NUD A;  3JVJ A;  3S91 A;  4BW1 A;  3U5J A;  5CQ6 A;  3HMF A;  4QR3 A;  5H1V A;  5C89 A;  4A9L A;  5EWH A;  5I88 A;  5IID A;  2G4A A;  5CQ8 A;  5DYX A;  5E0R A;  4LZR A;  5F62 A;  4UIT A;  5F61 A;  4HXO A;  2DVQ A;  3JVM A;  4KV1 A;  5ENG A;  5E74 A;  4HXM A;  5DFD A;  5COI A;  4O7C A;  4UYG A;  5CQ7 A;  4N3W A;  5CQA A;  5HRX A;  4J0S A;  3UVD A;  4IOR A;  5ENC A;  5LKT A;  5DLX A;  3SVG A;  4YYI A;  5LKZ A;  5C7N A;  2L85 A;  5EA1 A;  2MJV B;  4A9M A;  4A9N A;  5H1T A;  4YYK A;  5I1Q A;  4UIU A;  4NR9 A;  2F6N A;  3P1E A;  4CFK A;  3GG3 A;  5DW2 A;  5HEN A;  5EGU A;  5F5Z A;  4IR4 A;  5G4R A;  5A81 A;  4NR4 A;  5CFW A;  1JM4 B;  5AD3 A;  5ACY A;  5CUA A;  5E9V A;  4LZS A;  4CUR A;  5HRV A;  5LJ2 A;  4XYA A;  2RO1 A;  5EV9 A;  4A9F A;  5HCL A;  4YYJ A;  4LYW A;  2I8N A;  3Q2E A;  5CUC A;  4Z6I A;  4AKN A;  4O7B A;  4PCE A;  5CUE A;  4QEV A;  4CLB A;  2RNW A;  5HM0 A;  5C4Q A;  5CP5 A;  5KU3 A;  1F68 A;  5CRM A;  5EIC A;  4XY8 A;  5CGP A;  2YW5 A;  4YYM A;  5CU8 A;  2RS9 B;  5D3R A;  4YH3 A;  5L97 A;  4N4G A;  4O75 A;  4TT2 A;  5EWD A;  2R0S A;  4NRA A;  4QNS A;  5BT4 A;  2H60 A;  4NR8 A;  2N9G A;  5F63 A;  2E7O A;  4QUU A;  4XUB A;  4NXJ A;  5KHM A;  5E3G A;  5L8T A;  5CPE A;  5E3D A;  5FG6 A;  3U5N A;  3Q2F A;  4CL9 A;  3LQJ A;  3MQM A;  5II1 A;  5D3H A;  4OGJ A;  5FE3 A;  5A5O A;  3SVF A;  4PTB A;  5LKU A;  4OUF A;  4IOQ A;  2DVS A;  5CY9 A;  5A85 A;  4TYL A;  4QSW A;  5CUB A;  5I40 A;  3MB3 A;  3O34 A;  5II2 A;  4HXS A;  4TZ2 A;  4YAX A;  5AME A;  4PCI A;  4YY4 A;  2WP2 A;  5I7Y A;  4QBM A;  5CQ3 A;  4QST A;  5A5R A;  4NYV A;  5I83 A;  5E73 A;  4NYX A;  4XUA A;  4Z1S A;  1WUM A;  5EP7 A;  5C85 A;  4QR4 A;  4GPJ A;  4QEU A;  3AAD A;  3UVY A;  5ENJ A;  5FFW A;  3NXB A;  4QSQ A;  4NUC A;  4ZW1 A;  5IGM A;  5EK9 A;  5FE5 A;  2YEL A;  2RNX A;  4YC9 A;  4NYW A;  5DFB A;  4O7E A;  4LYS A;  5EIS A;  3RCW A;  4LR6 A;  2OSS A;  4J3I A;  4UYE A;  5I29 A;  5L99 A;  2OUO A;  4N4H A;  4QSR A;  4QUT A;  5JI8 A;  4A9O A;  3QZS A;  5E9Y A;  5JWM A;  4NR5 A;  5FG5 A;  2YYN A;  3LXJ A;  4CUQ A;  3LJW A;  5HLS A;  5DBM A;  5ENI A;  5A5N A;  5IGL A;  4QB3 A;  4UIY A;  4YYN A;  5FE9 A;  3QZV A;  2LSP B;  5D25 A;  5F1H A;  4RVR A;  4A9J A;  5FFV A;  3HMH A;  4LC2 A;  4O71 A;  2D9E A;  5DX4 A;  1EQF A;  5D24 A;  1N72 A;  4QY4 A;  3JVK A;  3P5O A;  2R0V A;  4CUU A;  4A9K A;  4Q0N A;  5KTU A;  4YAB A;  5D0C A;  5FH8 A;  5FFY A;  5D3L A;  5D3N A;  4O70 A;  3O36 A;  5D3T A;  4A9I A;  1JSP B;  2RI7 A;  4XY9 A;  4MR5 A;  3D7C A;  5A82 A;  5FB1 A;  5I7X A;  4UYD A;  3P1D A;  5F25 A;  3IU6 A;  2L84 A;  5D7X A;  4ALH A;  2E3K A;  4Y03 A;  5LUU A;  5H1U A;  5HRW A;  3FKM X;  2KTB B;  5IGN A;  4YK0 A;  3P1C A;  2WP1 A;  2L5E A;  5EPB A;  3MB4 A;  5FE2 A;  2OO1 A;  2YQD A;  3O37 A;  4WIV A;  4BW4 A;  5D3P A;  4X2I A;  4YYD A;  4IR5 A;  4QSU A;  2E7N A;  5A5P A;  3U5L A;  1WUG A;  5IG6 A;  5EI4 A;  2YDW A;  4IR3 A;  4NRC A;  4YAT A;  5KTW A;  2DKW A;  4N4I A;  5DYU A;  4YY6 A;  3S92 A;  4O7A A;  5DYC A;  5HQ5 A;  5IGK A;  3HME A;  4O72 A;  4O7F A;  4NR6 A;  4N4F A;  4UIX A;  4O76 A;  3AQA A;  5H85 A;  3P1F A;  1ZS5 A;  4MEP A;  4A9E A;  4UYF B;  4NUE A;  4HBV A;  5DW1 A;  4IOO A;  5ENF A;  3K2J A;  4NQM A;  4IR6 A;  5E9I A;  4HBX A;  5ENB A;  5J0D A;  5DKC A;  4CUP A;  3UVX A;  4C67 A;  4TT6 A;  4QC1 A;  5CUD A;  5FBX A;  3U5K A;  4O74 A;  5DKH A;  5D26 A;  4YYH A;  5D3S A;  2YEK A; 
#chains in the Genus database with same CATH topology
 5CRZ A;  3LQI A;  4MEN A;  5F2P A;  5AD2 A;  4HXN A;  1ZKR A;  3I3J A;  4QSX A;  5I89 A;  5C8G A;  5E7D A;  4O77 A;  5FG4 A;  3ZYU A;  3DAI A;  5CQT A;  3VKH A;  5E9K A;  3O35 A;  4UIV A;  4O78 A;  4OGI A;  4MR6 A;  5G4S A;  5TCM A;  3MUK A;  5DYA A;  3U5P A;  5EWC A;  5AMF A;  5L98 A;  5FH7 A;  3VKG A;  5KO4 A;  4TT4 A;  4ZC9 A;  5EQ1 A;  4C66 A;  2RNY A;  5EPR A;  5F3A A;  5DFC A;  3UV4 A;  3IU5 A;  4J0R A;  4HBY A;  2RFJ A;  5BT3 A;  3MUL A;  5HQ7 A;  5DY7 A;  5EWW A;  4HBW A;  5F60 A;  5IBN A;  5A7C A;  5DLZ A;  4TZ8 A;  2DWW A;  4NS5 A;  3U5M A;  5ETB A;  4TS8 A;  5EU1 A;  5LJ1 A;  3DWY A;  5A83 A;  5I80 A;  4CUT A;  5KTX A;  2DVV A;  5FE7 A;  4QR5 A;  4MR4 A;  5A5Q A;  5FDZ A;  4UYF A;  1X0J A;  2F6J A;  3ONI A;  4Z93 A;  4LRG A;  5L8U A;  4YBS A;  3U5O A;  4BW3 A;  5EWV A;  5HEL A;  4UIZ A;  5DKD A;  3G0J A;  4BW2 A;  2I7K A;  4QYL A;  5F1L A;  5FE6 A;  5L96 A;  4LDF A;  5D3J A;  5CS8 A;  2FSA A;  5ENE A;  4PS5 A;  4TTE A;  3G0L A;  4F3I A;  5LJ0 A;  4QC3 A;  4HXK A;  5CQ4 A;  4HXP A;  5CUG A;  4AKG A;  4FLP A;  5HEM A;  3UVW A;  5I86 A;  2YEM A;  4CUS A;  4QSS A;  4AI6 A;  5BT5 A;  5CZG A;  4WHW A;  5FE4 A;  2R10 A;  4QEW A;  5K29 A;  5FE1 A;  3QZT A;  1E6I A;  4HXL A;  4TQN A;  5E9M A;  4TU6 A;  5HJC A;  4E96 A;  4YYG A;  4BJX A;  2R0Y A;  3D1D A;  4NRB A;  3UW9 A;  4A9H A;  4MR3 A;  5CQ5 A;  4MEQ A;  4Q0O A;  3UV2 A;  2GRC A;  5HQ6 A;  3O33 A;  4NR7 A;  3UV5 A;  4WHU A;  4YH4 A;  5E9L A;  5LVQ A;  4QYD A;  5A5S A;  5EVA A;  4J1P A;  4ZQL A;  4Z1Q A;  3MXF A;  4Z6H A;  4TU4 A;  4PKL A;  5FH6 A;  4KV4 A;  2DAT A;  4YBT A;  4QSV A;  3SVH A;  3JVL A;  5FE8 A;  4DON A;  4BHW A;  4QSP A;  5HFR A;  4YAD A;  4NQN A;  4MEO A;  5C87 A;  4QZS A;  4CFL A;  4LYI A;  5HFQ A;  4UYH A;  5CTL A;  5ETD A;  3TLP A;  4UIW A;  4HXR A;  5EPS A;  5FB0 A;  4LZ2 A;  4KCX A;  4YBM A;  3LQH A;  5TB6 A;  5F36 A;  2DVR A;  5FE0 A;  5ENH A;  2NXB A;  5LKX A;  5LVR A;  4ALG A;  4PY6 A;  5EM3 A;  2D82 A;  4NUD A;  3JVJ A;  3S91 A;  4BW1 A;  3U5J A;  5CQ6 A;  3HMF A;  4QR3 A;  5H1V A;  5C89 A;  4AKI A;  4A9L A;  5EWH A;  5I88 A;  5IID A;  2G4A A;  5CQ8 A;  5DYX A;  5E0R A;  4LZR A;  5F62 A;  4UIT A;  5F61 A;  4HXO A;  2DVQ A;  3JVM A;  4KV1 A;  5ENG A;  5E74 A;  4HXM A;  5DFD A;  5COI A;  4O7C A;  4UYG A;  5CQ7 A;  4N3W A;  5CQA A;  5HRX A;  4J0S A;  3UVD A;  4IOR A;  5ENC A;  5LKT A;  5DLX A;  3SVG A;  4YYI A;  5LKZ A;  5C7N A;  2L85 A;  5EA1 A;  2MJV B;  4A9M A;  4A9N A;  5H1T A;  4YYK A;  5I1Q A;  4UIU A;  4NR9 A;  2F6N A;  3P1E A;  4CFK A;  3GG3 A;  5DW2 A;  5HEN A;  5EGU A;  5F5Z A;  4IR4 A;  5G4R A;  5A81 A;  4NR4 A;  5CFW A;  1JM4 B;  5AD3 A;  5ACY A;  5CUA A;  5E9V A;  4LZS A;  4CUR A;  5HRV A;  5LJ2 A;  4XYA A;  2RO1 A;  5EV9 A;  4A9F A;  5HCL A;  4YYJ A;  4LYW A;  2I8N A;  3Q2E A;  5CUC A;  4Z6I A;  4AKN A;  4O7B A;  4PCE A;  5CUE A;  4QEV A;  4CLB A;  2RNW A;  5HM0 A;  5C4Q A;  5CP5 A;  5KU3 A;  1F68 A;  5CRM A;  5EIC A;  4XY8 A;  5CGP A;  2YW5 A;  4YYM A;  2EJN A;  5CU8 A;  2RS9 B;  5D3R A;  4YH3 A;  5L97 A;  4N4G A;  4O75 A;  4TT2 A;  5EWD A;  2R0S A;  4NRA A;  4QNS A;  5BT4 A;  3D1B A;  2H60 A;  4NR8 A;  2N9G A;  5F63 A;  2E7O A;  4QUU A;  4XUB A;  4NXJ A;  3ERR A;  5KHM A;  5E3G A;  5L8T A;  5CPE A;  5E3D A;  5FG6 A;  3U5N A;  3Q2F A;  4CL9 A;  3LQJ A;  3MQM A;  5II1 A;  5D3H A;  4OGJ A;  5FE3 A;  5A5O A;  3SVF A;  4PTB A;  5LKU A;  4OUF A;  4IOQ A;  2DVS A;  5CY9 A;  5A85 A;  4TYL A;  4QSW A;  5CUB A;  5I40 A;  3MB3 A;  3O34 A;  5II2 A;  4HXS A;  4TZ2 A;  4YAX A;  5AME A;  4PCI A;  4YY4 A;  2WP2 A;  5I7Y A;  4QBM A;  5CQ3 A;  4QST A;  5A5R A;  4NYV A;  5I83 A;  5E73 A;  4NYX A;  4XUA A;  4Z1S A;  1WUM A;  5EP7 A;  5C85 A;  4QR4 A;  4GPJ A;  4QEU A;  3AAD A;  3UVY A;  5ENJ A;  5FFW A;  3NXB A;  4QSQ A;  4NUC A;  4ZW1 A;  5IGM A;  5EK9 A;  5FE5 A;  2YEL A;  2RNX A;  4YC9 A;  4NYW A;  5DFB A;  4O7E A;  4LYS A;  5EIS A;  3RCW A;  4LR6 A;  2OSS A;  4J3I A;  4UYE A;  5I29 A;  5L99 A;  2OUO A;  4N4H A;  4QSR A;  4QUT A;  5JI8 A;  4A9O A;  3QZS A;  5E9Y A;  5JWM A;  4NR5 A;  5FG5 A;  2YYN A;  3LXJ A;  4CUQ A;  3LJW A;  5HLS A;  5DBM A;  5ENI A;  5A5N A;  5IGL A;  4QB3 A;  4UIY A;  4YYN A;  5FE9 A;  4AKH A;  3QZV A;  2LSP B;  5D25 A;  5F1H A;  4RVR A;  4A9J A;  5FFV A;  3HMH A;  4LC2 A;  4O71 A;  2D9E A;  5DX4 A;  1EQF A;  5D24 A;  1N72 A;  4QY4 A;  3JVK A;  3P5O A;  2R0V A;  4CUU A;  4A9K A;  4Q0N A;  5KTU A;  4YAB A;  5D0C A;  5FH8 A;  5FFY A;  5D3L A;  5D3N A;  4O70 A;  3O36 A;  5D3T A;  4A9I A;  1JSP B;  2RI7 A;  4XY9 A;  4MR5 A;  3D7C A;  5A82 A;  5FB1 A;  5I7X A;  4UYD A;  3P1D A;  5F25 A;  3IU6 A;  2L84 A;  1PUO A;  5D7X A;  4ALH A;  2E3K A;  4Y03 A;  5LUU A;  5H1U A;  5HRW A;  3FKM X;  2KTB B;  5IGN A;  4YK0 A;  3P1C A;  2WP1 A;  2L5E A;  5EPB A;  3MB4 A;  5FE2 A;  2OO1 A;  2YQD A;  3O37 A;  4WIV A;  4BW4 A;  5D3P A;  4X2I A;  4YYD A;  4IR5 A;  4QSU A;  2E7N A;  5A5P A;  3U5L A;  1WUG A;  5IG6 A;  5EI4 A;  2YDW A;  4IR3 A;  4NRC A;  4YAT A;  5KTW A;  2DKW A;  4N4I A;  5DYU A;  4YY6 A;  3S92 A;  4O7A A;  5DYC A;  5HQ5 A;  5IGK A;  3HME A;  4O72 A;  4O7F A;  4NR6 A;  4N4F A;  4UIX A;  4O76 A;  3AQA A;  5H85 A;  3P1F A;  1ZS5 A;  4MEP A;  4A9E A;  4UYF B;  4NUE A;  4HBV A;  5DW1 A;  4IOO A;  5ENF A;  3K2J A;  4NQM A;  4IR6 A;  5E9I A;  4HBX A;  5ENB A;  5J0D A;  5DKC A;  4CUP A;  3UVX A;  4C67 A;  4TT6 A;  4QC1 A;  5CUD A;  5FBX A;  3U5K A;  4O74 A;  5DKH A;  5D26 A;  4YYH A;  5D3S A;  2YEK A; 
#chains in the Genus database with same CATH homology
 5CRZ A;  3LQI A;  4MEN A;  5F2P A;  5AD2 A;  4HXN A;  3I3J A;  4QSX A;  5I89 A;  5C8G A;  5E7D A;  4O77 A;  5FG4 A;  3ZYU A;  3DAI A;  5CQT A;  5E9K A;  3O35 A;  4UIV A;  4O78 A;  4OGI A;  4MR6 A;  5G4S A;  5TCM A;  3MUK A;  5DYA A;  3U5P A;  5EWC A;  5AMF A;  5L98 A;  5FH7 A;  5KO4 A;  4TT4 A;  4ZC9 A;  5EQ1 A;  4C66 A;  2RNY A;  5EPR A;  5F3A A;  5DFC A;  3UV4 A;  3IU5 A;  4J0R A;  4HBY A;  2RFJ A;  5BT3 A;  3MUL A;  5HQ7 A;  5DY7 A;  5EWW A;  4HBW A;  5F60 A;  5IBN A;  5A7C A;  5DLZ A;  4TZ8 A;  2DWW A;  4NS5 A;  3U5M A;  5ETB A;  4TS8 A;  5EU1 A;  5LJ1 A;  3DWY A;  5A83 A;  5I80 A;  4CUT A;  5KTX A;  2DVV A;  5FE7 A;  4QR5 A;  4MR4 A;  5A5Q A;  5FDZ A;  4UYF A;  1X0J A;  2F6J A;  3ONI A;  4Z93 A;  4LRG A;  5L8U A;  4YBS A;  3U5O A;  4BW3 A;  5EWV A;  5HEL A;  4UIZ A;  5DKD A;  3G0J A;  4BW2 A;  2I7K A;  4QYL A;  5F1L A;  5FE6 A;  5L96 A;  4LDF A;  5D3J A;  5CS8 A;  2FSA A;  5ENE A;  4PS5 A;  4TTE A;  3G0L A;  4F3I A;  5LJ0 A;  4QC3 A;  4HXK A;  5CQ4 A;  4HXP A;  5CUG A;  4FLP A;  5HEM A;  3UVW A;  5I86 A;  2YEM A;  4CUS A;  4QSS A;  5BT5 A;  5CZG A;  4WHW A;  5FE4 A;  2R10 A;  4QEW A;  5K29 A;  5FE1 A;  3QZT A;  1E6I A;  4HXL A;  4TQN A;  5E9M A;  4TU6 A;  5HJC A;  4E96 A;  4YYG A;  4BJX A;  2R0Y A;  4NRB A;  3UW9 A;  4A9H A;  4MR3 A;  5CQ5 A;  4MEQ A;  4Q0O A;  3UV2 A;  2GRC A;  5HQ6 A;  3O33 A;  4NR7 A;  3UV5 A;  4WHU A;  4YH4 A;  5E9L A;  5LVQ A;  4QYD A;  5A5S A;  5EVA A;  4J1P A;  4ZQL A;  4Z1Q A;  3MXF A;  4Z6H A;  4TU4 A;  4PKL A;  5FH6 A;  4KV4 A;  2DAT A;  4YBT A;  4QSV A;  3SVH A;  3JVL A;  5FE8 A;  4DON A;  4BHW A;  4QSP A;  5HFR A;  4YAD A;  4NQN A;  4MEO A;  5C87 A;  4QZS A;  4CFL A;  4LYI A;  5HFQ A;  4UYH A;  5CTL A;  5ETD A;  3TLP A;  4UIW A;  4HXR A;  5EPS A;  5FB0 A;  4LZ2 A;  4KCX A;  4YBM A;  3LQH A;  5TB6 A;  5F36 A;  2DVR A;  5FE0 A;  5ENH A;  2NXB A;  5LKX A;  5LVR A;  4ALG A;  4PY6 A;  5EM3 A;  2D82 A;  4NUD A;  3JVJ A;  3S91 A;  4BW1 A;  3U5J A;  5CQ6 A;  3HMF A;  4QR3 A;  5H1V A;  5C89 A;  4A9L A;  5EWH A;  5I88 A;  5IID A;  2G4A A;  5CQ8 A;  5DYX A;  5E0R A;  4LZR A;  5F62 A;  4UIT A;  5F61 A;  4HXO A;  2DVQ A;  3JVM A;  4KV1 A;  5ENG A;  5E74 A;  4HXM A;  5DFD A;  5COI A;  4O7C A;  4UYG A;  5CQ7 A;  4N3W A;  5CQA A;  5HRX A;  4J0S A;  3UVD A;  4IOR A;  5ENC A;  5LKT A;  5DLX A;  3SVG A;  4YYI A;  5LKZ A;  5C7N A;  2L85 A;  5EA1 A;  2MJV B;  4A9M A;  4A9N A;  5H1T A;  4YYK A;  5I1Q A;  4UIU A;  4NR9 A;  2F6N A;  3P1E A;  4CFK A;  3GG3 A;  5DW2 A;  5HEN A;  5EGU A;  5F5Z A;  4IR4 A;  5G4R A;  5A81 A;  4NR4 A;  5CFW A;  1JM4 B;  5AD3 A;  5ACY A;  5CUA A;  5E9V A;  4LZS A;  4CUR A;  5HRV A;  5LJ2 A;  4XYA A;  2RO1 A;  5EV9 A;  4A9F A;  5HCL A;  4YYJ A;  4LYW A;  2I8N A;  3Q2E A;  5CUC A;  4Z6I A;  4AKN A;  4O7B A;  4PCE A;  5CUE A;  4QEV A;  4CLB A;  2RNW A;  5HM0 A;  5C4Q A;  5CP5 A;  5KU3 A;  1F68 A;  5CRM A;  5EIC A;  4XY8 A;  5CGP A;  2YW5 A;  4YYM A;  5CU8 A;  2RS9 B;  5D3R A;  4YH3 A;  5L97 A;  4N4G A;  4O75 A;  4TT2 A;  5EWD A;  2R0S A;  4NRA A;  4QNS A;  5BT4 A;  2H60 A;  4NR8 A;  2N9G A;  5F63 A;  2E7O A;  4QUU A;  4XUB A;  4NXJ A;  5KHM A;  5E3G A;  5L8T A;  5CPE A;  5E3D A;  5FG6 A;  3U5N A;  3Q2F A;  4CL9 A;  3LQJ A;  3MQM A;  5II1 A;  5D3H A;  4OGJ A;  5FE3 A;  5A5O A;  3SVF A;  4PTB A;  5LKU A;  4OUF A;  4IOQ A;  2DVS A;  5CY9 A;  5A85 A;  4TYL A;  4QSW A;  5CUB A;  5I40 A;  3MB3 A;  3O34 A;  5II2 A;  4HXS A;  4TZ2 A;  4YAX A;  5AME A;  4PCI A;  4YY4 A;  2WP2 A;  5I7Y A;  4QBM A;  5CQ3 A;  4QST A;  5A5R A;  4NYV A;  5I83 A;  5E73 A;  4NYX A;  4XUA A;  4Z1S A;  1WUM A;  5EP7 A;  5C85 A;  4QR4 A;  4GPJ A;  4QEU A;  3AAD A;  3UVY A;  5ENJ A;  5FFW A;  3NXB A;  4QSQ A;  4NUC A;  4ZW1 A;  5IGM A;  5EK9 A;  5FE5 A;  2YEL A;  2RNX A;  4YC9 A;  4NYW A;  5DFB A;  4O7E A;  4LYS A;  5EIS A;  3RCW A;  4LR6 A;  2OSS A;  4J3I A;  4UYE A;  5I29 A;  5L99 A;  2OUO A;  4N4H A;  4QSR A;  4QUT A;  5JI8 A;  4A9O A;  3QZS A;  5E9Y A;  5JWM A;  4NR5 A;  5FG5 A;  2YYN A;  3LXJ A;  4CUQ A;  3LJW A;  5HLS A;  5DBM A;  5ENI A;  5A5N A;  5IGL A;  4QB3 A;  4UIY A;  4YYN A;  5FE9 A;  3QZV A;  2LSP B;  5D25 A;  5F1H A;  4RVR A;  4A9J A;  5FFV A;  3HMH A;  4LC2 A;  4O71 A;  2D9E A;  5DX4 A;  1EQF A;  5D24 A;  1N72 A;  4QY4 A;  3JVK A;  3P5O A;  2R0V A;  4CUU A;  4A9K A;  4Q0N A;  5KTU A;  4YAB A;  5D0C A;  5FH8 A;  5FFY A;  5D3L A;  5D3N A;  4O70 A;  3O36 A;  5D3T A;  4A9I A;  1JSP B;  2RI7 A;  4XY9 A;  4MR5 A;  3D7C A;  5A82 A;  5FB1 A;  5I7X A;  4UYD A;  3P1D A;  5F25 A;  3IU6 A;  2L84 A;  5D7X A;  4ALH A;  2E3K A;  4Y03 A;  5LUU A;  5H1U A;  5HRW A;  3FKM X;  2KTB B;  5IGN A;  4YK0 A;  3P1C A;  2WP1 A;  2L5E A;  5EPB A;  3MB4 A;  5FE2 A;  2OO1 A;  2YQD A;  3O37 A;  4WIV A;  4BW4 A;  5D3P A;  4X2I A;  4YYD A;  4IR5 A;  4QSU A;  2E7N A;  5A5P A;  3U5L A;  1WUG A;  5IG6 A;  5EI4 A;  2YDW A;  4IR3 A;  4NRC A;  4YAT A;  5KTW A;  2DKW A;  4N4I A;  5DYU A;  4YY6 A;  3S92 A;  4O7A A;  5DYC A;  5HQ5 A;  5IGK A;  3HME A;  4O72 A;  4O7F A;  4NR6 A;  4N4F A;  4UIX A;  4O76 A;  3AQA A;  5H85 A;  3P1F A;  1ZS5 A;  4MEP A;  4A9E A;  4UYF B;  4NUE A;  4HBV A;  5DW1 A;  4IOO A;  5ENF A;  3K2J A;  4NQM A;  4IR6 A;  5E9I A;  4HBX A;  5ENB A;  5J0D A;  5DKC A;  4CUP A;  3UVX A;  4C67 A;  4TT6 A;  4QC1 A;  5CUD A;  5FBX A;  3U5K A;  4O74 A;  5DKH A;  5D26 A;  4YYH A;  5D3S A;  2YEK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...