5A5RA

Crystal structure of human atad2 bromodomain in complex with 5-5- methoxypyridin-3-yl-3-methyl-8-piperidin-4-ylamino-1,2-dihydro-1,7- naphthyridin-2-one
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
130
structure length
130
Chain Sequence
SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICSNALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords ATPASE FAMILY AAA DOMAIN-CONTAINING PROTEIN 2
publication title Fragment-Based Discovery of Low-Micromolar Atad2 Bromodomain Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 55
structure length 130
sequence length 130
ec nomenclature ec 3.6.1.3: Adenosinetriphosphatase.
pdb deposition date 2015-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5a5rA00
5KTWA 3IU5A 4C67A 4OGIA 5G4RA 4YBSA 5G4SA 4MR3A 5HRWA 5KHMA 3U5NA 3O36A 4A9JA 5EISA 5FG6A 4CFLA 5D26A 5LUUA 4CUTA 5EICA 5A81A 4HBWA 4HXSA 5ENFA 5IIDA 5E9YA 5F62A 4O7FA 2WP2A 5A83A 4MEPA 2MJVB 5FE3A 2OO1A 5E9KA 3U5JA 5HRXA 4Z93A 4HBVA 5FFWA 5HQ5A 5CTLA 3S91A 2RNWA 4O7EA 5KO4A 4YYHA 5CGPA 4LDFA 3U5KA 5JWMA 5H1TA 5CUBA 4J1PA 4J3IA 5LKXA 4QNSA 5IGLA 5BT5A 5EM3A 5A5NA 4YH3A 4QSXA 5HEMA 5DY7A 5I7YA 3UVDA 3P1DA 4O78A 4KV1A 5C85A 1ZS5A 3UV2A 3G0LA 4LZRA 4KCXA 2D82A 2YEMA 2YDWA 5CUAA 2DVQA 5EWHA 4NQNA 4QUTA 4Z1QA 5C4QA 4NRAA 4HXLA 1JM4B 3O37A 5CRMA 4UYHA 4UYEA 5FDZA 5E74A 1WUGA 2RNXA 5CY9A 4O71A 3UW9A 4BHWA 4LZ2A 2I7KA 5E0RA 5CQ3A 4CUPA 4XY8A 4YYGA 5ENEA 5ETBA 5D7XA 5HRVA 2I8NA 5CQTA 4QC3A 5E7DA 2RS9B 4O7CA 5CUDA 4NYXA 2RO1A 4QSPA 4YYMA 4O70A 5ENHA 2YEKA 2DATA 5E9VA 4MR4A 4UIWA 4N4GA 4YYKA 4ZW1A 5E3GA 4UYDA 5FH7A 5C8GA 4NR5A 2DVRA 5C87A 5KU3A 2WP1A 4QB3A 5II1A 4YYJA 5CQ4A 3DAIA 5EA1A 4QEWA 5EK9A 4NUCA 5BT3A 5AD2A 5COIA 4MENA 5FB0A 4NRCA 3TLPA 5II2A 2DVSA 4MR6A 5CQ8A 3U5MA 5EPRA 4QEVA 2DWWA 4QYDA 5F36A 5D3JA 5ENIA 3GG3A 4N3WA 4UYFB 2OUOA 4YAXA 4YYIA 3U5PA 2L84A 5IGMA 5FE1A 4YC9A 5A5RA 3JVLA 4NXJA 3MULA 4LYIA 5HFRA 5HJCA 4IR4A 5HCLA 4IOOA 4HXNA 4WHUA 4TT4A 3D7CA 4TZ2A 5CU8A 4NYVA 5F60A 4PKLA 4XUBA 4CUSA 2YQDA 4OGJA 5ENCA 5CFWA 4FLPA 5D0CA 5D3TA 5ENBA 4HXOA 5A5OA 4ZQLA 5EWCA 5FH6A 5A5SA 5FFYA 3NXBA 4TZ8A 2YELA 4YK0A 5LKUA 5CP5A 2FSAA 4HXRA 5I89A 5IBNA 4IR6A 5FE4A 5EGUA 2G4AA 4NR9A 5EU1A 3HMEA 5F1HA 4RVRA 5KTUA 2RFJA 4LYSA 3JVMA 4QBMA 5E73A 4UITA 4ALGA 2L5EA 4C66A 4QUUA 4X2IA 5FE7A 4TTEA 2H60A 3G0JA 4CURA 5D24A 1EQFA 5D3RA 4J0RA 1F68A 3HMHA 4TYLA 5AD3A 4QSVA 4YYNA 2RNYA 4HBYA 2YYNA 2KTBB 5TCMA 4QY4A 5CQ6A 5FE2A 4O7BA 4PY6A 5DX4A 4LZSA 5DYCA 5FE8A 3MB4A 5CUGA 5F3AA 4O72A 5DLZA 2NXBA 4N4FA 4YABA 1JSPB 4MR5A 5L99A 4A9IA 3UVWA 4UYFA 3UV5A 3HMFA 3UV4A 5L96A 3SVGA 5HM0A 3I3JA 3MXFA 5H85A 3O35A 3MQMA 5E9IA 2E3KA 4WHWA 4IORA 5F63A 3MUKA 5L98A 4O74A 5D3SA 3Q2FA 5HFQA 3UVXA 5DLXA 5FG4A 3MB3A 4O75A 4LRGA 5D3LA 3QZTA 2R0SA 4HXKA 4YH4A 3AQAA 3U5OA 5FE6A 4YYDA 5ENJA 5ETDA 4QSQA 5LVRA 4PTBA 5ACYA 5A7CA 4HXMA 5LVQA 5AMEA 2R10A 4QR5A 5AMFA 4ZC9A 4A9NA 5F1LA 4UIYA 2N9GA 5F2PA 4A9OA 5F25A 5CS8A 5FE9A 5H1UA 4XY9A 5F5ZA 5IGNA 4UIVA 5A82A 5I1QA 5D25A 4QSTA 1WUMA 4XUAA 1E6IA 5DKHA 3FKMX 4NR4A 2YW5A 5DFBA 4A9LA 4A9KA 4YADA 4Q0NA 3ONIA 5DYUA 4NUEA 4QR3A 2DKWA 5CUCA 3U5LA 2DVVA 5A5PA 4TU6A 5EWDA 4BW4A 4A9HA 5HQ6A 2D9EA 3JVJA 5D3PA 3SVHA 4PCEA 4N4IA 4CFKA 3K2JA 2E7NA 5LJ2A 4A9FA 4NUDA 4TU4A 5ENGA 4GPJA 5LJ1A 4AKNA 4YY6A 4QR4A 5HQ7A 5HLSA 4J0SA 4TS8A 4OUFA 5I86A 4QSWA 2RI7A 5DYAA 3DWYA 4Y03A 5CQ7A 3LQIA 4O76A 2LSPB 5H1VA 5EPBA 5E9MA 3O34A 5EPSA 4YBMA 4CUQA 4QYLA 5FE0A 3LQHA 2GRCA 3LXJA 5FH8A 5D3NA 3UVYA 5DYXA 4CLBA 4BW2A 3QZVA 5DBMA 5DKCA 5I40A 1N72A 2F6JA 4IR3A 4LR6A 5FG5A 5A85A 5K29A 4TT2A 4UIXA 4BW1A 4A9MA 4CUUA 3AADA 4PCIA 4YY4A 5EP7A 5IG6A 5EVAA 4N4HA 5EQ1A 4UIZA 4IR5A 3QZSA 4QZSA 4LYWA 2R0VA 3JVKA 4Z1SA 2F6NA 4MEQA 5HELA 4CL9A 5I29A 3LQJA 3O33A 4IOQA 4PS5A 4ALHA 4QC1A 5L8UA 5C89A 5TB6A 4NR6A 5I80A 4QEUA 5I83A 4F3IA 4NYWA 3P1FA 4NS5A 5EV9A 5EWVA 4UYGA 3P5OA 4KV4A 4MEOA 4NR8A 5DFDA 5HENA 5J0DA 2E7OA 5CRZA 2OSSA 4Z6IA 4NRBA 3P1EA 4O77A 5A5QA 5LKTA 5FFVA 3LJWA 3ZYUA 4TQNA 1X0JA 5DW2A 5FB1A 4TT6A 5FBXA 4DONA 4NR7A 5D3HA 2L85A 5EWWA 5DFCA 4XYAA 2R0YA 3IU6A 3SVFA 3P1CA 5CPEA 3S92A 4O7AA 5I88A 4BW3A 4BJXA 5EI4A 4WIVA 5CUEA 5C7NA 4HXPA 4Q0OA 4UIUA 4QSSA 5CZGA 5IGKA 5F61A 4QSUA 4YATA 3Q2EA 4A9EA 5FE5A 5JI8A 4YBTA 4Z6HA 5CQAA 4HBXA 5L8TA 3RCWA 4QSRA 4NQMA 5DW1A 4LC2A 5CQ5A 5KTXA 5E3DA 5LJ0A 5E9LA 5DKDA 5I7XA 4E96A 5BT4A 5LKZA 5L97A
chains in the Genus database with same CATH superfamily
5KTWA 3IU5A 4C67A 4OGIA 5G4RA 4YBSA 5G4SA 4MR3A 5HRWA 5KHMA 3U5NA 3O36A 4A9JA 5EISA 5FG6A 4CFLA 5D26A 5LUUA 4CUTA 5EICA 5A81A 4HBWA 4HXSA 5ENFA 5IIDA 5E9YA 5F62A 4O7FA 2WP2A 5A83A 4MEPA 4AKHA 2MJVB 5FE3A 2OO1A 5E9KA 3U5JA 5HRXA 4Z93A 4HBVA 5FFWA 5HQ5A 5CTLA 3S91A 2RNWA 4O7EA 5KO4A 4YYHA 5CGPA 4LDFA 3U5KA 5JWMA 5H1TA 5CUBA 4J1PA 4J3IA 5LKXA 4QNSA 5IGLA 5BT5A 5EM3A 5A5NA 4YH3A 4QSXA 5HEMA 5DY7A 5I7YA 3UVDA 3P1DA 4O78A 4KV1A 5C85A 1ZS5A 3UV2A 3G0LA 3VKHA 4LZRA 4KCXA 2D82A 2YEMA 2YDWA 5CUAA 2DVQA 5EWHA 4NQNA 4QUTA 4Z1QA 5C4QA 4NRAA 4HXLA 1JM4B 3O37A 5CRMA 4UYHA 4UYEA 5FDZA 5E74A 1ZKRA 1WUGA 2RNXA 5CY9A 4O71A 3UW9A 4BHWA 4LZ2A 2I7KA 5E0RA 5CQ3A 4CUPA 4XY8A 4YYGA 5ENEA 5ETBA 5D7XA 5HRVA 2I8NA 5CQTA 4QC3A 5E7DA 2RS9B 4O7CA 5CUDA 4NYXA 2RO1A 4QSPA 4YYMA 4O70A 5ENHA 2YEKA 2DATA 5E9VA 4MR4A 4UIWA 4AI6A 4N4GA 4YYKA 4ZW1A 5E3GA 4UYDA 5FH7A 5C8GA 4NR5A 2DVRA 5C87A 1PUOA 5KU3A 2WP1A 3VKGA 4QB3A 5II1A 4YYJA 5CQ4A 3DAIA 5EA1A 4QEWA 5EK9A 4NUCA 3D1BA 5BT3A 5AD2A 5COIA 4MENA 5FB0A 4NRCA 3TLPA 5II2A 2DVSA 4MR6A 5CQ8A 3U5MA 5EPRA 4QEVA 2DWWA 4QYDA 5F36A 5D3JA 5ENIA 3GG3A 4N3WA 4UYFB 2OUOA 4YAXA 4YYIA 3U5PA 2L84A 5IGMA 5FE1A 4YC9A 5A5RA 3JVLA 4NXJA 3MULA 4LYIA 5HFRA 5HJCA 4IR4A 5HCLA 4IOOA 4HXNA 4WHUA 4TT4A 3D7CA 4TZ2A 5CU8A 4NYVA 5F60A 4PKLA 4XUBA 4CUSA 2YQDA 4OGJA 5ENCA 5CFWA 4FLPA 5D0CA 5D3TA 5ENBA 4HXOA 5A5OA 4ZQLA 5EWCA 5FH6A 5A5SA 5FFYA 3NXBA 4TZ8A 2YELA 4YK0A 5LKUA 5CP5A 2FSAA 4HXRA 5I89A 5IBNA 4IR6A 5FE4A 5EGUA 2G4AA 4NR9A 5EU1A 3HMEA 5F1HA 4RVRA 5KTUA 2RFJA 4LYSA 3JVMA 4QBMA 5E73A 4UITA 4ALGA 2L5EA 4C66A 4QUUA 4X2IA 5FE7A 4TTEA 2H60A 3G0JA 4CURA 5D24A 1EQFA 5D3RA 4J0RA 1F68A 3HMHA 4TYLA 5AD3A 4QSVA 4YYNA 2RNYA 4HBYA 2YYNA 2KTBB 5TCMA 4QY4A 5CQ6A 5FE2A 4O7BA 4PY6A 5DX4A 4LZSA 5DYCA 5FE8A 3MB4A 5CUGA 5F3AA 4O72A 5DLZA 2NXBA 4N4FA 4YABA 1JSPB 4MR5A 5L99A 4A9IA 3UVWA 4UYFA 3UV5A 3HMFA 3UV4A 5L96A 3SVGA 5HM0A 3I3JA 3MXFA 5H85A 3O35A 3ERRA 3MQMA 5E9IA 2E3KA 4WHWA 4IORA 5F63A 3MUKA 5L98A 4O74A 5D3SA 3Q2FA 5HFQA 3UVXA 5DLXA 5FG4A 3MB3A 4O75A 4LRGA 5D3LA 3QZTA 2R0SA 4HXKA 4YH4A 3AQAA 3U5OA 5FE6A 4YYDA 5ENJA 5ETDA 4QSQA 5LVRA 4PTBA 5ACYA 5A7CA 4HXMA 5LVQA 5AMEA 2R10A 4QR5A 5AMFA 4ZC9A 4A9NA 5F1LA 4UIYA 2N9GA 5F2PA 4A9OA 5F25A 5CS8A 5FE9A 5H1UA 4XY9A 5F5ZA 5IGNA 4UIVA 5A82A 5I1QA 5D25A 4QSTA 1WUMA 4XUAA 1E6IA 5DKHA 3FKMX 4NR4A 2YW5A 5DFBA 4A9LA 4A9KA 4YADA 4Q0NA 3ONIA 5DYUA 4NUEA 4QR3A 2DKWA 5CUCA 3U5LA 2DVVA 5A5PA 4TU6A 5EWDA 4BW4A 4A9HA 5HQ6A 2D9EA 3JVJA 5D3PA 3SVHA 4PCEA 4N4IA 4CFKA 3K2JA 2E7NA 5LJ2A 4A9FA 4NUDA 4TU4A 5ENGA 4GPJA 5LJ1A 4AKGA 4AKNA 4YY6A 4QR4A 5HQ7A 5HLSA 4J0SA 3D1DA 4TS8A 4OUFA 5I86A 4QSWA 2RI7A 5DYAA 3DWYA 4Y03A 5CQ7A 3LQIA 4O76A 2LSPB 5H1VA 5EPBA 5E9MA 3O34A 5EPSA 4YBMA 4CUQA 4QYLA 5FE0A 3LQHA 2GRCA 3LXJA 5FH8A 5D3NA 3UVYA 5DYXA 4CLBA 4BW2A 3QZVA 5DBMA 5DKCA 5I40A 1N72A 2F6JA 4IR3A 4LR6A 5FG5A 5A85A 5K29A 4TT2A 4UIXA 4BW1A 4A9MA 4CUUA 3AADA 4PCIA 4YY4A 5EP7A 5IG6A 5EVAA 4N4HA 5EQ1A 4UIZA 4IR5A 3QZSA 4QZSA 4LYWA 2R0VA 3JVKA 4Z1SA 2F6NA 4MEQA 5HELA 4CL9A 5I29A 3LQJA 3O33A 4IOQA 4AKIA 2EJNA 4PS5A 4ALHA 4QC1A 5L8UA 5C89A 5TB6A 4NR6A 5I80A 4QEUA 5I83A 4F3IA 4NYWA 3P1FA 4NS5A 5EV9A 5EWVA 4UYGA 3P5OA 4KV4A 4MEOA 4NR8A 5DFDA 5HENA 5J0DA 2E7OA 5CRZA 2OSSA 4Z6IA 4NRBA 3P1EA 4O77A 5A5QA 5LKTA 5FFVA 3LJWA 3ZYUA 4TQNA 1X0JA 5DW2A 5FB1A 4TT6A 5FBXA 4DONA 4NR7A 5D3HA 2L85A 5EWWA 5DFCA 4XYAA 2R0YA 3IU6A 3SVFA 3P1CA 5CPEA 3S92A 4O7AA 5I88A 4BW3A 4BJXA 5EI4A 4WIVA 5CUEA 5C7NA 4HXPA 4Q0OA 4UIUA 4QSSA 5CZGA 5IGKA 5F61A 4QSUA 4YATA 3Q2EA 4A9EA 5FE5A 5JI8A 4YBTA 4Z6HA 5CQAA 4HBXA 5L8TA 3RCWA 4QSRA 4NQMA 5DW1A 4LC2A 5CQ5A 5KTXA 5E3DA 5LJ0A 5E9LA 5DKDA 5I7XA 4E96A 5BT4A 5LKZA 5L97A
chains in the Genus database with same CATH topology
5KTWA 3IU5A 4C67A 4OGIA 5G4RA 4YBSA 5G4SA 4MR3A 5HRWA 5KHMA 3U5NA 3O36A 4A9JA 5EISA 5FG6A 4CFLA 5D26A 5LUUA 4CUTA 5EICA 5A81A 4HBWA 4HXSA 5ENFA 5IIDA 5E9YA 5F62A 4O7FA 2WP2A 5A83A 4MEPA 2MJVB 5FE3A 2OO1A 5E9KA 3U5JA 5HRXA 4Z93A 4HBVA 5FFWA 5HQ5A 5CTLA 3S91A 2RNWA 4O7EA 5KO4A 4YYHA 5CGPA 4LDFA 3U5KA 5JWMA 5H1TA 5CUBA 4J1PA 4J3IA 5LKXA 4QNSA 5IGLA 5BT5A 5EM3A 5A5NA 4YH3A 4QSXA 5HEMA 5DY7A 5I7YA 3UVDA 3P1DA 4O78A 4KV1A 5C85A 1ZS5A 3UV2A 3G0LA 4LZRA 4KCXA 2D82A 2YEMA 2YDWA 5CUAA 2DVQA 5EWHA 4NQNA 4QUTA 4Z1QA 5C4QA 4NRAA 4HXLA 1JM4B 3O37A 5CRMA 4UYHA 4UYEA 5FDZA 5E74A 1WUGA 2RNXA 5CY9A 4O71A 3UW9A 4BHWA 4LZ2A 2I7KA 5E0RA 5CQ3A 4CUPA 4XY8A 4YYGA 5ENEA 5ETBA 5D7XA 5HRVA 2I8NA 5CQTA 4QC3A 5E7DA 2RS9B 4O7CA 5CUDA 4NYXA 2RO1A 4QSPA 4YYMA 4O70A 5ENHA 2YEKA 2DATA 5E9VA 4MR4A 4UIWA 4N4GA 4YYKA 4ZW1A 5E3GA 4UYDA 5FH7A 5C8GA 4NR5A 2DVRA 5C87A 5KU3A 2WP1A 4QB3A 5II1A 4YYJA 5CQ4A 3DAIA 5EA1A 4QEWA 5EK9A 4NUCA 5BT3A 5AD2A 5COIA 4MENA 5FB0A 4NRCA 3TLPA 5II2A 2DVSA 4MR6A 5CQ8A 3U5MA 5EPRA 4QEVA 2DWWA 4QYDA 5F36A 5D3JA 5ENIA 3GG3A 4N3WA 4UYFB 2OUOA 4YAXA 4YYIA 3U5PA 2L84A 5IGMA 5FE1A 4YC9A 5A5RA 3JVLA 4NXJA 3MULA 4LYIA 5HFRA 5HJCA 4IR4A 5HCLA 4IOOA 4HXNA 4WHUA 4TT4A 3D7CA 4TZ2A 5CU8A 4NYVA 5F60A 4PKLA 4XUBA 4CUSA 2YQDA 4OGJA 5ENCA 5CFWA 4FLPA 5D0CA 5D3TA 5ENBA 4HXOA 5A5OA 4ZQLA 5EWCA 5FH6A 5A5SA 5FFYA 3NXBA 4TZ8A 2YELA 4YK0A 5LKUA 5CP5A 2FSAA 4HXRA 5I89A 5IBNA 4IR6A 5FE4A 5EGUA 2G4AA 4NR9A 5EU1A 3HMEA 5F1HA 4RVRA 5KTUA 2RFJA 4LYSA 3JVMA 4QBMA 5E73A 4UITA 4ALGA 2L5EA 4C66A 4QUUA 4X2IA 5FE7A 4TTEA 2H60A 3G0JA 4CURA 5D24A 1EQFA 5D3RA 4J0RA 1F68A 3HMHA 4TYLA 5AD3A 4QSVA 4YYNA 2RNYA 4HBYA 2YYNA 2KTBB 5TCMA 4QY4A 5CQ6A 5FE2A 4O7BA 4PY6A 5DX4A 4LZSA 5DYCA 5FE8A 3MB4A 5CUGA 5F3AA 4O72A 5DLZA 2NXBA 4N4FA 4YABA 1JSPB 4MR5A 5L99A 4A9IA 3UVWA 4UYFA 3UV5A 3HMFA 3UV4A 5L96A 3SVGA 5HM0A 3I3JA 3MXFA 5H85A 3O35A 3MQMA 5E9IA 2E3KA 4WHWA 4IORA 5F63A 3MUKA 5L98A 4O74A 5D3SA 3Q2FA 5HFQA 3UVXA 5DLXA 5FG4A 3MB3A 4O75A 4LRGA 5D3LA 3QZTA 2R0SA 4HXKA 4YH4A 3AQAA 3U5OA 5FE6A 4YYDA 5ENJA 5ETDA 4QSQA 5LVRA 4PTBA 5ACYA 5A7CA 4HXMA 5LVQA 5AMEA 2R10A 4QR5A 5AMFA 4ZC9A 4A9NA 5F1LA 4UIYA 2N9GA 5F2PA 4A9OA 5F25A 5CS8A 5FE9A 5H1UA 4XY9A 5F5ZA 5IGNA 4UIVA 5A82A 5I1QA 5D25A 4QSTA 1WUMA 4XUAA 1E6IA 5DKHA 3FKMX 4NR4A 2YW5A 5DFBA 4A9LA 4A9KA 4YADA 4Q0NA 3ONIA 5DYUA 4NUEA 4QR3A 2DKWA 5CUCA 3U5LA 2DVVA 5A5PA 4TU6A 5EWDA 4BW4A 4A9HA 5HQ6A 2D9EA 3JVJA 5D3PA 3SVHA 4PCEA 4N4IA 4CFKA 3K2JA 2E7NA 5LJ2A 4A9FA 4NUDA 4TU4A 5ENGA 4GPJA 5LJ1A 4AKNA 4YY6A 4QR4A 5HQ7A 5HLSA 4J0SA 4TS8A 4OUFA 5I86A 4QSWA 2RI7A 5DYAA 3DWYA 4Y03A 5CQ7A 3LQIA 4O76A 2LSPB 5H1VA 5EPBA 5E9MA 3O34A 5EPSA 4YBMA 4CUQA 4QYLA 5FE0A 3LQHA 2GRCA 3LXJA 5FH8A 5D3NA 3UVYA 5DYXA 4CLBA 4BW2A 3QZVA 5DBMA 5DKCA 5I40A 1N72A 2F6JA 4IR3A 4LR6A 5FG5A 5A85A 5K29A 4TT2A 4UIXA 4BW1A 4A9MA 4CUUA 3AADA 4PCIA 4YY4A 5EP7A 5IG6A 5EVAA 4N4HA 5EQ1A 4UIZA 4IR5A 3QZSA 4QZSA 4LYWA 2R0VA 3JVKA 4Z1SA 2F6NA 4MEQA 5HELA 4CL9A 5I29A 3LQJA 3O33A 4IOQA 4PS5A 4ALHA 4QC1A 5L8UA 5C89A 5TB6A 4NR6A 5I80A 4QEUA 5I83A 4F3IA 4NYWA 3P1FA 4NS5A 5EV9A 5EWVA 4UYGA 3P5OA 4KV4A 4MEOA 4NR8A 5DFDA 5HENA 5J0DA 2E7OA 5CRZA 2OSSA 4Z6IA 4NRBA 3P1EA 4O77A 5A5QA 5LKTA 5FFVA 3LJWA 3ZYUA 4TQNA 1X0JA 5DW2A 5FB1A 4TT6A 5FBXA 4DONA 4NR7A 5D3HA 2L85A 5EWWA 5DFCA 4XYAA 2R0YA 3IU6A 3SVFA 3P1CA 5CPEA 3S92A 4O7AA 5I88A 4BW3A 4BJXA 5EI4A 4WIVA 5CUEA 5C7NA 4HXPA 4Q0OA 4UIUA 4QSSA 5CZGA 5IGKA 5F61A 4QSUA 4YATA 3Q2EA 4A9EA 5FE5A 5JI8A 4YBTA 4Z6HA 5CQAA 4HBXA 5L8TA 3RCWA 4QSRA 4NQMA 5DW1A 4LC2A 5CQ5A 5KTXA 5E3DA 5LJ0A 5E9LA 5DKDA 5I7XA 4E96A 5BT4A 5LKZA 5L97A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KTW A;  3IU5 A;  4C67 A;  4OGI A;  5G4R A;  4YBS A;  5G4S A;  4MR3 A;  5HRW A;  5KHM A;  3U5N A;  3O36 A;  4A9J A;  5EIS A;  5FG6 A;  4CFL A;  5D26 A;  5LUU A;  4CUT A;  5EIC A;  5A81 A;  4HBW A;  4HXS A;  5ENF A;  5IID A;  5E9Y A;  5F62 A;  4O7F A;  2WP2 A;  5A83 A;  4MEP A;  2MJV B;  5FE3 A;  2OO1 A;  5E9K A;  3U5J A;  5HRX A;  4Z93 A;  4HBV A;  5FFW A;  5HQ5 A;  5CTL A;  3S91 A;  2RNW A;  4O7E A;  5KO4 A;  4YYH A;  5CGP A;  4LDF A;  3U5K A;  5JWM A;  5H1T A;  5CUB A;  4J1P A;  4J3I A;  5LKX A;  4QNS A;  5IGL A;  5BT5 A;  5EM3 A;  5A5N A;  4YH3 A;  4QSX A;  5HEM A;  5DY7 A;  5I7Y A;  3UVD A;  3P1D A;  4O78 A;  4KV1 A;  5C85 A;  1ZS5 A;  3UV2 A;  3G0L A;  4LZR A;  4KCX A;  2D82 A;  2YEM A;  2YDW A;  5CUA A;  2DVQ A;  5EWH A;  4NQN A;  4QUT A;  4Z1Q A;  5C4Q A;  4NRA A;  4HXL A;  1JM4 B;  3O37 A;  5CRM A;  4UYH A;  4UYE A;  5FDZ A;  5E74 A;  1WUG A;  2RNX A;  5CY9 A;  4O71 A;  3UW9 A;  4BHW A;  4LZ2 A;  2I7K A;  5E0R A;  5CQ3 A;  4CUP A;  4XY8 A;  4YYG A;  5ENE A;  5ETB A;  5D7X A;  5HRV A;  2I8N A;  5CQT A;  4QC3 A;  5E7D A;  2RS9 B;  4O7C A;  5CUD A;  4NYX A;  2RO1 A;  4QSP A;  4YYM A;  4O70 A;  5ENH A;  2YEK A;  2DAT A;  5E9V A;  4MR4 A;  4UIW A;  4N4G A;  4YYK A;  4ZW1 A;  5E3G A;  4UYD A;  5FH7 A;  5C8G A;  4NR5 A;  2DVR A;  5C87 A;  5KU3 A;  2WP1 A;  4QB3 A;  5II1 A;  4YYJ A;  5CQ4 A;  3DAI A;  5EA1 A;  4QEW A;  5EK9 A;  4NUC A;  5BT3 A;  5AD2 A;  5COI A;  4MEN A;  5FB0 A;  4NRC A;  3TLP A;  5II2 A;  2DVS A;  4MR6 A;  5CQ8 A;  3U5M A;  5EPR A;  4QEV A;  2DWW A;  4QYD A;  5F36 A;  5D3J A;  5ENI A;  3GG3 A;  4N3W A;  4UYF B;  2OUO A;  4YAX A;  4YYI A;  3U5P A;  2L84 A;  5IGM A;  5FE1 A;  4YC9 A;  5A5R A;  3JVL A;  4NXJ A;  3MUL A;  4LYI A;  5HFR A;  5HJC A;  4IR4 A;  5HCL A;  4IOO A;  4HXN A;  4WHU A;  4TT4 A;  3D7C A;  4TZ2 A;  5CU8 A;  4NYV A;  5F60 A;  4PKL A;  4XUB A;  4CUS A;  2YQD A;  4OGJ A;  5ENC A;  5CFW A;  4FLP A;  5D0C A;  5D3T A;  5ENB A;  4HXO A;  5A5O A;  4ZQL A;  5EWC A;  5FH6 A;  5A5S A;  5FFY A;  3NXB A;  4TZ8 A;  2YEL A;  4YK0 A;  5LKU A;  5CP5 A;  2FSA A;  4HXR A;  5I89 A;  5IBN A;  4IR6 A;  5FE4 A;  5EGU A;  2G4A A;  4NR9 A;  5EU1 A;  3HME A;  5F1H A;  4RVR A;  5KTU A;  2RFJ A;  4LYS A;  3JVM A;  4QBM A;  5E73 A;  4UIT A;  4ALG A;  2L5E A;  4C66 A;  4QUU A;  4X2I A;  5FE7 A;  4TTE A;  2H60 A;  3G0J A;  4CUR A;  5D24 A;  1EQF A;  5D3R A;  4J0R A;  1F68 A;  3HMH A;  4TYL A;  5AD3 A;  4QSV A;  4YYN A;  2RNY A;  4HBY A;  2YYN A;  2KTB B;  5TCM A;  4QY4 A;  5CQ6 A;  5FE2 A;  4O7B A;  4PY6 A;  5DX4 A;  4LZS A;  5DYC A;  5FE8 A;  3MB4 A;  5CUG A;  5F3A A;  4O72 A;  5DLZ A;  2NXB A;  4N4F A;  4YAB A;  1JSP B;  4MR5 A;  5L99 A;  4A9I A;  3UVW A;  4UYF A;  3UV5 A;  3HMF A;  3UV4 A;  5L96 A;  3SVG A;  5HM0 A;  3I3J A;  3MXF A;  5H85 A;  3O35 A;  3MQM A;  5E9I A;  2E3K A;  4WHW A;  4IOR A;  5F63 A;  3MUK A;  5L98 A;  4O74 A;  5D3S A;  3Q2F A;  5HFQ A;  3UVX A;  5DLX A;  5FG4 A;  3MB3 A;  4O75 A;  4LRG A;  5D3L A;  3QZT A;  2R0S A;  4HXK A;  4YH4 A;  3AQA A;  3U5O A;  5FE6 A;  4YYD A;  5ENJ A;  5ETD A;  4QSQ A;  5LVR A;  4PTB A;  5ACY A;  5A7C A;  4HXM A;  5LVQ A;  5AME A;  2R10 A;  4QR5 A;  5AMF A;  4ZC9 A;  4A9N A;  5F1L A;  4UIY A;  2N9G A;  5F2P A;  4A9O A;  5F25 A;  5CS8 A;  5FE9 A;  5H1U A;  4XY9 A;  5F5Z A;  5IGN A;  4UIV A;  5A82 A;  5I1Q A;  5D25 A;  4QST A;  1WUM A;  4XUA A;  1E6I A;  5DKH A;  3FKM X;  4NR4 A;  2YW5 A;  5DFB A;  4A9L A;  4A9K A;  4YAD A;  4Q0N A;  3ONI A;  5DYU A;  4NUE A;  4QR3 A;  2DKW A;  5CUC A;  3U5L A;  2DVV A;  5A5P A;  4TU6 A;  5EWD A;  4BW4 A;  4A9H A;  5HQ6 A;  2D9E A;  3JVJ A;  5D3P A;  3SVH A;  4PCE A;  4N4I A;  4CFK A;  3K2J A;  2E7N A;  5LJ2 A;  4A9F A;  4NUD A;  4TU4 A;  5ENG A;  4GPJ A;  5LJ1 A;  4AKN A;  4YY6 A;  4QR4 A;  5HQ7 A;  5HLS A;  4J0S A;  4TS8 A;  4OUF A;  5I86 A;  4QSW A;  2RI7 A;  5DYA A;  3DWY A;  4Y03 A;  5CQ7 A;  3LQI A;  4O76 A;  2LSP B;  5H1V A;  5EPB A;  5E9M A;  3O34 A;  5EPS A;  4YBM A;  4CUQ A;  4QYL A;  5FE0 A;  3LQH A;  2GRC A;  3LXJ A;  5FH8 A;  5D3N A;  3UVY A;  5DYX A;  4CLB A;  4BW2 A;  3QZV A;  5DBM A;  5DKC A;  5I40 A;  1N72 A;  2F6J A;  4IR3 A;  4LR6 A;  5FG5 A;  5A85 A;  5K29 A;  4TT2 A;  4UIX A;  4BW1 A;  4A9M A;  4CUU A;  3AAD A;  4PCI A;  4YY4 A;  5EP7 A;  5IG6 A;  5EVA A;  4N4H A;  5EQ1 A;  4UIZ A;  4IR5 A;  3QZS A;  4QZS A;  4LYW A;  2R0V A;  3JVK A;  4Z1S A;  2F6N A;  4MEQ A;  5HEL A;  4CL9 A;  5I29 A;  3LQJ A;  3O33 A;  4IOQ A;  4PS5 A;  4ALH A;  4QC1 A;  5L8U A;  5C89 A;  5TB6 A;  4NR6 A;  5I80 A;  4QEU A;  5I83 A;  4F3I A;  4NYW A;  3P1F A;  4NS5 A;  5EV9 A;  5EWV A;  4UYG A;  3P5O A;  4KV4 A;  4MEO A;  4NR8 A;  5DFD A;  5HEN A;  5J0D A;  2E7O A;  5CRZ A;  2OSS A;  4Z6I A;  4NRB A;  3P1E A;  4O77 A;  5A5Q A;  5LKT A;  5FFV A;  3LJW A;  3ZYU A;  4TQN A;  1X0J A;  5DW2 A;  5FB1 A;  4TT6 A;  5FBX A;  4DON A;  4NR7 A;  5D3H A;  2L85 A;  5EWW A;  5DFC A;  4XYA A;  2R0Y A;  3IU6 A;  3SVF A;  3P1C A;  5CPE A;  3S92 A;  4O7A A;  5I88 A;  4BW3 A;  4BJX A;  5EI4 A;  4WIV A;  5CUE A;  5C7N A;  4HXP A;  4Q0O A;  4UIU A;  4QSS A;  5CZG A;  5IGK A;  5F61 A;  4QSU A;  4YAT A;  3Q2E A;  4A9E A;  5FE5 A;  5JI8 A;  4YBT A;  4Z6H A;  5CQA A;  4HBX A;  5L8T A;  3RCW A;  4QSR A;  4NQM A;  5DW1 A;  4LC2 A;  5CQ5 A;  5KTX A;  5E3D A;  5LJ0 A;  5E9L A;  5DKD A;  5I7X A;  4E96 A;  5BT4 A;  5LKZ A;  5L97 A; 
#chains in the Genus database with same CATH topology
 5KTW A;  3IU5 A;  4C67 A;  4OGI A;  5G4R A;  4YBS A;  5G4S A;  4MR3 A;  5HRW A;  5KHM A;  3U5N A;  3O36 A;  4A9J A;  5EIS A;  5FG6 A;  4CFL A;  5D26 A;  5LUU A;  4CUT A;  5EIC A;  5A81 A;  4HBW A;  4HXS A;  5ENF A;  5IID A;  5E9Y A;  5F62 A;  4O7F A;  2WP2 A;  5A83 A;  4MEP A;  4AKH A;  2MJV B;  5FE3 A;  2OO1 A;  5E9K A;  3U5J A;  5HRX A;  4Z93 A;  4HBV A;  5FFW A;  5HQ5 A;  5CTL A;  3S91 A;  2RNW A;  4O7E A;  5KO4 A;  4YYH A;  5CGP A;  4LDF A;  3U5K A;  5JWM A;  5H1T A;  5CUB A;  4J1P A;  4J3I A;  5LKX A;  4QNS A;  5IGL A;  5BT5 A;  5EM3 A;  5A5N A;  4YH3 A;  4QSX A;  5HEM A;  5DY7 A;  5I7Y A;  3UVD A;  3P1D A;  4O78 A;  4KV1 A;  5C85 A;  1ZS5 A;  3UV2 A;  3G0L A;  3VKH A;  4LZR A;  4KCX A;  2D82 A;  2YEM A;  2YDW A;  5CUA A;  2DVQ A;  5EWH A;  4NQN A;  4QUT A;  4Z1Q A;  5C4Q A;  4NRA A;  4HXL A;  1JM4 B;  3O37 A;  5CRM A;  4UYH A;  4UYE A;  5FDZ A;  5E74 A;  1ZKR A;  1WUG A;  2RNX A;  5CY9 A;  4O71 A;  3UW9 A;  4BHW A;  4LZ2 A;  2I7K A;  5E0R A;  5CQ3 A;  4CUP A;  4XY8 A;  4YYG A;  5ENE A;  5ETB A;  5D7X A;  5HRV A;  2I8N A;  5CQT A;  4QC3 A;  5E7D A;  2RS9 B;  4O7C A;  5CUD A;  4NYX A;  2RO1 A;  4QSP A;  4YYM A;  4O70 A;  5ENH A;  2YEK A;  2DAT A;  5E9V A;  4MR4 A;  4UIW A;  4AI6 A;  4N4G A;  4YYK A;  4ZW1 A;  5E3G A;  4UYD A;  5FH7 A;  5C8G A;  4NR5 A;  2DVR A;  5C87 A;  1PUO A;  5KU3 A;  2WP1 A;  3VKG A;  4QB3 A;  5II1 A;  4YYJ A;  5CQ4 A;  3DAI A;  5EA1 A;  4QEW A;  5EK9 A;  4NUC A;  3D1B A;  5BT3 A;  5AD2 A;  5COI A;  4MEN A;  5FB0 A;  4NRC A;  3TLP A;  5II2 A;  2DVS A;  4MR6 A;  5CQ8 A;  3U5M A;  5EPR A;  4QEV A;  2DWW A;  4QYD A;  5F36 A;  5D3J A;  5ENI A;  3GG3 A;  4N3W A;  4UYF B;  2OUO A;  4YAX A;  4YYI A;  3U5P A;  2L84 A;  5IGM A;  5FE1 A;  4YC9 A;  5A5R A;  3JVL A;  4NXJ A;  3MUL A;  4LYI A;  5HFR A;  5HJC A;  4IR4 A;  5HCL A;  4IOO A;  4HXN A;  4WHU A;  4TT4 A;  3D7C A;  4TZ2 A;  5CU8 A;  4NYV A;  5F60 A;  4PKL A;  4XUB A;  4CUS A;  2YQD A;  4OGJ A;  5ENC A;  5CFW A;  4FLP A;  5D0C A;  5D3T A;  5ENB A;  4HXO A;  5A5O A;  4ZQL A;  5EWC A;  5FH6 A;  5A5S A;  5FFY A;  3NXB A;  4TZ8 A;  2YEL A;  4YK0 A;  5LKU A;  5CP5 A;  2FSA A;  4HXR A;  5I89 A;  5IBN A;  4IR6 A;  5FE4 A;  5EGU A;  2G4A A;  4NR9 A;  5EU1 A;  3HME A;  5F1H A;  4RVR A;  5KTU A;  2RFJ A;  4LYS A;  3JVM A;  4QBM A;  5E73 A;  4UIT A;  4ALG A;  2L5E A;  4C66 A;  4QUU A;  4X2I A;  5FE7 A;  4TTE A;  2H60 A;  3G0J A;  4CUR A;  5D24 A;  1EQF A;  5D3R A;  4J0R A;  1F68 A;  3HMH A;  4TYL A;  5AD3 A;  4QSV A;  4YYN A;  2RNY A;  4HBY A;  2YYN A;  2KTB B;  5TCM A;  4QY4 A;  5CQ6 A;  5FE2 A;  4O7B A;  4PY6 A;  5DX4 A;  4LZS A;  5DYC A;  5FE8 A;  3MB4 A;  5CUG A;  5F3A A;  4O72 A;  5DLZ A;  2NXB A;  4N4F A;  4YAB A;  1JSP B;  4MR5 A;  5L99 A;  4A9I A;  3UVW A;  4UYF A;  3UV5 A;  3HMF A;  3UV4 A;  5L96 A;  3SVG A;  5HM0 A;  3I3J A;  3MXF A;  5H85 A;  3O35 A;  3ERR A;  3MQM A;  5E9I A;  2E3K A;  4WHW A;  4IOR A;  5F63 A;  3MUK A;  5L98 A;  4O74 A;  5D3S A;  3Q2F A;  5HFQ A;  3UVX A;  5DLX A;  5FG4 A;  3MB3 A;  4O75 A;  4LRG A;  5D3L A;  3QZT A;  2R0S A;  4HXK A;  4YH4 A;  3AQA A;  3U5O A;  5FE6 A;  4YYD A;  5ENJ A;  5ETD A;  4QSQ A;  5LVR A;  4PTB A;  5ACY A;  5A7C A;  4HXM A;  5LVQ A;  5AME A;  2R10 A;  4QR5 A;  5AMF A;  4ZC9 A;  4A9N A;  5F1L A;  4UIY A;  2N9G A;  5F2P A;  4A9O A;  5F25 A;  5CS8 A;  5FE9 A;  5H1U A;  4XY9 A;  5F5Z A;  5IGN A;  4UIV A;  5A82 A;  5I1Q A;  5D25 A;  4QST A;  1WUM A;  4XUA A;  1E6I A;  5DKH A;  3FKM X;  4NR4 A;  2YW5 A;  5DFB A;  4A9L A;  4A9K A;  4YAD A;  4Q0N A;  3ONI A;  5DYU A;  4NUE A;  4QR3 A;  2DKW A;  5CUC A;  3U5L A;  2DVV A;  5A5P A;  4TU6 A;  5EWD A;  4BW4 A;  4A9H A;  5HQ6 A;  2D9E A;  3JVJ A;  5D3P A;  3SVH A;  4PCE A;  4N4I A;  4CFK A;  3K2J A;  2E7N A;  5LJ2 A;  4A9F A;  4NUD A;  4TU4 A;  5ENG A;  4GPJ A;  5LJ1 A;  4AKG A;  4AKN A;  4YY6 A;  4QR4 A;  5HQ7 A;  5HLS A;  4J0S A;  3D1D A;  4TS8 A;  4OUF A;  5I86 A;  4QSW A;  2RI7 A;  5DYA A;  3DWY A;  4Y03 A;  5CQ7 A;  3LQI A;  4O76 A;  2LSP B;  5H1V A;  5EPB A;  5E9M A;  3O34 A;  5EPS A;  4YBM A;  4CUQ A;  4QYL A;  5FE0 A;  3LQH A;  2GRC A;  3LXJ A;  5FH8 A;  5D3N A;  3UVY A;  5DYX A;  4CLB A;  4BW2 A;  3QZV A;  5DBM A;  5DKC A;  5I40 A;  1N72 A;  2F6J A;  4IR3 A;  4LR6 A;  5FG5 A;  5A85 A;  5K29 A;  4TT2 A;  4UIX A;  4BW1 A;  4A9M A;  4CUU A;  3AAD A;  4PCI A;  4YY4 A;  5EP7 A;  5IG6 A;  5EVA A;  4N4H A;  5EQ1 A;  4UIZ A;  4IR5 A;  3QZS A;  4QZS A;  4LYW A;  2R0V A;  3JVK A;  4Z1S A;  2F6N A;  4MEQ A;  5HEL A;  4CL9 A;  5I29 A;  3LQJ A;  3O33 A;  4IOQ A;  4AKI A;  2EJN A;  4PS5 A;  4ALH A;  4QC1 A;  5L8U A;  5C89 A;  5TB6 A;  4NR6 A;  5I80 A;  4QEU A;  5I83 A;  4F3I A;  4NYW A;  3P1F A;  4NS5 A;  5EV9 A;  5EWV A;  4UYG A;  3P5O A;  4KV4 A;  4MEO A;  4NR8 A;  5DFD A;  5HEN A;  5J0D A;  2E7O A;  5CRZ A;  2OSS A;  4Z6I A;  4NRB A;  3P1E A;  4O77 A;  5A5Q A;  5LKT A;  5FFV A;  3LJW A;  3ZYU A;  4TQN A;  1X0J A;  5DW2 A;  5FB1 A;  4TT6 A;  5FBX A;  4DON A;  4NR7 A;  5D3H A;  2L85 A;  5EWW A;  5DFC A;  4XYA A;  2R0Y A;  3IU6 A;  3SVF A;  3P1C A;  5CPE A;  3S92 A;  4O7A A;  5I88 A;  4BW3 A;  4BJX A;  5EI4 A;  4WIV A;  5CUE A;  5C7N A;  4HXP A;  4Q0O A;  4UIU A;  4QSS A;  5CZG A;  5IGK A;  5F61 A;  4QSU A;  4YAT A;  3Q2E A;  4A9E A;  5FE5 A;  5JI8 A;  4YBT A;  4Z6H A;  5CQA A;  4HBX A;  5L8T A;  3RCW A;  4QSR A;  4NQM A;  5DW1 A;  4LC2 A;  5CQ5 A;  5KTX A;  5E3D A;  5LJ0 A;  5E9L A;  5DKD A;  5I7X A;  4E96 A;  5BT4 A;  5LKZ A;  5L97 A; 
#chains in the Genus database with same CATH homology
 5KTW A;  3IU5 A;  4C67 A;  4OGI A;  5G4R A;  4YBS A;  5G4S A;  4MR3 A;  5HRW A;  5KHM A;  3U5N A;  3O36 A;  4A9J A;  5EIS A;  5FG6 A;  4CFL A;  5D26 A;  5LUU A;  4CUT A;  5EIC A;  5A81 A;  4HBW A;  4HXS A;  5ENF A;  5IID A;  5E9Y A;  5F62 A;  4O7F A;  2WP2 A;  5A83 A;  4MEP A;  2MJV B;  5FE3 A;  2OO1 A;  5E9K A;  3U5J A;  5HRX A;  4Z93 A;  4HBV A;  5FFW A;  5HQ5 A;  5CTL A;  3S91 A;  2RNW A;  4O7E A;  5KO4 A;  4YYH A;  5CGP A;  4LDF A;  3U5K A;  5JWM A;  5H1T A;  5CUB A;  4J1P A;  4J3I A;  5LKX A;  4QNS A;  5IGL A;  5BT5 A;  5EM3 A;  5A5N A;  4YH3 A;  4QSX A;  5HEM A;  5DY7 A;  5I7Y A;  3UVD A;  3P1D A;  4O78 A;  4KV1 A;  5C85 A;  1ZS5 A;  3UV2 A;  3G0L A;  4LZR A;  4KCX A;  2D82 A;  2YEM A;  2YDW A;  5CUA A;  2DVQ A;  5EWH A;  4NQN A;  4QUT A;  4Z1Q A;  5C4Q A;  4NRA A;  4HXL A;  1JM4 B;  3O37 A;  5CRM A;  4UYH A;  4UYE A;  5FDZ A;  5E74 A;  1WUG A;  2RNX A;  5CY9 A;  4O71 A;  3UW9 A;  4BHW A;  4LZ2 A;  2I7K A;  5E0R A;  5CQ3 A;  4CUP A;  4XY8 A;  4YYG A;  5ENE A;  5ETB A;  5D7X A;  5HRV A;  2I8N A;  5CQT A;  4QC3 A;  5E7D A;  2RS9 B;  4O7C A;  5CUD A;  4NYX A;  2RO1 A;  4QSP A;  4YYM A;  4O70 A;  5ENH A;  2YEK A;  2DAT A;  5E9V A;  4MR4 A;  4UIW A;  4N4G A;  4YYK A;  4ZW1 A;  5E3G A;  4UYD A;  5FH7 A;  5C8G A;  4NR5 A;  2DVR A;  5C87 A;  5KU3 A;  2WP1 A;  4QB3 A;  5II1 A;  4YYJ A;  5CQ4 A;  3DAI A;  5EA1 A;  4QEW A;  5EK9 A;  4NUC A;  5BT3 A;  5AD2 A;  5COI A;  4MEN A;  5FB0 A;  4NRC A;  3TLP A;  5II2 A;  2DVS A;  4MR6 A;  5CQ8 A;  3U5M A;  5EPR A;  4QEV A;  2DWW A;  4QYD A;  5F36 A;  5D3J A;  5ENI A;  3GG3 A;  4N3W A;  4UYF B;  2OUO A;  4YAX A;  4YYI A;  3U5P A;  2L84 A;  5IGM A;  5FE1 A;  4YC9 A;  5A5R A;  3JVL A;  4NXJ A;  3MUL A;  4LYI A;  5HFR A;  5HJC A;  4IR4 A;  5HCL A;  4IOO A;  4HXN A;  4WHU A;  4TT4 A;  3D7C A;  4TZ2 A;  5CU8 A;  4NYV A;  5F60 A;  4PKL A;  4XUB A;  4CUS A;  2YQD A;  4OGJ A;  5ENC A;  5CFW A;  4FLP A;  5D0C A;  5D3T A;  5ENB A;  4HXO A;  5A5O A;  4ZQL A;  5EWC A;  5FH6 A;  5A5S A;  5FFY A;  3NXB A;  4TZ8 A;  2YEL A;  4YK0 A;  5LKU A;  5CP5 A;  2FSA A;  4HXR A;  5I89 A;  5IBN A;  4IR6 A;  5FE4 A;  5EGU A;  2G4A A;  4NR9 A;  5EU1 A;  3HME A;  5F1H A;  4RVR A;  5KTU A;  2RFJ A;  4LYS A;  3JVM A;  4QBM A;  5E73 A;  4UIT A;  4ALG A;  2L5E A;  4C66 A;  4QUU A;  4X2I A;  5FE7 A;  4TTE A;  2H60 A;  3G0J A;  4CUR A;  5D24 A;  1EQF A;  5D3R A;  4J0R A;  1F68 A;  3HMH A;  4TYL A;  5AD3 A;  4QSV A;  4YYN A;  2RNY A;  4HBY A;  2YYN A;  2KTB B;  5TCM A;  4QY4 A;  5CQ6 A;  5FE2 A;  4O7B A;  4PY6 A;  5DX4 A;  4LZS A;  5DYC A;  5FE8 A;  3MB4 A;  5CUG A;  5F3A A;  4O72 A;  5DLZ A;  2NXB A;  4N4F A;  4YAB A;  1JSP B;  4MR5 A;  5L99 A;  4A9I A;  3UVW A;  4UYF A;  3UV5 A;  3HMF A;  3UV4 A;  5L96 A;  3SVG A;  5HM0 A;  3I3J A;  3MXF A;  5H85 A;  3O35 A;  3MQM A;  5E9I A;  2E3K A;  4WHW A;  4IOR A;  5F63 A;  3MUK A;  5L98 A;  4O74 A;  5D3S A;  3Q2F A;  5HFQ A;  3UVX A;  5DLX A;  5FG4 A;  3MB3 A;  4O75 A;  4LRG A;  5D3L A;  3QZT A;  2R0S A;  4HXK A;  4YH4 A;  3AQA A;  3U5O A;  5FE6 A;  4YYD A;  5ENJ A;  5ETD A;  4QSQ A;  5LVR A;  4PTB A;  5ACY A;  5A7C A;  4HXM A;  5LVQ A;  5AME A;  2R10 A;  4QR5 A;  5AMF A;  4ZC9 A;  4A9N A;  5F1L A;  4UIY A;  2N9G A;  5F2P A;  4A9O A;  5F25 A;  5CS8 A;  5FE9 A;  5H1U A;  4XY9 A;  5F5Z A;  5IGN A;  4UIV A;  5A82 A;  5I1Q A;  5D25 A;  4QST A;  1WUM A;  4XUA A;  1E6I A;  5DKH A;  3FKM X;  4NR4 A;  2YW5 A;  5DFB A;  4A9L A;  4A9K A;  4YAD A;  4Q0N A;  3ONI A;  5DYU A;  4NUE A;  4QR3 A;  2DKW A;  5CUC A;  3U5L A;  2DVV A;  5A5P A;  4TU6 A;  5EWD A;  4BW4 A;  4A9H A;  5HQ6 A;  2D9E A;  3JVJ A;  5D3P A;  3SVH A;  4PCE A;  4N4I A;  4CFK A;  3K2J A;  2E7N A;  5LJ2 A;  4A9F A;  4NUD A;  4TU4 A;  5ENG A;  4GPJ A;  5LJ1 A;  4AKN A;  4YY6 A;  4QR4 A;  5HQ7 A;  5HLS A;  4J0S A;  4TS8 A;  4OUF A;  5I86 A;  4QSW A;  2RI7 A;  5DYA A;  3DWY A;  4Y03 A;  5CQ7 A;  3LQI A;  4O76 A;  2LSP B;  5H1V A;  5EPB A;  5E9M A;  3O34 A;  5EPS A;  4YBM A;  4CUQ A;  4QYL A;  5FE0 A;  3LQH A;  2GRC A;  3LXJ A;  5FH8 A;  5D3N A;  3UVY A;  5DYX A;  4CLB A;  4BW2 A;  3QZV A;  5DBM A;  5DKC A;  5I40 A;  1N72 A;  2F6J A;  4IR3 A;  4LR6 A;  5FG5 A;  5A85 A;  5K29 A;  4TT2 A;  4UIX A;  4BW1 A;  4A9M A;  4CUU A;  3AAD A;  4PCI A;  4YY4 A;  5EP7 A;  5IG6 A;  5EVA A;  4N4H A;  5EQ1 A;  4UIZ A;  4IR5 A;  3QZS A;  4QZS A;  4LYW A;  2R0V A;  3JVK A;  4Z1S A;  2F6N A;  4MEQ A;  5HEL A;  4CL9 A;  5I29 A;  3LQJ A;  3O33 A;  4IOQ A;  4PS5 A;  4ALH A;  4QC1 A;  5L8U A;  5C89 A;  5TB6 A;  4NR6 A;  5I80 A;  4QEU A;  5I83 A;  4F3I A;  4NYW A;  3P1F A;  4NS5 A;  5EV9 A;  5EWV A;  4UYG A;  3P5O A;  4KV4 A;  4MEO A;  4NR8 A;  5DFD A;  5HEN A;  5J0D A;  2E7O A;  5CRZ A;  2OSS A;  4Z6I A;  4NRB A;  3P1E A;  4O77 A;  5A5Q A;  5LKT A;  5FFV A;  3LJW A;  3ZYU A;  4TQN A;  1X0J A;  5DW2 A;  5FB1 A;  4TT6 A;  5FBX A;  4DON A;  4NR7 A;  5D3H A;  2L85 A;  5EWW A;  5DFC A;  4XYA A;  2R0Y A;  3IU6 A;  3SVF A;  3P1C A;  5CPE A;  3S92 A;  4O7A A;  5I88 A;  4BW3 A;  4BJX A;  5EI4 A;  4WIV A;  5CUE A;  5C7N A;  4HXP A;  4Q0O A;  4UIU A;  4QSS A;  5CZG A;  5IGK A;  5F61 A;  4QSU A;  4YAT A;  3Q2E A;  4A9E A;  5FE5 A;  5JI8 A;  4YBT A;  4Z6H A;  5CQA A;  4HBX A;  5L8T A;  3RCW A;  4QSR A;  4NQM A;  5DW1 A;  4LC2 A;  5CQ5 A;  5KTX A;  5E3D A;  5LJ0 A;  5E9L A;  5DKD A;  5I7X A;  4E96 A;  5BT4 A;  5LKZ A;  5L97 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...