5A5RA

Crystal structure of human atad2 bromodomain in complex with 5-5- methoxypyridin-3-yl-3-methyl-8-piperidin-4-ylamino-1,2-dihydro-1,7- naphthyridin-2-one
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
130
structure length
130
Chain Sequence
SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICSNALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ATPASE FAMILY AAA DOMAIN-CONTAINING PROTEIN 2
publication title Fragment-Based Discovery of Low-Micromolar Atad2 Bromodomain Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 55
structure length 130
sequence length 130
ec nomenclature ec 3.6.1.3: Adenosinetriphosphatase.
pdb deposition date 2015-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5a5rA00
4PY6A 4UIYA 5LJ0A 4NUEA 5AMFA 4QZSA 3JVMA 4A9NA 5F61A 5A5QA 5F63A 5L97A 3U5JA 4LC2A 4QB3A 4O7AA 4YBTA 4HXOA 3O33A 3S92A 5L99A 5CQ6A 4CUPA 3UV4A 3P1EA 5KU3A 4E96A 4UITA 3MULA 5HRWA 5LVRA 5ACYA 4TTEA 2RNXA 5L8UA 5D7XA 4UIZA 5I89A 3P1CA 5IBNA 4YYJA 5EPSA 2RO1A 4O75A 5FG5A 5CZGA 5L96A 4NR4A 4YATA 3SVHA 1F68A 5CY9A 5FE7A 5DKCA 3JVKA 5D3TA 4TT6A 4QEUA 5CRMA 2L84A 5E74A 5HFRA 3AQAA 5FG6A 1ZS5A 4LRGA 2F6NA 5DLXA 5HENA 4HXLA 2DWWA 2DATA 2L85A 5EI4A 4UYDA 5HQ5A 5DYCA 5E9KA 3U5OA 4WHWA 5IGKA 5ENHA 4A9HA 5ENBA 2YQDA 4MR3A 3P1FA 3TLPA 4CFKA 5EK9A 4BW2A 2L5EA 4IR4A 5CU8A 5CTLA 5E73A 4HXSA 5CUBA 5F25A 4BW3A 4GPJA 5C8GA 5FE2A 5DX4A 5DLZA 5A85A 5BT3A 5FE6A 4A9MA 4HXMA 3LQHA 5E9LA 5LKXA 5EISA 4YYNA 5EQ1A 5LKZA 4QY4A 4UYFA 4WIVA 4YADA 3Q2FA 5HRXA 4XY9A 5EWDA 4BHWA 5EM3A 2DVQA 1JSPB 5LUUA 3LJWA 5CPEA 5HFQA 5BT4A 5A81A 3ONIA 5CRZA 4ZW1A 4YYHA 5C7NA 2FSAA 4TZ8A 4DONA 3LQIA 4YYDA 4WHUA 5FE5A 5I7XA 4NUCA 5FB1A 1WUMA 4PKLA 3HMHA 4TQNA 4F3IA 4O7FA 2WP1A 5D0CA 3JVJA 4Z6HA 3O36A 4A9JA 3DAIA 4C67A 4MR6A 5E9IA 5DYAA 5CS8A 5CUAA 5AMEA 5TB6A 3U5LA 5A82A 5FH8A 5II1A 5FBXA 4O77A 5EWVA 3K2JA 4YAXA 4ZQLA 4N4FA 5I80A 3O37A 5FFWA 5EWWA 2RNYA 2OUOA 4XYAA 4AKNA 5CQ7A 5CGPA 5G4SA 3RCWA 5CQ4A 5H1VA 4KV1A 4NQMA 4QSVA 3GG3A 5I83A 5D26A 5EPRA 4NYWA 3O35A 4UIUA 5EV9A 4YY6A 5FH7A 4NRBA 3UVDA 4N4IA 4BW1A 5CQ5A 5D3LA 5K29A 5EICA 3UVXA 5KTWA 4HBXA 5H1TA 2I7KA 5FE4A 4TT2A 5EU1A 5E9YA 5IGNA 4Z1QA 3P1DA 5FFYA 5JWMA 4QSUA 5DKDA 4NR9A 4O76A 4MEQA 5CQ3A 5FE1A 4YYMA 4J1PA 5DYXA 4O70A 4O71A 5LKUA 4A9EA 5FFVA 4NR6A 4MENA 2OSSA 5I7YA 5J0DA 5FE8A 4XUAA 5F60A 4QNSA 3MXFA 5F1HA 3UVYA 5CFWA 5AD2A 4O7CA 5IGMA 2DVSA 2RI7A 3LXJA 5CUEA 1N72A 4TU6A 4UYGA 3G0JA 5KTXA 3IU6A 4YY4A 2E7OA 5CQ8A 4UIVA 2YDWA 5H1UA 4J0SA 5D24A 5E3GA 4O74A 5C89A 3U5NA 4A9LA 4QEVA 3UV5A 4RVRA 5DYUA 4HXRA 5A5RA 4QYLA 3U5KA 4IOOA 5FE9A 2RFJA 5L98A 4CFLA 5LJ1A 4O7BA 5DFCA 4HBWA 5HQ7A 5AD3A 4NRAA 4ALGA 4IORA 3O34A 3AADA 5BT5A 2YELA 2DVRA 2R0YA 5EP7A 5E9VA 3ZYUA 4QSTA 3MUKA 4Z93A 4UIWA 4A9FA 4UYHA 5F3AA 2R0VA 2YEMA 4MR4A 4YYIA 4QSQA 4QSRA 3IU5A 4PCEA 2NXBA 2N9GA 5II2A 4FLPA 3HMEA 4NS5A 4CURA 2RS9B 4Q0OA 5D3SA 4HBYA 5COIA 4J0RA 4QSSA 3MB3A 4QC1A 5A5NA 5C4QA 4Z6IA 3Q2EA 2OO1A 4YK0A 5LVQA 5CUGA 5CQTA 3DWYA 4PTBA 5EVAA 4YYGA 2D82A 4LZSA 5CQAA 5H85A 5KHMA 4CUTA 2MJVB 5E7DA 4XY8A 4ZC9A 5I88A 5IGLA 4YYKA 1E6IA 5A83A 4QSWA 4HXKA 3UVWA 4NRCA 5DKHA 5L8TA 5I29A 5I86A 4A9KA 4IOQA 3QZVA 2GRCA 4UIXA 4BJXA 3QZTA 3SVFA 4YBMA 4YBSA 4N3WA 5EGUA 5ENEA 5E0RA 5DY7A 4MEOA 4LYIA 5A5OA 2F6JA 4CLBA 3HMFA 5I40A 5EWCA 4CUQA 4IR6A 2RNWA 5FG4A 5IG6A 2I8NA 5D3RA 4NR8A 4QR3A 4LYWA 5DBMA 4PCIA 4NXJA 5E3DA 3NXBA 2WP2A 2R10A 4LR6A 3UW9A 5G4RA 4QEWA 2G4AA 5EA1A 4QR4A 5D25A 5ETDA 5FB0A 4NR7A 5F5ZA 4O7EA 2YYNA 3U5MA 4HXNA 1EQFA 5HLSA 5ENJA 4YH3A 4QSXA 4OGJA 4OUFA 4YC9A 5FH6A 5KO4A 5CUCA 4IR3A 3P5OA 4CUSA 5A7CA 3MB4A 5CUDA 3LQJA 2E3KA 4N4HA 3G0LA 4NUDA 2KTBB 4TYLA 5A5PA 5ENGA 3QZSA 3D7CA 1X0JA 4NYXA 1WUGA 5LKTA 3JVLA 4BW4A 4J3IA 3MQMA 5KTUA 4MR5A 4YH4A 4IR5A 4UYFB 4A9IA 3I3JA 5DFBA 4QBMA 5EWHA 4LZRA 5HELA 4XUBA 5E9MA 4HBVA 4YABA 5D3NA 4TS8A 3SVGA 5HM0A 4Y03A 2D9EA 5DFDA 2DKWA 5LJ2A 5D3JA 5C87A 4MEPA 4HXPA 4QUTA 4QSPA 2YEKA 4PS5A 2H60A 5HRVA 4CL9A 5JI8A 4QR5A 5HJCA 4KCXA 4LZ2A 3U5PA 4NQNA 4QC3A 5CP5A 5FE0A 5A5SA 5HEMA 5C85A 4X2IA 5F2PA 5FDZA 4N4GA 4O78A 5DW2A 3UV2A 4Z1SA 5ENCA 4TU4A 5HCLA 2R0SA 2YW5A 4NR5A 5D3PA 4LYSA 5ENFA 5HQ6A 4TT4A 4KV4A 4O72A 5ENIA 4C66A 4UYEA 2LSPB 5F36A 1JM4B 4Q0NA 3S91A 4NYVA 2E7NA 5FE3A 4OGIA 4LDFA 4QYDA 5DW1A 5TCMA 5F62A 5IIDA 5F1LA 4TZ2A 5ETBA 5EPBA 5I1QA 4A9OA 4QUUA 3FKMX 4CUUA 4ALHA 2DVVA 5D3HA
chains in the Genus database with same CATH superfamily
4PY6A 4UIYA 5LJ0A 4NUEA 5AMFA 4QZSA 3JVMA 4A9NA 5F61A 5A5QA 5F63A 5L97A 3U5JA 4LC2A 4QB3A 4O7AA 4YBTA 4HXOA 3O33A 3S92A 5L99A 5CQ6A 4CUPA 3UV4A 3P1EA 5KU3A 4E96A 4UITA 3MULA 5HRWA 5LVRA 5ACYA 4TTEA 2RNXA 5L8UA 5D7XA 4UIZA 5I89A 3P1CA 3ERRA 5IBNA 4YYJA 5EPSA 2RO1A 4O75A 5FG5A 5CZGA 5L96A 4NR4A 4YATA 3SVHA 1F68A 5CY9A 5FE7A 5DKCA 3JVKA 5D3TA 4TT6A 4QEUA 5CRMA 2L84A 5E74A 5HFRA 3VKGA 3AQAA 5FG6A 1ZS5A 4LRGA 2F6NA 5DLXA 3D1BA 5HENA 4HXLA 2DWWA 2DATA 2L85A 5EI4A 4UYDA 5HQ5A 5DYCA 5E9KA 3U5OA 4WHWA 5IGKA 5ENHA 4A9HA 5ENBA 2YQDA 4MR3A 3P1FA 3TLPA 4CFKA 5EK9A 4BW2A 4AKIA 2L5EA 4IR4A 5CU8A 5CTLA 5E73A 4HXSA 5CUBA 5F25A 4BW3A 4GPJA 5C8GA 5FE2A 5DX4A 5DLZA 5A85A 5BT3A 5FE6A 4A9MA 4HXMA 3LQHA 5E9LA 5LKXA 5EISA 4YYNA 5EQ1A 5LKZA 4QY4A 4UYFA 4WIVA 4YADA 3Q2FA 5HRXA 4XY9A 5EWDA 4BHWA 5EM3A 2DVQA 1JSPB 5LUUA 3LJWA 5CPEA 5HFQA 5BT4A 5A81A 3ONIA 5CRZA 4ZW1A 4YYHA 5C7NA 2FSAA 4TZ8A 3VKHA 4DONA 3LQIA 4YYDA 4WHUA 5FE5A 5I7XA 4NUCA 5FB1A 1WUMA 4PKLA 3HMHA 4TQNA 4F3IA 4O7FA 2WP1A 5D0CA 3JVJA 4Z6HA 3O36A 4A9JA 3DAIA 4C67A 4MR6A 5E9IA 5DYAA 5CS8A 5CUAA 5AMEA 5TB6A 3U5LA 5A82A 5FH8A 5II1A 5FBXA 4O77A 5EWVA 3K2JA 4YAXA 4ZQLA 4N4FA 5I80A 3O37A 5FFWA 5EWWA 2RNYA 2OUOA 4XYAA 4AKNA 5CQ7A 5CGPA 5G4SA 3RCWA 5CQ4A 5H1VA 4KV1A 4NQMA 4QSVA 3GG3A 5I83A 5D26A 5EPRA 4NYWA 3O35A 4UIUA 5EV9A 4YY6A 5FH7A 4NRBA 3UVDA 4N4IA 4BW1A 5CQ5A 5D3LA 5K29A 5EICA 3UVXA 5KTWA 4HBXA 5H1TA 2I7KA 5FE4A 4TT2A 5EU1A 5E9YA 5IGNA 2EJNA 4Z1QA 3P1DA 5FFYA 5JWMA 4QSUA 5DKDA 4NR9A 4O76A 4MEQA 5CQ3A 5FE1A 4YYMA 4J1PA 5DYXA 4O70A 4O71A 5LKUA 4A9EA 5FFVA 4NR6A 4MENA 2OSSA 5I7YA 5J0DA 5FE8A 4XUAA 1PUOA 5F60A 4QNSA 3MXFA 5F1HA 3UVYA 5CFWA 5AD2A 4O7CA 5IGMA 2DVSA 2RI7A 3LXJA 5CUEA 1N72A 4TU6A 4UYGA 3G0JA 5KTXA 3IU6A 4YY4A 2E7OA 5CQ8A 4UIVA 2YDWA 5H1UA 4J0SA 5D24A 5E3GA 4O74A 5C89A 3U5NA 4A9LA 4QEVA 3UV5A 4RVRA 5DYUA 4HXRA 5A5RA 4QYLA 3U5KA 4IOOA 5FE9A 2RFJA 5L98A 4CFLA 5LJ1A 4O7BA 5DFCA 4HBWA 5HQ7A 5AD3A 4NRAA 4ALGA 4IORA 3O34A 3AADA 5BT5A 2YELA 2DVRA 2R0YA 5EP7A 5E9VA 3ZYUA 4QSTA 3MUKA 4Z93A 4UIWA 4A9FA 4UYHA 5F3AA 2R0VA 2YEMA 4MR4A 4YYIA 4QSQA 4QSRA 3IU5A 4PCEA 2NXBA 2N9GA 5II2A 4FLPA 3HMEA 4NS5A 4CURA 2RS9B 4Q0OA 5D3SA 4HBYA 5COIA 4J0RA 4QSSA 3MB3A 4QC1A 5A5NA 5C4QA 4Z6IA 3Q2EA 2OO1A 4YK0A 5LVQA 5CUGA 5CQTA 3DWYA 4PTBA 5EVAA 4YYGA 2D82A 4LZSA 5CQAA 5H85A 5KHMA 4CUTA 2MJVB 5E7DA 4XY8A 4ZC9A 5I88A 5IGLA 4YYKA 1E6IA 5A83A 4QSWA 4HXKA 3UVWA 4NRCA 5DKHA 5L8TA 5I29A 5I86A 4A9KA 4IOQA 3QZVA 2GRCA 4UIXA 4BJXA 3QZTA 3SVFA 4YBMA 4YBSA 4N3WA 5EGUA 5ENEA 5E0RA 5DY7A 4MEOA 4LYIA 5A5OA 2F6JA 4CLBA 3HMFA 5I40A 5EWCA 4CUQA 4IR6A 2RNWA 5FG4A 5IG6A 2I8NA 5D3RA 4NR8A 4QR3A 4LYWA 5DBMA 4PCIA 4NXJA 5E3DA 3NXBA 2WP2A 2R10A 4LR6A 3UW9A 5G4RA 4QEWA 2G4AA 5EA1A 4QR4A 5D25A 5ETDA 5FB0A 4NR7A 5F5ZA 4O7EA 2YYNA 3U5MA 4HXNA 1EQFA 5HLSA 5ENJA 4YH3A 4QSXA 4OGJA 4OUFA 4YC9A 5FH6A 5KO4A 5CUCA 4IR3A 3P5OA 4CUSA 5A7CA 3MB4A 5CUDA 3LQJA 2E3KA 4N4HA 3G0LA 4NUDA 2KTBB 4TYLA 5A5PA 5ENGA 3QZSA 3D7CA 1X0JA 4NYXA 1WUGA 5LKTA 3JVLA 4BW4A 4J3IA 3MQMA 5KTUA 4MR5A 4YH4A 4IR5A 4UYFB 4A9IA 3I3JA 5DFBA 4QBMA 5EWHA 4LZRA 5HELA 4XUBA 5E9MA 4HBVA 4YABA 5D3NA 4TS8A 3D1DA 3SVGA 5HM0A 4Y03A 2D9EA 5DFDA 4AKHA 2DKWA 5LJ2A 5D3JA 5C87A 4MEPA 4HXPA 4QUTA 4QSPA 2YEKA 1ZKRA 4PS5A 2H60A 5HRVA 4CL9A 5JI8A 4QR5A 5HJCA 4KCXA 4LZ2A 3U5PA 4NQNA 4QC3A 5CP5A 5FE0A 5A5SA 5HEMA 5C85A 4X2IA 5F2PA 5FDZA 4N4GA 4O78A 5DW2A 3UV2A 4Z1SA 5ENCA 4TU4A 5HCLA 2R0SA 2YW5A 4NR5A 5D3PA 4LYSA 5ENFA 4AI6A 5HQ6A 4TT4A 4KV4A 4O72A 5ENIA 4C66A 4UYEA 2LSPB 5F36A 1JM4B 4Q0NA 3S91A 4NYVA 2E7NA 5FE3A 4OGIA 4LDFA 4QYDA 5DW1A 5TCMA 5F62A 5IIDA 5F1LA 4AKGA 4TZ2A 5ETBA 5EPBA 5I1QA 4A9OA 4QUUA 3FKMX 4CUUA 4ALHA 2DVVA 5D3HA
chains in the Genus database with same CATH topology
4PY6A 4UIYA 5LJ0A 4NUEA 5AMFA 4QZSA 3JVMA 4A9NA 5F61A 5A5QA 5F63A 5L97A 3U5JA 4LC2A 4QB3A 4O7AA 4YBTA 4HXOA 3O33A 3S92A 5L99A 5CQ6A 4CUPA 3UV4A 3P1EA 5KU3A 4E96A 4UITA 3MULA 5HRWA 5LVRA 5ACYA 4TTEA 2RNXA 5L8UA 5D7XA 4UIZA 5I89A 3P1CA 5IBNA 4YYJA 5EPSA 2RO1A 4O75A 5FG5A 5CZGA 5L96A 4NR4A 4YATA 3SVHA 1F68A 5CY9A 5FE7A 5DKCA 3JVKA 5D3TA 4TT6A 4QEUA 5CRMA 2L84A 5E74A 5HFRA 3AQAA 5FG6A 1ZS5A 4LRGA 2F6NA 5DLXA 5HENA 4HXLA 2DWWA 2DATA 2L85A 5EI4A 4UYDA 5HQ5A 5DYCA 5E9KA 3U5OA 4WHWA 5IGKA 5ENHA 4A9HA 5ENBA 2YQDA 4MR3A 3P1FA 3TLPA 4CFKA 5EK9A 4BW2A 2L5EA 4IR4A 5CU8A 5CTLA 5E73A 4HXSA 5CUBA 5F25A 4BW3A 4GPJA 5C8GA 5FE2A 5DX4A 5DLZA 5A85A 5BT3A 5FE6A 4A9MA 4HXMA 3LQHA 5E9LA 5LKXA 5EISA 4YYNA 5EQ1A 5LKZA 4QY4A 4UYFA 4WIVA 4YADA 3Q2FA 5HRXA 4XY9A 5EWDA 4BHWA 5EM3A 2DVQA 1JSPB 5LUUA 3LJWA 5CPEA 5HFQA 5BT4A 5A81A 3ONIA 5CRZA 4ZW1A 4YYHA 5C7NA 2FSAA 4TZ8A 4DONA 3LQIA 4YYDA 4WHUA 5FE5A 5I7XA 4NUCA 5FB1A 1WUMA 4PKLA 3HMHA 4TQNA 4F3IA 4O7FA 2WP1A 5D0CA 3JVJA 4Z6HA 3O36A 4A9JA 3DAIA 4C67A 4MR6A 5E9IA 5DYAA 5CS8A 5CUAA 5AMEA 5TB6A 3U5LA 5A82A 5FH8A 5II1A 5FBXA 4O77A 5EWVA 3K2JA 4YAXA 4ZQLA 4N4FA 5I80A 3O37A 5FFWA 5EWWA 2RNYA 2OUOA 4XYAA 4AKNA 5CQ7A 5CGPA 5G4SA 3RCWA 5CQ4A 5H1VA 4KV1A 4NQMA 4QSVA 3GG3A 5I83A 5D26A 5EPRA 4NYWA 3O35A 4UIUA 5EV9A 4YY6A 5FH7A 4NRBA 3UVDA 4N4IA 4BW1A 5CQ5A 5D3LA 5K29A 5EICA 3UVXA 5KTWA 4HBXA 5H1TA 2I7KA 5FE4A 4TT2A 5EU1A 5E9YA 5IGNA 4Z1QA 3P1DA 5FFYA 5JWMA 4QSUA 5DKDA 4NR9A 4O76A 4MEQA 5CQ3A 5FE1A 4YYMA 4J1PA 5DYXA 4O70A 4O71A 5LKUA 4A9EA 5FFVA 4NR6A 4MENA 2OSSA 5I7YA 5J0DA 5FE8A 4XUAA 5F60A 4QNSA 3MXFA 5F1HA 3UVYA 5CFWA 5AD2A 4O7CA 5IGMA 2DVSA 2RI7A 3LXJA 5CUEA 1N72A 4TU6A 4UYGA 3G0JA 5KTXA 3IU6A 4YY4A 2E7OA 5CQ8A 4UIVA 2YDWA 5H1UA 4J0SA 5D24A 5E3GA 4O74A 5C89A 3U5NA 4A9LA 4QEVA 3UV5A 4RVRA 5DYUA 4HXRA 5A5RA 4QYLA 3U5KA 4IOOA 5FE9A 2RFJA 5L98A 4CFLA 5LJ1A 4O7BA 5DFCA 4HBWA 5HQ7A 5AD3A 4NRAA 4ALGA 4IORA 3O34A 3AADA 5BT5A 2YELA 2DVRA 2R0YA 5EP7A 5E9VA 3ZYUA 4QSTA 3MUKA 4Z93A 4UIWA 4A9FA 4UYHA 5F3AA 2R0VA 2YEMA 4MR4A 4YYIA 4QSQA 4QSRA 3IU5A 4PCEA 2NXBA 2N9GA 5II2A 4FLPA 3HMEA 4NS5A 4CURA 2RS9B 4Q0OA 5D3SA 4HBYA 5COIA 4J0RA 4QSSA 3MB3A 4QC1A 5A5NA 5C4QA 4Z6IA 3Q2EA 2OO1A 4YK0A 5LVQA 5CUGA 5CQTA 3DWYA 4PTBA 5EVAA 4YYGA 2D82A 4LZSA 5CQAA 5H85A 5KHMA 4CUTA 2MJVB 5E7DA 4XY8A 4ZC9A 5I88A 5IGLA 4YYKA 1E6IA 5A83A 4QSWA 4HXKA 3UVWA 4NRCA 5DKHA 5L8TA 5I29A 5I86A 4A9KA 4IOQA 3QZVA 2GRCA 4UIXA 4BJXA 3QZTA 3SVFA 4YBMA 4YBSA 4N3WA 5EGUA 5ENEA 5E0RA 5DY7A 4MEOA 4LYIA 5A5OA 2F6JA 4CLBA 3HMFA 5I40A 5EWCA 4CUQA 4IR6A 2RNWA 5FG4A 5IG6A 2I8NA 5D3RA 4NR8A 4QR3A 4LYWA 5DBMA 4PCIA 4NXJA 5E3DA 3NXBA 2WP2A 2R10A 4LR6A 3UW9A 5G4RA 4QEWA 2G4AA 5EA1A 4QR4A 5D25A 5ETDA 5FB0A 4NR7A 5F5ZA 4O7EA 2YYNA 3U5MA 4HXNA 1EQFA 5HLSA 5ENJA 4YH3A 4QSXA 4OGJA 4OUFA 4YC9A 5FH6A 5KO4A 5CUCA 4IR3A 3P5OA 4CUSA 5A7CA 3MB4A 5CUDA 3LQJA 2E3KA 4N4HA 3G0LA 4NUDA 2KTBB 4TYLA 5A5PA 5ENGA 3QZSA 3D7CA 1X0JA 4NYXA 1WUGA 5LKTA 3JVLA 4BW4A 4J3IA 3MQMA 5KTUA 4MR5A 4YH4A 4IR5A 4UYFB 4A9IA 3I3JA 5DFBA 4QBMA 5EWHA 4LZRA 5HELA 4XUBA 5E9MA 4HBVA 4YABA 5D3NA 4TS8A 3SVGA 5HM0A 4Y03A 2D9EA 5DFDA 2DKWA 5LJ2A 5D3JA 5C87A 4MEPA 4HXPA 4QUTA 4QSPA 2YEKA 4PS5A 2H60A 5HRVA 4CL9A 5JI8A 4QR5A 5HJCA 4KCXA 4LZ2A 3U5PA 4NQNA 4QC3A 5CP5A 5FE0A 5A5SA 5HEMA 5C85A 4X2IA 5F2PA 5FDZA 4N4GA 4O78A 5DW2A 3UV2A 4Z1SA 5ENCA 4TU4A 5HCLA 2R0SA 2YW5A 4NR5A 5D3PA 4LYSA 5ENFA 5HQ6A 4TT4A 4KV4A 4O72A 5ENIA 4C66A 4UYEA 2LSPB 5F36A 1JM4B 4Q0NA 3S91A 4NYVA 2E7NA 5FE3A 4OGIA 4LDFA 4QYDA 5DW1A 5TCMA 5F62A 5IIDA 5F1LA 4TZ2A 5ETBA 5EPBA 5I1QA 4A9OA 4QUUA 3FKMX 4CUUA 4ALHA 2DVVA 5D3HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PY6 A;  4UIY A;  5LJ0 A;  4NUE A;  5AMF A;  4QZS A;  3JVM A;  4A9N A;  5F61 A;  5A5Q A;  5F63 A;  5L97 A;  3U5J A;  4LC2 A;  4QB3 A;  4O7A A;  4YBT A;  4HXO A;  3O33 A;  3S92 A;  5L99 A;  5CQ6 A;  4CUP A;  3UV4 A;  3P1E A;  5KU3 A;  4E96 A;  4UIT A;  3MUL A;  5HRW A;  5LVR A;  5ACY A;  4TTE A;  2RNX A;  5L8U A;  5D7X A;  4UIZ A;  5I89 A;  3P1C A;  5IBN A;  4YYJ A;  5EPS A;  2RO1 A;  4O75 A;  5FG5 A;  5CZG A;  5L96 A;  4NR4 A;  4YAT A;  3SVH A;  1F68 A;  5CY9 A;  5FE7 A;  5DKC A;  3JVK A;  5D3T A;  4TT6 A;  4QEU A;  5CRM A;  2L84 A;  5E74 A;  5HFR A;  3AQA A;  5FG6 A;  1ZS5 A;  4LRG A;  2F6N A;  5DLX A;  5HEN A;  4HXL A;  2DWW A;  2DAT A;  2L85 A;  5EI4 A;  4UYD A;  5HQ5 A;  5DYC A;  5E9K A;  3U5O A;  4WHW A;  5IGK A;  5ENH A;  4A9H A;  5ENB A;  2YQD A;  4MR3 A;  3P1F A;  3TLP A;  4CFK A;  5EK9 A;  4BW2 A;  2L5E A;  4IR4 A;  5CU8 A;  5CTL A;  5E73 A;  4HXS A;  5CUB A;  5F25 A;  4BW3 A;  4GPJ A;  5C8G A;  5FE2 A;  5DX4 A;  5DLZ A;  5A85 A;  5BT3 A;  5FE6 A;  4A9M A;  4HXM A;  3LQH A;  5E9L A;  5LKX A;  5EIS A;  4YYN A;  5EQ1 A;  5LKZ A;  4QY4 A;  4UYF A;  4WIV A;  4YAD A;  3Q2F A;  5HRX A;  4XY9 A;  5EWD A;  4BHW A;  5EM3 A;  2DVQ A;  1JSP B;  5LUU A;  3LJW A;  5CPE A;  5HFQ A;  5BT4 A;  5A81 A;  3ONI A;  5CRZ A;  4ZW1 A;  4YYH A;  5C7N A;  2FSA A;  4TZ8 A;  4DON A;  3LQI A;  4YYD A;  4WHU A;  5FE5 A;  5I7X A;  4NUC A;  5FB1 A;  1WUM A;  4PKL A;  3HMH A;  4TQN A;  4F3I A;  4O7F A;  2WP1 A;  5D0C A;  3JVJ A;  4Z6H A;  3O36 A;  4A9J A;  3DAI A;  4C67 A;  4MR6 A;  5E9I A;  5DYA A;  5CS8 A;  5CUA A;  5AME A;  5TB6 A;  3U5L A;  5A82 A;  5FH8 A;  5II1 A;  5FBX A;  4O77 A;  5EWV A;  3K2J A;  4YAX A;  4ZQL A;  4N4F A;  5I80 A;  3O37 A;  5FFW A;  5EWW A;  2RNY A;  2OUO A;  4XYA A;  4AKN A;  5CQ7 A;  5CGP A;  5G4S A;  3RCW A;  5CQ4 A;  5H1V A;  4KV1 A;  4NQM A;  4QSV A;  3GG3 A;  5I83 A;  5D26 A;  5EPR A;  4NYW A;  3O35 A;  4UIU A;  5EV9 A;  4YY6 A;  5FH7 A;  4NRB A;  3UVD A;  4N4I A;  4BW1 A;  5CQ5 A;  5D3L A;  5K29 A;  5EIC A;  3UVX A;  5KTW A;  4HBX A;  5H1T A;  2I7K A;  5FE4 A;  4TT2 A;  5EU1 A;  5E9Y A;  5IGN A;  4Z1Q A;  3P1D A;  5FFY A;  5JWM A;  4QSU A;  5DKD A;  4NR9 A;  4O76 A;  4MEQ A;  5CQ3 A;  5FE1 A;  4YYM A;  4J1P A;  5DYX A;  4O70 A;  4O71 A;  5LKU A;  4A9E A;  5FFV A;  4NR6 A;  4MEN A;  2OSS A;  5I7Y A;  5J0D A;  5FE8 A;  4XUA A;  5F60 A;  4QNS A;  3MXF A;  5F1H A;  3UVY A;  5CFW A;  5AD2 A;  4O7C A;  5IGM A;  2DVS A;  2RI7 A;  3LXJ A;  5CUE A;  1N72 A;  4TU6 A;  4UYG A;  3G0J A;  5KTX A;  3IU6 A;  4YY4 A;  2E7O A;  5CQ8 A;  4UIV A;  2YDW A;  5H1U A;  4J0S A;  5D24 A;  5E3G A;  4O74 A;  5C89 A;  3U5N A;  4A9L A;  4QEV A;  3UV5 A;  4RVR A;  5DYU A;  4HXR A;  5A5R A;  4QYL A;  3U5K A;  4IOO A;  5FE9 A;  2RFJ A;  5L98 A;  4CFL A;  5LJ1 A;  4O7B A;  5DFC A;  4HBW A;  5HQ7 A;  5AD3 A;  4NRA A;  4ALG A;  4IOR A;  3O34 A;  3AAD A;  5BT5 A;  2YEL A;  2DVR A;  2R0Y A;  5EP7 A;  5E9V A;  3ZYU A;  4QST A;  3MUK A;  4Z93 A;  4UIW A;  4A9F A;  4UYH A;  5F3A A;  2R0V A;  2YEM A;  4MR4 A;  4YYI A;  4QSQ A;  4QSR A;  3IU5 A;  4PCE A;  2NXB A;  2N9G A;  5II2 A;  4FLP A;  3HME A;  4NS5 A;  4CUR A;  2RS9 B;  4Q0O A;  5D3S A;  4HBY A;  5COI A;  4J0R A;  4QSS A;  3MB3 A;  4QC1 A;  5A5N A;  5C4Q A;  4Z6I A;  3Q2E A;  2OO1 A;  4YK0 A;  5LVQ A;  5CUG A;  5CQT A;  3DWY A;  4PTB A;  5EVA A;  4YYG A;  2D82 A;  4LZS A;  5CQA A;  5H85 A;  5KHM A;  4CUT A;  2MJV B;  5E7D A;  4XY8 A;  4ZC9 A;  5I88 A;  5IGL A;  4YYK A;  1E6I A;  5A83 A;  4QSW A;  4HXK A;  3UVW A;  4NRC A;  5DKH A;  5L8T A;  5I29 A;  5I86 A;  4A9K A;  4IOQ A;  3QZV A;  2GRC A;  4UIX A;  4BJX A;  3QZT A;  3SVF A;  4YBM A;  4YBS A;  4N3W A;  5EGU A;  5ENE A;  5E0R A;  5DY7 A;  4MEO A;  4LYI A;  5A5O A;  2F6J A;  4CLB A;  3HMF A;  5I40 A;  5EWC A;  4CUQ A;  4IR6 A;  2RNW A;  5FG4 A;  5IG6 A;  2I8N A;  5D3R A;  4NR8 A;  4QR3 A;  4LYW A;  5DBM A;  4PCI A;  4NXJ A;  5E3D A;  3NXB A;  2WP2 A;  2R10 A;  4LR6 A;  3UW9 A;  5G4R A;  4QEW A;  2G4A A;  5EA1 A;  4QR4 A;  5D25 A;  5ETD A;  5FB0 A;  4NR7 A;  5F5Z A;  4O7E A;  2YYN A;  3U5M A;  4HXN A;  1EQF A;  5HLS A;  5ENJ A;  4YH3 A;  4QSX A;  4OGJ A;  4OUF A;  4YC9 A;  5FH6 A;  5KO4 A;  5CUC A;  4IR3 A;  3P5O A;  4CUS A;  5A7C A;  3MB4 A;  5CUD A;  3LQJ A;  2E3K A;  4N4H A;  3G0L A;  4NUD A;  2KTB B;  4TYL A;  5A5P A;  5ENG A;  3QZS A;  3D7C A;  1X0J A;  4NYX A;  1WUG A;  5LKT A;  3JVL A;  4BW4 A;  4J3I A;  3MQM A;  5KTU A;  4MR5 A;  4YH4 A;  4IR5 A;  4UYF B;  4A9I A;  3I3J A;  5DFB A;  4QBM A;  5EWH A;  4LZR A;  5HEL A;  4XUB A;  5E9M A;  4HBV A;  4YAB A;  5D3N A;  4TS8 A;  3SVG A;  5HM0 A;  4Y03 A;  2D9E A;  5DFD A;  2DKW A;  5LJ2 A;  5D3J A;  5C87 A;  4MEP A;  4HXP A;  4QUT A;  4QSP A;  2YEK A;  4PS5 A;  2H60 A;  5HRV A;  4CL9 A;  5JI8 A;  4QR5 A;  5HJC A;  4KCX A;  4LZ2 A;  3U5P A;  4NQN A;  4QC3 A;  5CP5 A;  5FE0 A;  5A5S A;  5HEM A;  5C85 A;  4X2I A;  5F2P A;  5FDZ A;  4N4G A;  4O78 A;  5DW2 A;  3UV2 A;  4Z1S A;  5ENC A;  4TU4 A;  5HCL A;  2R0S A;  2YW5 A;  4NR5 A;  5D3P A;  4LYS A;  5ENF A;  5HQ6 A;  4TT4 A;  4KV4 A;  4O72 A;  5ENI A;  4C66 A;  4UYE A;  2LSP B;  5F36 A;  1JM4 B;  4Q0N A;  3S91 A;  4NYV A;  2E7N A;  5FE3 A;  4OGI A;  4LDF A;  4QYD A;  5DW1 A;  5TCM A;  5F62 A;  5IID A;  5F1L A;  4TZ2 A;  5ETB A;  5EPB A;  5I1Q A;  4A9O A;  4QUU A;  3FKM X;  4CUU A;  4ALH A;  2DVV A;  5D3H A; 
#chains in the Genus database with same CATH topology
 4PY6 A;  4UIY A;  5LJ0 A;  4NUE A;  5AMF A;  4QZS A;  3JVM A;  4A9N A;  5F61 A;  5A5Q A;  5F63 A;  5L97 A;  3U5J A;  4LC2 A;  4QB3 A;  4O7A A;  4YBT A;  4HXO A;  3O33 A;  3S92 A;  5L99 A;  5CQ6 A;  4CUP A;  3UV4 A;  3P1E A;  5KU3 A;  4E96 A;  4UIT A;  3MUL A;  5HRW A;  5LVR A;  5ACY A;  4TTE A;  2RNX A;  5L8U A;  5D7X A;  4UIZ A;  5I89 A;  3P1C A;  3ERR A;  5IBN A;  4YYJ A;  5EPS A;  2RO1 A;  4O75 A;  5FG5 A;  5CZG A;  5L96 A;  4NR4 A;  4YAT A;  3SVH A;  1F68 A;  5CY9 A;  5FE7 A;  5DKC A;  3JVK A;  5D3T A;  4TT6 A;  4QEU A;  5CRM A;  2L84 A;  5E74 A;  5HFR A;  3VKG A;  3AQA A;  5FG6 A;  1ZS5 A;  4LRG A;  2F6N A;  5DLX A;  3D1B A;  5HEN A;  4HXL A;  2DWW A;  2DAT A;  2L85 A;  5EI4 A;  4UYD A;  5HQ5 A;  5DYC A;  5E9K A;  3U5O A;  4WHW A;  5IGK A;  5ENH A;  4A9H A;  5ENB A;  2YQD A;  4MR3 A;  3P1F A;  3TLP A;  4CFK A;  5EK9 A;  4BW2 A;  4AKI A;  2L5E A;  4IR4 A;  5CU8 A;  5CTL A;  5E73 A;  4HXS A;  5CUB A;  5F25 A;  4BW3 A;  4GPJ A;  5C8G A;  5FE2 A;  5DX4 A;  5DLZ A;  5A85 A;  5BT3 A;  5FE6 A;  4A9M A;  4HXM A;  3LQH A;  5E9L A;  5LKX A;  5EIS A;  4YYN A;  5EQ1 A;  5LKZ A;  4QY4 A;  4UYF A;  4WIV A;  4YAD A;  3Q2F A;  5HRX A;  4XY9 A;  5EWD A;  4BHW A;  5EM3 A;  2DVQ A;  1JSP B;  5LUU A;  3LJW A;  5CPE A;  5HFQ A;  5BT4 A;  5A81 A;  3ONI A;  5CRZ A;  4ZW1 A;  4YYH A;  5C7N A;  2FSA A;  4TZ8 A;  3VKH A;  4DON A;  3LQI A;  4YYD A;  4WHU A;  5FE5 A;  5I7X A;  4NUC A;  5FB1 A;  1WUM A;  4PKL A;  3HMH A;  4TQN A;  4F3I A;  4O7F A;  2WP1 A;  5D0C A;  3JVJ A;  4Z6H A;  3O36 A;  4A9J A;  3DAI A;  4C67 A;  4MR6 A;  5E9I A;  5DYA A;  5CS8 A;  5CUA A;  5AME A;  5TB6 A;  3U5L A;  5A82 A;  5FH8 A;  5II1 A;  5FBX A;  4O77 A;  5EWV A;  3K2J A;  4YAX A;  4ZQL A;  4N4F A;  5I80 A;  3O37 A;  5FFW A;  5EWW A;  2RNY A;  2OUO A;  4XYA A;  4AKN A;  5CQ7 A;  5CGP A;  5G4S A;  3RCW A;  5CQ4 A;  5H1V A;  4KV1 A;  4NQM A;  4QSV A;  3GG3 A;  5I83 A;  5D26 A;  5EPR A;  4NYW A;  3O35 A;  4UIU A;  5EV9 A;  4YY6 A;  5FH7 A;  4NRB A;  3UVD A;  4N4I A;  4BW1 A;  5CQ5 A;  5D3L A;  5K29 A;  5EIC A;  3UVX A;  5KTW A;  4HBX A;  5H1T A;  2I7K A;  5FE4 A;  4TT2 A;  5EU1 A;  5E9Y A;  5IGN A;  2EJN A;  4Z1Q A;  3P1D A;  5FFY A;  5JWM A;  4QSU A;  5DKD A;  4NR9 A;  4O76 A;  4MEQ A;  5CQ3 A;  5FE1 A;  4YYM A;  4J1P A;  5DYX A;  4O70 A;  4O71 A;  5LKU A;  4A9E A;  5FFV A;  4NR6 A;  4MEN A;  2OSS A;  5I7Y A;  5J0D A;  5FE8 A;  4XUA A;  1PUO A;  5F60 A;  4QNS A;  3MXF A;  5F1H A;  3UVY A;  5CFW A;  5AD2 A;  4O7C A;  5IGM A;  2DVS A;  2RI7 A;  3LXJ A;  5CUE A;  1N72 A;  4TU6 A;  4UYG A;  3G0J A;  5KTX A;  3IU6 A;  4YY4 A;  2E7O A;  5CQ8 A;  4UIV A;  2YDW A;  5H1U A;  4J0S A;  5D24 A;  5E3G A;  4O74 A;  5C89 A;  3U5N A;  4A9L A;  4QEV A;  3UV5 A;  4RVR A;  5DYU A;  4HXR A;  5A5R A;  4QYL A;  3U5K A;  4IOO A;  5FE9 A;  2RFJ A;  5L98 A;  4CFL A;  5LJ1 A;  4O7B A;  5DFC A;  4HBW A;  5HQ7 A;  5AD3 A;  4NRA A;  4ALG A;  4IOR A;  3O34 A;  3AAD A;  5BT5 A;  2YEL A;  2DVR A;  2R0Y A;  5EP7 A;  5E9V A;  3ZYU A;  4QST A;  3MUK A;  4Z93 A;  4UIW A;  4A9F A;  4UYH A;  5F3A A;  2R0V A;  2YEM A;  4MR4 A;  4YYI A;  4QSQ A;  4QSR A;  3IU5 A;  4PCE A;  2NXB A;  2N9G A;  5II2 A;  4FLP A;  3HME A;  4NS5 A;  4CUR A;  2RS9 B;  4Q0O A;  5D3S A;  4HBY A;  5COI A;  4J0R A;  4QSS A;  3MB3 A;  4QC1 A;  5A5N A;  5C4Q A;  4Z6I A;  3Q2E A;  2OO1 A;  4YK0 A;  5LVQ A;  5CUG A;  5CQT A;  3DWY A;  4PTB A;  5EVA A;  4YYG A;  2D82 A;  4LZS A;  5CQA A;  5H85 A;  5KHM A;  4CUT A;  2MJV B;  5E7D A;  4XY8 A;  4ZC9 A;  5I88 A;  5IGL A;  4YYK A;  1E6I A;  5A83 A;  4QSW A;  4HXK A;  3UVW A;  4NRC A;  5DKH A;  5L8T A;  5I29 A;  5I86 A;  4A9K A;  4IOQ A;  3QZV A;  2GRC A;  4UIX A;  4BJX A;  3QZT A;  3SVF A;  4YBM A;  4YBS A;  4N3W A;  5EGU A;  5ENE A;  5E0R A;  5DY7 A;  4MEO A;  4LYI A;  5A5O A;  2F6J A;  4CLB A;  3HMF A;  5I40 A;  5EWC A;  4CUQ A;  4IR6 A;  2RNW A;  5FG4 A;  5IG6 A;  2I8N A;  5D3R A;  4NR8 A;  4QR3 A;  4LYW A;  5DBM A;  4PCI A;  4NXJ A;  5E3D A;  3NXB A;  2WP2 A;  2R10 A;  4LR6 A;  3UW9 A;  5G4R A;  4QEW A;  2G4A A;  5EA1 A;  4QR4 A;  5D25 A;  5ETD A;  5FB0 A;  4NR7 A;  5F5Z A;  4O7E A;  2YYN A;  3U5M A;  4HXN A;  1EQF A;  5HLS A;  5ENJ A;  4YH3 A;  4QSX A;  4OGJ A;  4OUF A;  4YC9 A;  5FH6 A;  5KO4 A;  5CUC A;  4IR3 A;  3P5O A;  4CUS A;  5A7C A;  3MB4 A;  5CUD A;  3LQJ A;  2E3K A;  4N4H A;  3G0L A;  4NUD A;  2KTB B;  4TYL A;  5A5P A;  5ENG A;  3QZS A;  3D7C A;  1X0J A;  4NYX A;  1WUG A;  5LKT A;  3JVL A;  4BW4 A;  4J3I A;  3MQM A;  5KTU A;  4MR5 A;  4YH4 A;  4IR5 A;  4UYF B;  4A9I A;  3I3J A;  5DFB A;  4QBM A;  5EWH A;  4LZR A;  5HEL A;  4XUB A;  5E9M A;  4HBV A;  4YAB A;  5D3N A;  4TS8 A;  3D1D A;  3SVG A;  5HM0 A;  4Y03 A;  2D9E A;  5DFD A;  4AKH A;  2DKW A;  5LJ2 A;  5D3J A;  5C87 A;  4MEP A;  4HXP A;  4QUT A;  4QSP A;  2YEK A;  1ZKR A;  4PS5 A;  2H60 A;  5HRV A;  4CL9 A;  5JI8 A;  4QR5 A;  5HJC A;  4KCX A;  4LZ2 A;  3U5P A;  4NQN A;  4QC3 A;  5CP5 A;  5FE0 A;  5A5S A;  5HEM A;  5C85 A;  4X2I A;  5F2P A;  5FDZ A;  4N4G A;  4O78 A;  5DW2 A;  3UV2 A;  4Z1S A;  5ENC A;  4TU4 A;  5HCL A;  2R0S A;  2YW5 A;  4NR5 A;  5D3P A;  4LYS A;  5ENF A;  4AI6 A;  5HQ6 A;  4TT4 A;  4KV4 A;  4O72 A;  5ENI A;  4C66 A;  4UYE A;  2LSP B;  5F36 A;  1JM4 B;  4Q0N A;  3S91 A;  4NYV A;  2E7N A;  5FE3 A;  4OGI A;  4LDF A;  4QYD A;  5DW1 A;  5TCM A;  5F62 A;  5IID A;  5F1L A;  4AKG A;  4TZ2 A;  5ETB A;  5EPB A;  5I1Q A;  4A9O A;  4QUU A;  3FKM X;  4CUU A;  4ALH A;  2DVV A;  5D3H A; 
#chains in the Genus database with same CATH homology
 4PY6 A;  4UIY A;  5LJ0 A;  4NUE A;  5AMF A;  4QZS A;  3JVM A;  4A9N A;  5F61 A;  5A5Q A;  5F63 A;  5L97 A;  3U5J A;  4LC2 A;  4QB3 A;  4O7A A;  4YBT A;  4HXO A;  3O33 A;  3S92 A;  5L99 A;  5CQ6 A;  4CUP A;  3UV4 A;  3P1E A;  5KU3 A;  4E96 A;  4UIT A;  3MUL A;  5HRW A;  5LVR A;  5ACY A;  4TTE A;  2RNX A;  5L8U A;  5D7X A;  4UIZ A;  5I89 A;  3P1C A;  5IBN A;  4YYJ A;  5EPS A;  2RO1 A;  4O75 A;  5FG5 A;  5CZG A;  5L96 A;  4NR4 A;  4YAT A;  3SVH A;  1F68 A;  5CY9 A;  5FE7 A;  5DKC A;  3JVK A;  5D3T A;  4TT6 A;  4QEU A;  5CRM A;  2L84 A;  5E74 A;  5HFR A;  3AQA A;  5FG6 A;  1ZS5 A;  4LRG A;  2F6N A;  5DLX A;  5HEN A;  4HXL A;  2DWW A;  2DAT A;  2L85 A;  5EI4 A;  4UYD A;  5HQ5 A;  5DYC A;  5E9K A;  3U5O A;  4WHW A;  5IGK A;  5ENH A;  4A9H A;  5ENB A;  2YQD A;  4MR3 A;  3P1F A;  3TLP A;  4CFK A;  5EK9 A;  4BW2 A;  2L5E A;  4IR4 A;  5CU8 A;  5CTL A;  5E73 A;  4HXS A;  5CUB A;  5F25 A;  4BW3 A;  4GPJ A;  5C8G A;  5FE2 A;  5DX4 A;  5DLZ A;  5A85 A;  5BT3 A;  5FE6 A;  4A9M A;  4HXM A;  3LQH A;  5E9L A;  5LKX A;  5EIS A;  4YYN A;  5EQ1 A;  5LKZ A;  4QY4 A;  4UYF A;  4WIV A;  4YAD A;  3Q2F A;  5HRX A;  4XY9 A;  5EWD A;  4BHW A;  5EM3 A;  2DVQ A;  1JSP B;  5LUU A;  3LJW A;  5CPE A;  5HFQ A;  5BT4 A;  5A81 A;  3ONI A;  5CRZ A;  4ZW1 A;  4YYH A;  5C7N A;  2FSA A;  4TZ8 A;  4DON A;  3LQI A;  4YYD A;  4WHU A;  5FE5 A;  5I7X A;  4NUC A;  5FB1 A;  1WUM A;  4PKL A;  3HMH A;  4TQN A;  4F3I A;  4O7F A;  2WP1 A;  5D0C A;  3JVJ A;  4Z6H A;  3O36 A;  4A9J A;  3DAI A;  4C67 A;  4MR6 A;  5E9I A;  5DYA A;  5CS8 A;  5CUA A;  5AME A;  5TB6 A;  3U5L A;  5A82 A;  5FH8 A;  5II1 A;  5FBX A;  4O77 A;  5EWV A;  3K2J A;  4YAX A;  4ZQL A;  4N4F A;  5I80 A;  3O37 A;  5FFW A;  5EWW A;  2RNY A;  2OUO A;  4XYA A;  4AKN A;  5CQ7 A;  5CGP A;  5G4S A;  3RCW A;  5CQ4 A;  5H1V A;  4KV1 A;  4NQM A;  4QSV A;  3GG3 A;  5I83 A;  5D26 A;  5EPR A;  4NYW A;  3O35 A;  4UIU A;  5EV9 A;  4YY6 A;  5FH7 A;  4NRB A;  3UVD A;  4N4I A;  4BW1 A;  5CQ5 A;  5D3L A;  5K29 A;  5EIC A;  3UVX A;  5KTW A;  4HBX A;  5H1T A;  2I7K A;  5FE4 A;  4TT2 A;  5EU1 A;  5E9Y A;  5IGN A;  4Z1Q A;  3P1D A;  5FFY A;  5JWM A;  4QSU A;  5DKD A;  4NR9 A;  4O76 A;  4MEQ A;  5CQ3 A;  5FE1 A;  4YYM A;  4J1P A;  5DYX A;  4O70 A;  4O71 A;  5LKU A;  4A9E A;  5FFV A;  4NR6 A;  4MEN A;  2OSS A;  5I7Y A;  5J0D A;  5FE8 A;  4XUA A;  5F60 A;  4QNS A;  3MXF A;  5F1H A;  3UVY A;  5CFW A;  5AD2 A;  4O7C A;  5IGM A;  2DVS A;  2RI7 A;  3LXJ A;  5CUE A;  1N72 A;  4TU6 A;  4UYG A;  3G0J A;  5KTX A;  3IU6 A;  4YY4 A;  2E7O A;  5CQ8 A;  4UIV A;  2YDW A;  5H1U A;  4J0S A;  5D24 A;  5E3G A;  4O74 A;  5C89 A;  3U5N A;  4A9L A;  4QEV A;  3UV5 A;  4RVR A;  5DYU A;  4HXR A;  5A5R A;  4QYL A;  3U5K A;  4IOO A;  5FE9 A;  2RFJ A;  5L98 A;  4CFL A;  5LJ1 A;  4O7B A;  5DFC A;  4HBW A;  5HQ7 A;  5AD3 A;  4NRA A;  4ALG A;  4IOR A;  3O34 A;  3AAD A;  5BT5 A;  2YEL A;  2DVR A;  2R0Y A;  5EP7 A;  5E9V A;  3ZYU A;  4QST A;  3MUK A;  4Z93 A;  4UIW A;  4A9F A;  4UYH A;  5F3A A;  2R0V A;  2YEM A;  4MR4 A;  4YYI A;  4QSQ A;  4QSR A;  3IU5 A;  4PCE A;  2NXB A;  2N9G A;  5II2 A;  4FLP A;  3HME A;  4NS5 A;  4CUR A;  2RS9 B;  4Q0O A;  5D3S A;  4HBY A;  5COI A;  4J0R A;  4QSS A;  3MB3 A;  4QC1 A;  5A5N A;  5C4Q A;  4Z6I A;  3Q2E A;  2OO1 A;  4YK0 A;  5LVQ A;  5CUG A;  5CQT A;  3DWY A;  4PTB A;  5EVA A;  4YYG A;  2D82 A;  4LZS A;  5CQA A;  5H85 A;  5KHM A;  4CUT A;  2MJV B;  5E7D A;  4XY8 A;  4ZC9 A;  5I88 A;  5IGL A;  4YYK A;  1E6I A;  5A83 A;  4QSW A;  4HXK A;  3UVW A;  4NRC A;  5DKH A;  5L8T A;  5I29 A;  5I86 A;  4A9K A;  4IOQ A;  3QZV A;  2GRC A;  4UIX A;  4BJX A;  3QZT A;  3SVF A;  4YBM A;  4YBS A;  4N3W A;  5EGU A;  5ENE A;  5E0R A;  5DY7 A;  4MEO A;  4LYI A;  5A5O A;  2F6J A;  4CLB A;  3HMF A;  5I40 A;  5EWC A;  4CUQ A;  4IR6 A;  2RNW A;  5FG4 A;  5IG6 A;  2I8N A;  5D3R A;  4NR8 A;  4QR3 A;  4LYW A;  5DBM A;  4PCI A;  4NXJ A;  5E3D A;  3NXB A;  2WP2 A;  2R10 A;  4LR6 A;  3UW9 A;  5G4R A;  4QEW A;  2G4A A;  5EA1 A;  4QR4 A;  5D25 A;  5ETD A;  5FB0 A;  4NR7 A;  5F5Z A;  4O7E A;  2YYN A;  3U5M A;  4HXN A;  1EQF A;  5HLS A;  5ENJ A;  4YH3 A;  4QSX A;  4OGJ A;  4OUF A;  4YC9 A;  5FH6 A;  5KO4 A;  5CUC A;  4IR3 A;  3P5O A;  4CUS A;  5A7C A;  3MB4 A;  5CUD A;  3LQJ A;  2E3K A;  4N4H A;  3G0L A;  4NUD A;  2KTB B;  4TYL A;  5A5P A;  5ENG A;  3QZS A;  3D7C A;  1X0J A;  4NYX A;  1WUG A;  5LKT A;  3JVL A;  4BW4 A;  4J3I A;  3MQM A;  5KTU A;  4MR5 A;  4YH4 A;  4IR5 A;  4UYF B;  4A9I A;  3I3J A;  5DFB A;  4QBM A;  5EWH A;  4LZR A;  5HEL A;  4XUB A;  5E9M A;  4HBV A;  4YAB A;  5D3N A;  4TS8 A;  3SVG A;  5HM0 A;  4Y03 A;  2D9E A;  5DFD A;  2DKW A;  5LJ2 A;  5D3J A;  5C87 A;  4MEP A;  4HXP A;  4QUT A;  4QSP A;  2YEK A;  4PS5 A;  2H60 A;  5HRV A;  4CL9 A;  5JI8 A;  4QR5 A;  5HJC A;  4KCX A;  4LZ2 A;  3U5P A;  4NQN A;  4QC3 A;  5CP5 A;  5FE0 A;  5A5S A;  5HEM A;  5C85 A;  4X2I A;  5F2P A;  5FDZ A;  4N4G A;  4O78 A;  5DW2 A;  3UV2 A;  4Z1S A;  5ENC A;  4TU4 A;  5HCL A;  2R0S A;  2YW5 A;  4NR5 A;  5D3P A;  4LYS A;  5ENF A;  5HQ6 A;  4TT4 A;  4KV4 A;  4O72 A;  5ENI A;  4C66 A;  4UYE A;  2LSP B;  5F36 A;  1JM4 B;  4Q0N A;  3S91 A;  4NYV A;  2E7N A;  5FE3 A;  4OGI A;  4LDF A;  4QYD A;  5DW1 A;  5TCM A;  5F62 A;  5IID A;  5F1L A;  4TZ2 A;  5ETB A;  5EPB A;  5I1Q A;  4A9O A;  4QUU A;  3FKM X;  4CUU A;  4ALH A;  2DVV A;  5D3H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...