4Z6HA

Crystal structure of brd9 bromodomain in complex with a valerolactam quinolone ligand
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
113
structure length
113
Chain Sequence
STPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDFGTMKDKIVANEYKSVTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMSKERLLALKRSMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Bromodomain-containing protein 9
publication title LP99: Discovery and Synthesis of the First Selective BRD7/9 Bromodomain Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
total genus 41
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4z6hA00
5FE6A 2F6JA 5KTWA 5II2A 5F2PA 5EI4A 3DWYA 3I3JA 5EWDA 4CL9A 5FE0A 4O70A 5D3NA 4HXRA 4A9IA 4Z93A 4CURA 2R0YA 3MB3A 5FB1A 4HBVA 4ALHA 5L96A 3HMHA 4TT4A 4N4FA 5FH8A 5D25A 3SVFA 4QSTA 2H60A 3JVKA 4YY6A 5D24A 4TT6A 4DONA 4O71A 4QYLA 4Z6HA 4IR3A 5CUBA 5FE5A 5CQ5A 5IGMA 5L99A 4Q0NA 5CQAA 5A83A 4YYNA 5HJCA 5D26A 5EQ1A 5E74A 2G4AA 3DAIA 2KTBB 4UIWA 5EISA 5TCMA 5CRMA 5DYXA 5G4SA 5HENA 2YEMA 3S91A 4CUTA 4F3IA 4YYKA 2RS9B 3AADA 3JVJA 5A5SA 5D3TA 5ENCA 3U5PA 5E9MA 5CY9A 5HM0A 5FE7A 4IR5A 5CUEA 5E3DA 5AMEA 3ZYUA 5E9IA 5EPRA 4BW1A 4PCEA 4IOQA 5EWHA 3P1DA 2RNYA 3UVYA 4O7AA 4HBYA 5LKUA 5BT5A 4QSPA 5DY7A 4O77A 4UYGA 5F36A 4KV4A 4PCIA 4A9NA 3UVDA 5I89A 5LJ0A 4PY6A 5LVQA 5DLXA 4TT2A 4BHWA 5DFCA 2DVQA 5JWMA 5L8TA 5DBMA 4NRBA 4UITA 2DVSA 4NS5A 4O78A 3MXFA 4E96A 2L5EA 5IGKA 2D9EA 4FLPA 4HXPA 5HELA 4KCXA 5FE4A 1N72A 3O34A 5E9VA 2OO1A 2RNXA 5I40A 5D3SA 5D3RA 2L85A 1JM4B 3IU5A 3SVGA 5CUGA 5F63A 5H1UA 5FE9A 3U5KA 4UYHA 5HCLA 4XYAA 4QR5A 4ZC9A 3G0JA 4NXJA 5E0RA 4YAXA 2L84A 5HRVA 3HMFA 4QY4A 4Z6IA 4IR4A 3MB4A 4A9MA 5DLZA 5CP5A 3JVMA 5E9YA 4NQNA 5HEMA 5H1TA 4Z1SA 4HXOA 4MR6A 5E9LA 5CUAA 5CZGA 4ZQLA 4QSVA 5F3AA 3HMEA 5FB0A 3QZTA 4TZ2A 4O75A 4C66A 4CUUA 5EM3A 3SVHA 5CUDA 4QSQA 5LKXA 4A9OA 4NR9A 4ZW1A 4TTEA 5D0CA 4NQMA 5CQ3A 2RO1A 4IR6A 4QSSA 4YYGA 4A9EA 5A82A 3LQHA 5EWWA 2OSSA 4QSUA 4UIYA 2WP2A 1WUMA 4O7EA 4YATA 3IU6A 4MENA 4TU6A 2D82A 4NRAA 3MULA 4HXMA 4NR4A 4YYDA 5TB6A 4C67A 4KV1A 5L8UA 4NUEA 5EWCA 5AD2A 4QC3A 4NUCA 5CGPA 5HLSA 5F1LA 4QSWA 2YYNA 4QNSA 4O7BA 5ENJA 4PTBA 5H85A 4QUTA 5CU8A 5HFQA 5A5NA 2DATA 4UYEA 5HRWA 3P5OA 5FG4A 1EQFA 5DW2A 4OGJA 3TLPA 3LJWA 5DKDA 2WP1A 4MEOA 2YELA 2E7NA 1ZS5A 3U5NA 5F60A 4A9HA 5A5QA 3GG3A 2YQDA 4Q0OA 4TQNA 5II1A 2DKWA 4NUDA 5D3JA 4QEWA 4CFKA 5LVRA 5LJ1A 3P1EA 4BW3A 5A85A 5J0DA 3P1FA 4PKLA 5COIA 4YK0A 5BT3A 4UIVA 5BT4A 4TS8A 4A9LA 5ENFA 5C87A 3Q2EA 5D3LA 5E9KA 5EWVA 4ALGA 4TU4A 5CS8A 5I80A 3O36A 5FE1A 5FH6A 3MQMA 2DVRA 4NYVA 4YADA 5EP7A 4BJXA 5HQ7A 4YABA 4LZ2A 4TYLA 4LRGA 5FH7A 5EICA 5FBXA 3UW9A 5F61A 4NR5A 4YYHA 4QUUA 4QR4A 4N4GA 4YBMA 2E7OA 4HXLA 2RI7A 5FFYA 4O72A 4QB3A 5AMFA 1JSPB 5DYAA 5F1HA 5LKZA 3LXJA 3U5OA 4CLBA 5A5OA 4UIXA 5FG5A 4NR7A 3G0LA 4OGIA 4XUAA 5E73A 2MJVB 5KU3A 3NXBA 4O7FA 3Q2FA 5DYUA 4OUFA 3LQJA 4J0SA 5DFDA 4XUBA 2R10A 4NYXA 4N3WA 5C7NA 2DWWA 5ETDA 5DYCA 4MEPA 3MUKA 5D3HA 5EGUA 3RCWA 2YEKA 3D7CA 3P1CA 2DVVA 5EK9A 3AQAA 5K29A 2N9GA 5EU1A 5H1VA 5I83A 4YYJA 5EPBA 5A7CA 5A81A 3QZVA 5CQ4A 5DKCA 2RFJA 4CUPA 5CQ8A 5EA1A 5KTXA 5IGLA 5FE3A 5IIDA 4N4HA 2GRCA 4XY8A 5C85A 5CQTA 3JVLA 4O74A 4A9JA 4GPJA 4LC2A 5CUCA 4LYIA 4LZSA 5LJ2A 5I29A 4QSXA 3UVXA 4NR6A 4YBTA 4YH3A 4LYSA 4UYFA 2YW5A 3U5JA 4YH4A 5FFWA 4QEUA 5C89A 5FG6A 5DFBA 5L98A 4LYWA 5IG6A 2I8NA 4X2IA 5ENHA 5A5PA 5L97A 5F62A 5FE8A 5KHMA 4MR3A 5ACYA 5CQ7A 4HBXA 3ONIA 4WHUA 5FE2A 3UV5A 5F5ZA 5D7XA 4YBSA 2LSPB 4HBWA 5ETBA 4IOOA 1X0JA 3FKMX 4BW2A 4UIUA 4QR3A 5I86A 3UV4A 4A9FA 2NXBA 5ENEA 4IORA 3K2JA 3QZSA 4J1PA 4J3IA 5KO4A 5LKTA 4TZ8A 4YYMA 5CQ6A 1E6IA 2YDWA 5E7DA 5I7YA 5DX4A 4MEQA 4O76A 4QC1A 3S92A 5AD3A 5EPSA 3U5LA 5HFRA 4UIZA 4UYDA 4Z1QA 5C8GA 5KTUA 5JI8A 2R0SA 5HQ5A 4MR4A 5F25A 5EVAA 3LQIA 4NYWA 4A9KA 4CUQA 5CPEA 5I1QA 5ENBA 4HXNA 4QYDA 5D3PA 4CFLA 4YYIA 4RVRA 4MR5A 4YY4A 4N4IA 4QEVA 3O35A 4QBMA 5DW1A 2R0VA 5ENGA 5CRZA 5CFWA 4AKNA 4QZSA 2FSAA 5LUUA 5A5RA 5EV9A 5ENIA 5IBNA 5DKHA 5CTLA 5G4RA 2RNWA 5HRXA 2E3KA 4XY9A 4PS5A 4CUSA 3O33A 4HXKA 4QSRA 5I7XA 4LZRA 4NRCA 1WUGA 5FDZA 4YC9A 5E3GA 2F6NA 4WIVA 4Y03A 5I88A 3UVWA 2I7KA 3U5MA 4LR6A 1F68A 3O37A 4BW4A 4WHWA 4O7CA 4J0RA 5IGNA 4NR8A 5FFVA 4LDFA 4HXSA 4UYFB 5HQ6A 3UV2A 5C4QA 2OUOA
chains in the Genus database with same CATH superfamily
5FE6A 2F6JA 5KTWA 5II2A 5F2PA 5EI4A 3DWYA 3I3JA 5EWDA 4CL9A 5FE0A 4O70A 5D3NA 4HXRA 4A9IA 4Z93A 4CURA 2R0YA 3MB3A 5FB1A 4HBVA 4ALHA 5L96A 3HMHA 4TT4A 4N4FA 5FH8A 5D25A 3SVFA 4QSTA 2H60A 3JVKA 4YY6A 5D24A 4TT6A 4DONA 4O71A 4QYLA 4Z6HA 4IR3A 5CUBA 5FE5A 5CQ5A 5IGMA 5L99A 4Q0NA 5CQAA 5A83A 4YYNA 5HJCA 5D26A 5EQ1A 5E74A 2G4AA 3DAIA 2KTBB 4UIWA 5EISA 5TCMA 5CRMA 5DYXA 5G4SA 5HENA 2YEMA 3S91A 4CUTA 4F3IA 4YYKA 2RS9B 3AADA 3JVJA 5A5SA 5D3TA 5ENCA 3U5PA 5E9MA 5CY9A 5HM0A 5FE7A 4IR5A 5CUEA 5E3DA 5AMEA 3ZYUA 5E9IA 5EPRA 4BW1A 4PCEA 4IOQA 5EWHA 3P1DA 2RNYA 3UVYA 4O7AA 4HBYA 5LKUA 5BT5A 4QSPA 5DY7A 4O77A 4UYGA 5F36A 4KV4A 4PCIA 4A9NA 3UVDA 5I89A 5LJ0A 1PUOA 4PY6A 5LVQA 5DLXA 4TT2A 4BHWA 5DFCA 2DVQA 5JWMA 5L8TA 5DBMA 4NRBA 4UITA 2DVSA 4NS5A 4O78A 3MXFA 4E96A 2L5EA 5IGKA 2D9EA 4FLPA 4HXPA 5HELA 4KCXA 5FE4A 1N72A 3O34A 5E9VA 2OO1A 2RNXA 5I40A 5D3SA 5D3RA 2L85A 1JM4B 3IU5A 3SVGA 5CUGA 5F63A 5H1UA 5FE9A 3U5KA 4UYHA 5HCLA 4XYAA 4QR5A 4ZC9A 3G0JA 4NXJA 5E0RA 4YAXA 2L84A 5HRVA 3HMFA 4QY4A 4Z6IA 4IR4A 3MB4A 4A9MA 5DLZA 5CP5A 3JVMA 5E9YA 4NQNA 5HEMA 4AI6A 5H1TA 4Z1SA 4HXOA 4MR6A 5E9LA 5CUAA 5CZGA 4ZQLA 4QSVA 5F3AA 3HMEA 5FB0A 3QZTA 4TZ2A 4O75A 4C66A 4CUUA 5EM3A 3SVHA 5CUDA 4QSQA 5LKXA 4A9OA 4NR9A 4ZW1A 4TTEA 5D0CA 4NQMA 5CQ3A 2RO1A 4IR6A 4QSSA 4YYGA 4A9EA 5A82A 3LQHA 5EWWA 2OSSA 4AKGA 4QSUA 4UIYA 2WP2A 1WUMA 4O7EA 4YATA 3IU6A 4MENA 4TU6A 2D82A 4NRAA 3D1BA 3MULA 4HXMA 4NR4A 4YYDA 5TB6A 4C67A 4KV1A 5L8UA 4NUEA 5EWCA 5AD2A 4QC3A 4NUCA 5CGPA 5HLSA 5F1LA 4QSWA 2YYNA 4QNSA 4O7BA 5ENJA 4PTBA 5H85A 4QUTA 5CU8A 5HFQA 5A5NA 2DATA 4UYEA 5HRWA 3P5OA 5FG4A 1EQFA 5DW2A 4OGJA 3TLPA 3LJWA 5DKDA 2WP1A 4MEOA 2YELA 2E7NA 1ZS5A 3U5NA 5F60A 4A9HA 5A5QA 3GG3A 2YQDA 4Q0OA 4TQNA 5II1A 2DKWA 4NUDA 5D3JA 4QEWA 4CFKA 5LVRA 5LJ1A 3P1EA 4BW3A 5A85A 5J0DA 3P1FA 4PKLA 5COIA 4YK0A 5BT3A 4UIVA 5BT4A 4TS8A 4A9LA 5ENFA 5C87A 3Q2EA 5D3LA 5E9KA 5EWVA 4ALGA 4TU4A 5CS8A 5I80A 3O36A 5FE1A 5FH6A 3MQMA 2DVRA 4NYVA 4YADA 5EP7A 4BJXA 4AKHA 5HQ7A 4YABA 4LZ2A 4TYLA 4LRGA 5FH7A 5EICA 5FBXA 3UW9A 5F61A 4NR5A 4YYHA 4QUUA 4QR4A 4N4GA 4YBMA 2E7OA 4HXLA 2RI7A 5FFYA 4O72A 4QB3A 5AMFA 1JSPB 5DYAA 5F1HA 5LKZA 3LXJA 3U5OA 4CLBA 5A5OA 4UIXA 5FG5A 4NR7A 3G0LA 4OGIA 4XUAA 5E73A 2MJVB 5KU3A 3NXBA 4O7FA 3Q2FA 5DYUA 4OUFA 3LQJA 4J0SA 5DFDA 4XUBA 2R10A 4NYXA 4N3WA 5C7NA 2DWWA 5ETDA 2EJNA 5DYCA 4MEPA 3MUKA 1ZKRA 5D3HA 5EGUA 3RCWA 2YEKA 3D7CA 3P1CA 2DVVA 5EK9A 3AQAA 5K29A 2N9GA 5EU1A 5H1VA 5I83A 4YYJA 5EPBA 5A7CA 5A81A 3QZVA 5CQ4A 5DKCA 2RFJA 4CUPA 5CQ8A 5EA1A 5KTXA 5IGLA 5FE3A 5IIDA 4N4HA 2GRCA 4XY8A 5C85A 5CQTA 3JVLA 4O74A 4AKIA 4A9JA 4GPJA 4LC2A 5CUCA 4LYIA 4LZSA 5LJ2A 5I29A 4QSXA 3UVXA 4NR6A 4YBTA 4YH3A 4LYSA 4UYFA 2YW5A 3U5JA 4YH4A 5FFWA 4QEUA 5C89A 5FG6A 5DFBA 5L98A 4LYWA 5IG6A 2I8NA 4X2IA 5ENHA 5A5PA 5L97A 5F62A 5FE8A 5KHMA 4MR3A 5ACYA 5CQ7A 4HBXA 3ONIA 4WHUA 5FE2A 3VKGA 3UV5A 5F5ZA 5D7XA 4YBSA 2LSPB 4HBWA 5ETBA 4IOOA 1X0JA 3ERRA 3FKMX 4BW2A 4UIUA 4QR3A 5I86A 3UV4A 4A9FA 2NXBA 5ENEA 4IORA 3K2JA 3QZSA 4J1PA 4J3IA 5KO4A 5LKTA 4TZ8A 4YYMA 5CQ6A 1E6IA 2YDWA 5E7DA 5I7YA 5DX4A 4MEQA 4O76A 4QC1A 3S92A 5AD3A 3VKHA 5EPSA 3U5LA 5HFRA 4UIZA 4UYDA 4Z1QA 5C8GA 5KTUA 5JI8A 2R0SA 5HQ5A 4MR4A 5F25A 5EVAA 3LQIA 4NYWA 4A9KA 4CUQA 5CPEA 5I1QA 5ENBA 4HXNA 4QYDA 5D3PA 4CFLA 4YYIA 4RVRA 4MR5A 4YY4A 4N4IA 4QEVA 3O35A 4QBMA 5DW1A 2R0VA 5ENGA 5CRZA 5CFWA 4AKNA 4QZSA 2FSAA 5LUUA 5A5RA 5EV9A 5ENIA 5IBNA 5DKHA 5CTLA 5G4RA 2RNWA 5HRXA 2E3KA 4XY9A 4PS5A 4CUSA 3O33A 4HXKA 4QSRA 5I7XA 4LZRA 4NRCA 1WUGA 5FDZA 4YC9A 3D1DA 5E3GA 2F6NA 4WIVA 4Y03A 5I88A 3UVWA 2I7KA 3U5MA 4LR6A 1F68A 3O37A 4BW4A 4WHWA 4O7CA 4J0RA 5IGNA 4NR8A 5FFVA 4LDFA 4HXSA 4UYFB 5HQ6A 3UV2A 5C4QA 2OUOA
chains in the Genus database with same CATH topology
5FE6A 2F6JA 5KTWA 5II2A 5F2PA 5EI4A 3DWYA 3I3JA 5EWDA 4CL9A 5FE0A 4O70A 5D3NA 4HXRA 4A9IA 4Z93A 4CURA 2R0YA 3MB3A 5FB1A 4HBVA 4ALHA 5L96A 3HMHA 4TT4A 4N4FA 5FH8A 5D25A 3SVFA 4QSTA 2H60A 3JVKA 4YY6A 5D24A 4TT6A 4DONA 4O71A 4QYLA 4Z6HA 4IR3A 5CUBA 5FE5A 5CQ5A 5IGMA 5L99A 4Q0NA 5CQAA 5A83A 4YYNA 5HJCA 5D26A 5EQ1A 5E74A 2G4AA 3DAIA 2KTBB 4UIWA 5EISA 5TCMA 5CRMA 5DYXA 5G4SA 5HENA 2YEMA 3S91A 4CUTA 4F3IA 4YYKA 2RS9B 3AADA 3JVJA 5A5SA 5D3TA 5ENCA 3U5PA 5E9MA 5CY9A 5HM0A 5FE7A 4IR5A 5CUEA 5E3DA 5AMEA 3ZYUA 5E9IA 5EPRA 4BW1A 4PCEA 4IOQA 5EWHA 3P1DA 2RNYA 3UVYA 4O7AA 4HBYA 5LKUA 5BT5A 4QSPA 5DY7A 4O77A 4UYGA 5F36A 4KV4A 4PCIA 4A9NA 3UVDA 5I89A 5LJ0A 4PY6A 5LVQA 5DLXA 4TT2A 4BHWA 5DFCA 2DVQA 5JWMA 5L8TA 5DBMA 4NRBA 4UITA 2DVSA 4NS5A 4O78A 3MXFA 4E96A 2L5EA 5IGKA 2D9EA 4FLPA 4HXPA 5HELA 4KCXA 5FE4A 1N72A 3O34A 5E9VA 2OO1A 2RNXA 5I40A 5D3SA 5D3RA 2L85A 1JM4B 3IU5A 3SVGA 5CUGA 5F63A 5H1UA 5FE9A 3U5KA 4UYHA 5HCLA 4XYAA 4QR5A 4ZC9A 3G0JA 4NXJA 5E0RA 4YAXA 2L84A 5HRVA 3HMFA 4QY4A 4Z6IA 4IR4A 3MB4A 4A9MA 5DLZA 5CP5A 3JVMA 5E9YA 4NQNA 5HEMA 5H1TA 4Z1SA 4HXOA 4MR6A 5E9LA 5CUAA 5CZGA 4ZQLA 4QSVA 5F3AA 3HMEA 5FB0A 3QZTA 4TZ2A 4O75A 4C66A 4CUUA 5EM3A 3SVHA 5CUDA 4QSQA 5LKXA 4A9OA 4NR9A 4ZW1A 4TTEA 5D0CA 4NQMA 5CQ3A 2RO1A 4IR6A 4QSSA 4YYGA 4A9EA 5A82A 3LQHA 5EWWA 2OSSA 4QSUA 4UIYA 2WP2A 1WUMA 4O7EA 4YATA 3IU6A 4MENA 4TU6A 2D82A 4NRAA 3MULA 4HXMA 4NR4A 4YYDA 5TB6A 4C67A 4KV1A 5L8UA 4NUEA 5EWCA 5AD2A 4QC3A 4NUCA 5CGPA 5HLSA 5F1LA 4QSWA 2YYNA 4QNSA 4O7BA 5ENJA 4PTBA 5H85A 4QUTA 5CU8A 5HFQA 5A5NA 2DATA 4UYEA 5HRWA 3P5OA 5FG4A 1EQFA 5DW2A 4OGJA 3TLPA 3LJWA 5DKDA 2WP1A 4MEOA 2YELA 2E7NA 1ZS5A 3U5NA 5F60A 4A9HA 5A5QA 3GG3A 2YQDA 4Q0OA 4TQNA 5II1A 2DKWA 4NUDA 5D3JA 4QEWA 4CFKA 5LVRA 5LJ1A 3P1EA 4BW3A 5A85A 5J0DA 3P1FA 4PKLA 5COIA 4YK0A 5BT3A 4UIVA 5BT4A 4TS8A 4A9LA 5ENFA 5C87A 3Q2EA 5D3LA 5E9KA 5EWVA 4ALGA 4TU4A 5CS8A 5I80A 3O36A 5FE1A 5FH6A 3MQMA 2DVRA 4NYVA 4YADA 5EP7A 4BJXA 5HQ7A 4YABA 4LZ2A 4TYLA 4LRGA 5FH7A 5EICA 5FBXA 3UW9A 5F61A 4NR5A 4YYHA 4QUUA 4QR4A 4N4GA 4YBMA 2E7OA 4HXLA 2RI7A 5FFYA 4O72A 4QB3A 5AMFA 1JSPB 5DYAA 5F1HA 5LKZA 3LXJA 3U5OA 4CLBA 5A5OA 4UIXA 5FG5A 4NR7A 3G0LA 4OGIA 4XUAA 5E73A 2MJVB 5KU3A 3NXBA 4O7FA 3Q2FA 5DYUA 4OUFA 3LQJA 4J0SA 5DFDA 4XUBA 2R10A 4NYXA 4N3WA 5C7NA 2DWWA 5ETDA 5DYCA 4MEPA 3MUKA 5D3HA 5EGUA 3RCWA 2YEKA 3D7CA 3P1CA 2DVVA 5EK9A 3AQAA 5K29A 2N9GA 5EU1A 5H1VA 5I83A 4YYJA 5EPBA 5A7CA 5A81A 3QZVA 5CQ4A 5DKCA 2RFJA 4CUPA 5CQ8A 5EA1A 5KTXA 5IGLA 5FE3A 5IIDA 4N4HA 2GRCA 4XY8A 5C85A 5CQTA 3JVLA 4O74A 4A9JA 4GPJA 4LC2A 5CUCA 4LYIA 4LZSA 5LJ2A 5I29A 4QSXA 3UVXA 4NR6A 4YBTA 4YH3A 4LYSA 4UYFA 2YW5A 3U5JA 4YH4A 5FFWA 4QEUA 5C89A 5FG6A 5DFBA 5L98A 4LYWA 5IG6A 2I8NA 4X2IA 5ENHA 5A5PA 5L97A 5F62A 5FE8A 5KHMA 4MR3A 5ACYA 5CQ7A 4HBXA 3ONIA 4WHUA 5FE2A 3UV5A 5F5ZA 5D7XA 4YBSA 2LSPB 4HBWA 5ETBA 4IOOA 1X0JA 3FKMX 4BW2A 4UIUA 4QR3A 5I86A 3UV4A 4A9FA 2NXBA 5ENEA 4IORA 3K2JA 3QZSA 4J1PA 4J3IA 5KO4A 5LKTA 4TZ8A 4YYMA 5CQ6A 1E6IA 2YDWA 5E7DA 5I7YA 5DX4A 4MEQA 4O76A 4QC1A 3S92A 5AD3A 5EPSA 3U5LA 5HFRA 4UIZA 4UYDA 4Z1QA 5C8GA 5KTUA 5JI8A 2R0SA 5HQ5A 4MR4A 5F25A 5EVAA 3LQIA 4NYWA 4A9KA 4CUQA 5CPEA 5I1QA 5ENBA 4HXNA 4QYDA 5D3PA 4CFLA 4YYIA 4RVRA 4MR5A 4YY4A 4N4IA 4QEVA 3O35A 4QBMA 5DW1A 2R0VA 5ENGA 5CRZA 5CFWA 4AKNA 4QZSA 2FSAA 5LUUA 5A5RA 5EV9A 5ENIA 5IBNA 5DKHA 5CTLA 5G4RA 2RNWA 5HRXA 2E3KA 4XY9A 4PS5A 4CUSA 3O33A 4HXKA 4QSRA 5I7XA 4LZRA 4NRCA 1WUGA 5FDZA 4YC9A 5E3GA 2F6NA 4WIVA 4Y03A 5I88A 3UVWA 2I7KA 3U5MA 4LR6A 1F68A 3O37A 4BW4A 4WHWA 4O7CA 4J0RA 5IGNA 4NR8A 5FFVA 4LDFA 4HXSA 4UYFB 5HQ6A 3UV2A 5C4QA 2OUOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FE6 A;  2F6J A;  5KTW A;  5II2 A;  5F2P A;  5EI4 A;  3DWY A;  3I3J A;  5EWD A;  4CL9 A;  5FE0 A;  4O70 A;  5D3N A;  4HXR A;  4A9I A;  4Z93 A;  4CUR A;  2R0Y A;  3MB3 A;  5FB1 A;  4HBV A;  4ALH A;  5L96 A;  3HMH A;  4TT4 A;  4N4F A;  5FH8 A;  5D25 A;  3SVF A;  4QST A;  2H60 A;  3JVK A;  4YY6 A;  5D24 A;  4TT6 A;  4DON A;  4O71 A;  4QYL A;  4Z6H A;  4IR3 A;  5CUB A;  5FE5 A;  5CQ5 A;  5IGM A;  5L99 A;  4Q0N A;  5CQA A;  5A83 A;  4YYN A;  5HJC A;  5D26 A;  5EQ1 A;  5E74 A;  2G4A A;  3DAI A;  2KTB B;  4UIW A;  5EIS A;  5TCM A;  5CRM A;  5DYX A;  5G4S A;  5HEN A;  2YEM A;  3S91 A;  4CUT A;  4F3I A;  4YYK A;  2RS9 B;  3AAD A;  3JVJ A;  5A5S A;  5D3T A;  5ENC A;  3U5P A;  5E9M A;  5CY9 A;  5HM0 A;  5FE7 A;  4IR5 A;  5CUE A;  5E3D A;  5AME A;  3ZYU A;  5E9I A;  5EPR A;  4BW1 A;  4PCE A;  4IOQ A;  5EWH A;  3P1D A;  2RNY A;  3UVY A;  4O7A A;  4HBY A;  5LKU A;  5BT5 A;  4QSP A;  5DY7 A;  4O77 A;  4UYG A;  5F36 A;  4KV4 A;  4PCI A;  4A9N A;  3UVD A;  5I89 A;  5LJ0 A;  4PY6 A;  5LVQ A;  5DLX A;  4TT2 A;  4BHW A;  5DFC A;  2DVQ A;  5JWM A;  5L8T A;  5DBM A;  4NRB A;  4UIT A;  2DVS A;  4NS5 A;  4O78 A;  3MXF A;  4E96 A;  2L5E A;  5IGK A;  2D9E A;  4FLP A;  4HXP A;  5HEL A;  4KCX A;  5FE4 A;  1N72 A;  3O34 A;  5E9V A;  2OO1 A;  2RNX A;  5I40 A;  5D3S A;  5D3R A;  2L85 A;  1JM4 B;  3IU5 A;  3SVG A;  5CUG A;  5F63 A;  5H1U A;  5FE9 A;  3U5K A;  4UYH A;  5HCL A;  4XYA A;  4QR5 A;  4ZC9 A;  3G0J A;  4NXJ A;  5E0R A;  4YAX A;  2L84 A;  5HRV A;  3HMF A;  4QY4 A;  4Z6I A;  4IR4 A;  3MB4 A;  4A9M A;  5DLZ A;  5CP5 A;  3JVM A;  5E9Y A;  4NQN A;  5HEM A;  5H1T A;  4Z1S A;  4HXO A;  4MR6 A;  5E9L A;  5CUA A;  5CZG A;  4ZQL A;  4QSV A;  5F3A A;  3HME A;  5FB0 A;  3QZT A;  4TZ2 A;  4O75 A;  4C66 A;  4CUU A;  5EM3 A;  3SVH A;  5CUD A;  4QSQ A;  5LKX A;  4A9O A;  4NR9 A;  4ZW1 A;  4TTE A;  5D0C A;  4NQM A;  5CQ3 A;  2RO1 A;  4IR6 A;  4QSS A;  4YYG A;  4A9E A;  5A82 A;  3LQH A;  5EWW A;  2OSS A;  4QSU A;  4UIY A;  2WP2 A;  1WUM A;  4O7E A;  4YAT A;  3IU6 A;  4MEN A;  4TU6 A;  2D82 A;  4NRA A;  3MUL A;  4HXM A;  4NR4 A;  4YYD A;  5TB6 A;  4C67 A;  4KV1 A;  5L8U A;  4NUE A;  5EWC A;  5AD2 A;  4QC3 A;  4NUC A;  5CGP A;  5HLS A;  5F1L A;  4QSW A;  2YYN A;  4QNS A;  4O7B A;  5ENJ A;  4PTB A;  5H85 A;  4QUT A;  5CU8 A;  5HFQ A;  5A5N A;  2DAT A;  4UYE A;  5HRW A;  3P5O A;  5FG4 A;  1EQF A;  5DW2 A;  4OGJ A;  3TLP A;  3LJW A;  5DKD A;  2WP1 A;  4MEO A;  2YEL A;  2E7N A;  1ZS5 A;  3U5N A;  5F60 A;  4A9H A;  5A5Q A;  3GG3 A;  2YQD A;  4Q0O A;  4TQN A;  5II1 A;  2DKW A;  4NUD A;  5D3J A;  4QEW A;  4CFK A;  5LVR A;  5LJ1 A;  3P1E A;  4BW3 A;  5A85 A;  5J0D A;  3P1F A;  4PKL A;  5COI A;  4YK0 A;  5BT3 A;  4UIV A;  5BT4 A;  4TS8 A;  4A9L A;  5ENF A;  5C87 A;  3Q2E A;  5D3L A;  5E9K A;  5EWV A;  4ALG A;  4TU4 A;  5CS8 A;  5I80 A;  3O36 A;  5FE1 A;  5FH6 A;  3MQM A;  2DVR A;  4NYV A;  4YAD A;  5EP7 A;  4BJX A;  5HQ7 A;  4YAB A;  4LZ2 A;  4TYL A;  4LRG A;  5FH7 A;  5EIC A;  5FBX A;  3UW9 A;  5F61 A;  4NR5 A;  4YYH A;  4QUU A;  4QR4 A;  4N4G A;  4YBM A;  2E7O A;  4HXL A;  2RI7 A;  5FFY A;  4O72 A;  4QB3 A;  5AMF A;  1JSP B;  5DYA A;  5F1H A;  5LKZ A;  3LXJ A;  3U5O A;  4CLB A;  5A5O A;  4UIX A;  5FG5 A;  4NR7 A;  3G0L A;  4OGI A;  4XUA A;  5E73 A;  2MJV B;  5KU3 A;  3NXB A;  4O7F A;  3Q2F A;  5DYU A;  4OUF A;  3LQJ A;  4J0S A;  5DFD A;  4XUB A;  2R10 A;  4NYX A;  4N3W A;  5C7N A;  2DWW A;  5ETD A;  5DYC A;  4MEP A;  3MUK A;  5D3H A;  5EGU A;  3RCW A;  2YEK A;  3D7C A;  3P1C A;  2DVV A;  5EK9 A;  3AQA A;  5K29 A;  2N9G A;  5EU1 A;  5H1V A;  5I83 A;  4YYJ A;  5EPB A;  5A7C A;  5A81 A;  3QZV A;  5CQ4 A;  5DKC A;  2RFJ A;  4CUP A;  5CQ8 A;  5EA1 A;  5KTX A;  5IGL A;  5FE3 A;  5IID A;  4N4H A;  2GRC A;  4XY8 A;  5C85 A;  5CQT A;  3JVL A;  4O74 A;  4A9J A;  4GPJ A;  4LC2 A;  5CUC A;  4LYI A;  4LZS A;  5LJ2 A;  5I29 A;  4QSX A;  3UVX A;  4NR6 A;  4YBT A;  4YH3 A;  4LYS A;  4UYF A;  2YW5 A;  3U5J A;  4YH4 A;  5FFW A;  4QEU A;  5C89 A;  5FG6 A;  5DFB A;  5L98 A;  4LYW A;  5IG6 A;  2I8N A;  4X2I A;  5ENH A;  5A5P A;  5L97 A;  5F62 A;  5FE8 A;  5KHM A;  4MR3 A;  5ACY A;  5CQ7 A;  4HBX A;  3ONI A;  4WHU A;  5FE2 A;  3UV5 A;  5F5Z A;  5D7X A;  4YBS A;  2LSP B;  4HBW A;  5ETB A;  4IOO A;  1X0J A;  3FKM X;  4BW2 A;  4UIU A;  4QR3 A;  5I86 A;  3UV4 A;  4A9F A;  2NXB A;  5ENE A;  4IOR A;  3K2J A;  3QZS A;  4J1P A;  4J3I A;  5KO4 A;  5LKT A;  4TZ8 A;  4YYM A;  5CQ6 A;  1E6I A;  2YDW A;  5E7D A;  5I7Y A;  5DX4 A;  4MEQ A;  4O76 A;  4QC1 A;  3S92 A;  5AD3 A;  5EPS A;  3U5L A;  5HFR A;  4UIZ A;  4UYD A;  4Z1Q A;  5C8G A;  5KTU A;  5JI8 A;  2R0S A;  5HQ5 A;  4MR4 A;  5F25 A;  5EVA A;  3LQI A;  4NYW A;  4A9K A;  4CUQ A;  5CPE A;  5I1Q A;  5ENB A;  4HXN A;  4QYD A;  5D3P A;  4CFL A;  4YYI A;  4RVR A;  4MR5 A;  4YY4 A;  4N4I A;  4QEV A;  3O35 A;  4QBM A;  5DW1 A;  2R0V A;  5ENG A;  5CRZ A;  5CFW A;  4AKN A;  4QZS A;  2FSA A;  5LUU A;  5A5R A;  5EV9 A;  5ENI A;  5IBN A;  5DKH A;  5CTL A;  5G4R A;  2RNW A;  5HRX A;  2E3K A;  4XY9 A;  4PS5 A;  4CUS A;  3O33 A;  4HXK A;  4QSR A;  5I7X A;  4LZR A;  4NRC A;  1WUG A;  5FDZ A;  4YC9 A;  5E3G A;  2F6N A;  4WIV A;  4Y03 A;  5I88 A;  3UVW A;  2I7K A;  3U5M A;  4LR6 A;  1F68 A;  3O37 A;  4BW4 A;  4WHW A;  4O7C A;  4J0R A;  5IGN A;  4NR8 A;  5FFV A;  4LDF A;  4HXS A;  4UYF B;  5HQ6 A;  3UV2 A;  5C4Q A;  2OUO A; 
#chains in the Genus database with same CATH topology
 5FE6 A;  2F6J A;  5KTW A;  5II2 A;  5F2P A;  5EI4 A;  3DWY A;  3I3J A;  5EWD A;  4CL9 A;  5FE0 A;  4O70 A;  5D3N A;  4HXR A;  4A9I A;  4Z93 A;  4CUR A;  2R0Y A;  3MB3 A;  5FB1 A;  4HBV A;  4ALH A;  5L96 A;  3HMH A;  4TT4 A;  4N4F A;  5FH8 A;  5D25 A;  3SVF A;  4QST A;  2H60 A;  3JVK A;  4YY6 A;  5D24 A;  4TT6 A;  4DON A;  4O71 A;  4QYL A;  4Z6H A;  4IR3 A;  5CUB A;  5FE5 A;  5CQ5 A;  5IGM A;  5L99 A;  4Q0N A;  5CQA A;  5A83 A;  4YYN A;  5HJC A;  5D26 A;  5EQ1 A;  5E74 A;  2G4A A;  3DAI A;  2KTB B;  4UIW A;  5EIS A;  5TCM A;  5CRM A;  5DYX A;  5G4S A;  5HEN A;  2YEM A;  3S91 A;  4CUT A;  4F3I A;  4YYK A;  2RS9 B;  3AAD A;  3JVJ A;  5A5S A;  5D3T A;  5ENC A;  3U5P A;  5E9M A;  5CY9 A;  5HM0 A;  5FE7 A;  4IR5 A;  5CUE A;  5E3D A;  5AME A;  3ZYU A;  5E9I A;  5EPR A;  4BW1 A;  4PCE A;  4IOQ A;  5EWH A;  3P1D A;  2RNY A;  3UVY A;  4O7A A;  4HBY A;  5LKU A;  5BT5 A;  4QSP A;  5DY7 A;  4O77 A;  4UYG A;  5F36 A;  4KV4 A;  4PCI A;  4A9N A;  3UVD A;  5I89 A;  5LJ0 A;  1PUO A;  4PY6 A;  5LVQ A;  5DLX A;  4TT2 A;  4BHW A;  5DFC A;  2DVQ A;  5JWM A;  5L8T A;  5DBM A;  4NRB A;  4UIT A;  2DVS A;  4NS5 A;  4O78 A;  3MXF A;  4E96 A;  2L5E A;  5IGK A;  2D9E A;  4FLP A;  4HXP A;  5HEL A;  4KCX A;  5FE4 A;  1N72 A;  3O34 A;  5E9V A;  2OO1 A;  2RNX A;  5I40 A;  5D3S A;  5D3R A;  2L85 A;  1JM4 B;  3IU5 A;  3SVG A;  5CUG A;  5F63 A;  5H1U A;  5FE9 A;  3U5K A;  4UYH A;  5HCL A;  4XYA A;  4QR5 A;  4ZC9 A;  3G0J A;  4NXJ A;  5E0R A;  4YAX A;  2L84 A;  5HRV A;  3HMF A;  4QY4 A;  4Z6I A;  4IR4 A;  3MB4 A;  4A9M A;  5DLZ A;  5CP5 A;  3JVM A;  5E9Y A;  4NQN A;  5HEM A;  4AI6 A;  5H1T A;  4Z1S A;  4HXO A;  4MR6 A;  5E9L A;  5CUA A;  5CZG A;  4ZQL A;  4QSV A;  5F3A A;  3HME A;  5FB0 A;  3QZT A;  4TZ2 A;  4O75 A;  4C66 A;  4CUU A;  5EM3 A;  3SVH A;  5CUD A;  4QSQ A;  5LKX A;  4A9O A;  4NR9 A;  4ZW1 A;  4TTE A;  5D0C A;  4NQM A;  5CQ3 A;  2RO1 A;  4IR6 A;  4QSS A;  4YYG A;  4A9E A;  5A82 A;  3LQH A;  5EWW A;  2OSS A;  4AKG A;  4QSU A;  4UIY A;  2WP2 A;  1WUM A;  4O7E A;  4YAT A;  3IU6 A;  4MEN A;  4TU6 A;  2D82 A;  4NRA A;  3D1B A;  3MUL A;  4HXM A;  4NR4 A;  4YYD A;  5TB6 A;  4C67 A;  4KV1 A;  5L8U A;  4NUE A;  5EWC A;  5AD2 A;  4QC3 A;  4NUC A;  5CGP A;  5HLS A;  5F1L A;  4QSW A;  2YYN A;  4QNS A;  4O7B A;  5ENJ A;  4PTB A;  5H85 A;  4QUT A;  5CU8 A;  5HFQ A;  5A5N A;  2DAT A;  4UYE A;  5HRW A;  3P5O A;  5FG4 A;  1EQF A;  5DW2 A;  4OGJ A;  3TLP A;  3LJW A;  5DKD A;  2WP1 A;  4MEO A;  2YEL A;  2E7N A;  1ZS5 A;  3U5N A;  5F60 A;  4A9H A;  5A5Q A;  3GG3 A;  2YQD A;  4Q0O A;  4TQN A;  5II1 A;  2DKW A;  4NUD A;  5D3J A;  4QEW A;  4CFK A;  5LVR A;  5LJ1 A;  3P1E A;  4BW3 A;  5A85 A;  5J0D A;  3P1F A;  4PKL A;  5COI A;  4YK0 A;  5BT3 A;  4UIV A;  5BT4 A;  4TS8 A;  4A9L A;  5ENF A;  5C87 A;  3Q2E A;  5D3L A;  5E9K A;  5EWV A;  4ALG A;  4TU4 A;  5CS8 A;  5I80 A;  3O36 A;  5FE1 A;  5FH6 A;  3MQM A;  2DVR A;  4NYV A;  4YAD A;  5EP7 A;  4BJX A;  4AKH A;  5HQ7 A;  4YAB A;  4LZ2 A;  4TYL A;  4LRG A;  5FH7 A;  5EIC A;  5FBX A;  3UW9 A;  5F61 A;  4NR5 A;  4YYH A;  4QUU A;  4QR4 A;  4N4G A;  4YBM A;  2E7O A;  4HXL A;  2RI7 A;  5FFY A;  4O72 A;  4QB3 A;  5AMF A;  1JSP B;  5DYA A;  5F1H A;  5LKZ A;  3LXJ A;  3U5O A;  4CLB A;  5A5O A;  4UIX A;  5FG5 A;  4NR7 A;  3G0L A;  4OGI A;  4XUA A;  5E73 A;  2MJV B;  5KU3 A;  3NXB A;  4O7F A;  3Q2F A;  5DYU A;  4OUF A;  3LQJ A;  4J0S A;  5DFD A;  4XUB A;  2R10 A;  4NYX A;  4N3W A;  5C7N A;  2DWW A;  5ETD A;  2EJN A;  5DYC A;  4MEP A;  3MUK A;  1ZKR A;  5D3H A;  5EGU A;  3RCW A;  2YEK A;  3D7C A;  3P1C A;  2DVV A;  5EK9 A;  3AQA A;  5K29 A;  2N9G A;  5EU1 A;  5H1V A;  5I83 A;  4YYJ A;  5EPB A;  5A7C A;  5A81 A;  3QZV A;  5CQ4 A;  5DKC A;  2RFJ A;  4CUP A;  5CQ8 A;  5EA1 A;  5KTX A;  5IGL A;  5FE3 A;  5IID A;  4N4H A;  2GRC A;  4XY8 A;  5C85 A;  5CQT A;  3JVL A;  4O74 A;  4AKI A;  4A9J A;  4GPJ A;  4LC2 A;  5CUC A;  4LYI A;  4LZS A;  5LJ2 A;  5I29 A;  4QSX A;  3UVX A;  4NR6 A;  4YBT A;  4YH3 A;  4LYS A;  4UYF A;  2YW5 A;  3U5J A;  4YH4 A;  5FFW A;  4QEU A;  5C89 A;  5FG6 A;  5DFB A;  5L98 A;  4LYW A;  5IG6 A;  2I8N A;  4X2I A;  5ENH A;  5A5P A;  5L97 A;  5F62 A;  5FE8 A;  5KHM A;  4MR3 A;  5ACY A;  5CQ7 A;  4HBX A;  3ONI A;  4WHU A;  5FE2 A;  3VKG A;  3UV5 A;  5F5Z A;  5D7X A;  4YBS A;  2LSP B;  4HBW A;  5ETB A;  4IOO A;  1X0J A;  3ERR A;  3FKM X;  4BW2 A;  4UIU A;  4QR3 A;  5I86 A;  3UV4 A;  4A9F A;  2NXB A;  5ENE A;  4IOR A;  3K2J A;  3QZS A;  4J1P A;  4J3I A;  5KO4 A;  5LKT A;  4TZ8 A;  4YYM A;  5CQ6 A;  1E6I A;  2YDW A;  5E7D A;  5I7Y A;  5DX4 A;  4MEQ A;  4O76 A;  4QC1 A;  3S92 A;  5AD3 A;  3VKH A;  5EPS A;  3U5L A;  5HFR A;  4UIZ A;  4UYD A;  4Z1Q A;  5C8G A;  5KTU A;  5JI8 A;  2R0S A;  5HQ5 A;  4MR4 A;  5F25 A;  5EVA A;  3LQI A;  4NYW A;  4A9K A;  4CUQ A;  5CPE A;  5I1Q A;  5ENB A;  4HXN A;  4QYD A;  5D3P A;  4CFL A;  4YYI A;  4RVR A;  4MR5 A;  4YY4 A;  4N4I A;  4QEV A;  3O35 A;  4QBM A;  5DW1 A;  2R0V A;  5ENG A;  5CRZ A;  5CFW A;  4AKN A;  4QZS A;  2FSA A;  5LUU A;  5A5R A;  5EV9 A;  5ENI A;  5IBN A;  5DKH A;  5CTL A;  5G4R A;  2RNW A;  5HRX A;  2E3K A;  4XY9 A;  4PS5 A;  4CUS A;  3O33 A;  4HXK A;  4QSR A;  5I7X A;  4LZR A;  4NRC A;  1WUG A;  5FDZ A;  4YC9 A;  3D1D A;  5E3G A;  2F6N A;  4WIV A;  4Y03 A;  5I88 A;  3UVW A;  2I7K A;  3U5M A;  4LR6 A;  1F68 A;  3O37 A;  4BW4 A;  4WHW A;  4O7C A;  4J0R A;  5IGN A;  4NR8 A;  5FFV A;  4LDF A;  4HXS A;  4UYF B;  5HQ6 A;  3UV2 A;  5C4Q A;  2OUO A; 
#chains in the Genus database with same CATH homology
 5FE6 A;  2F6J A;  5KTW A;  5II2 A;  5F2P A;  5EI4 A;  3DWY A;  3I3J A;  5EWD A;  4CL9 A;  5FE0 A;  4O70 A;  5D3N A;  4HXR A;  4A9I A;  4Z93 A;  4CUR A;  2R0Y A;  3MB3 A;  5FB1 A;  4HBV A;  4ALH A;  5L96 A;  3HMH A;  4TT4 A;  4N4F A;  5FH8 A;  5D25 A;  3SVF A;  4QST A;  2H60 A;  3JVK A;  4YY6 A;  5D24 A;  4TT6 A;  4DON A;  4O71 A;  4QYL A;  4Z6H A;  4IR3 A;  5CUB A;  5FE5 A;  5CQ5 A;  5IGM A;  5L99 A;  4Q0N A;  5CQA A;  5A83 A;  4YYN A;  5HJC A;  5D26 A;  5EQ1 A;  5E74 A;  2G4A A;  3DAI A;  2KTB B;  4UIW A;  5EIS A;  5TCM A;  5CRM A;  5DYX A;  5G4S A;  5HEN A;  2YEM A;  3S91 A;  4CUT A;  4F3I A;  4YYK A;  2RS9 B;  3AAD A;  3JVJ A;  5A5S A;  5D3T A;  5ENC A;  3U5P A;  5E9M A;  5CY9 A;  5HM0 A;  5FE7 A;  4IR5 A;  5CUE A;  5E3D A;  5AME A;  3ZYU A;  5E9I A;  5EPR A;  4BW1 A;  4PCE A;  4IOQ A;  5EWH A;  3P1D A;  2RNY A;  3UVY A;  4O7A A;  4HBY A;  5LKU A;  5BT5 A;  4QSP A;  5DY7 A;  4O77 A;  4UYG A;  5F36 A;  4KV4 A;  4PCI A;  4A9N A;  3UVD A;  5I89 A;  5LJ0 A;  4PY6 A;  5LVQ A;  5DLX A;  4TT2 A;  4BHW A;  5DFC A;  2DVQ A;  5JWM A;  5L8T A;  5DBM A;  4NRB A;  4UIT A;  2DVS A;  4NS5 A;  4O78 A;  3MXF A;  4E96 A;  2L5E A;  5IGK A;  2D9E A;  4FLP A;  4HXP A;  5HEL A;  4KCX A;  5FE4 A;  1N72 A;  3O34 A;  5E9V A;  2OO1 A;  2RNX A;  5I40 A;  5D3S A;  5D3R A;  2L85 A;  1JM4 B;  3IU5 A;  3SVG A;  5CUG A;  5F63 A;  5H1U A;  5FE9 A;  3U5K A;  4UYH A;  5HCL A;  4XYA A;  4QR5 A;  4ZC9 A;  3G0J A;  4NXJ A;  5E0R A;  4YAX A;  2L84 A;  5HRV A;  3HMF A;  4QY4 A;  4Z6I A;  4IR4 A;  3MB4 A;  4A9M A;  5DLZ A;  5CP5 A;  3JVM A;  5E9Y A;  4NQN A;  5HEM A;  5H1T A;  4Z1S A;  4HXO A;  4MR6 A;  5E9L A;  5CUA A;  5CZG A;  4ZQL A;  4QSV A;  5F3A A;  3HME A;  5FB0 A;  3QZT A;  4TZ2 A;  4O75 A;  4C66 A;  4CUU A;  5EM3 A;  3SVH A;  5CUD A;  4QSQ A;  5LKX A;  4A9O A;  4NR9 A;  4ZW1 A;  4TTE A;  5D0C A;  4NQM A;  5CQ3 A;  2RO1 A;  4IR6 A;  4QSS A;  4YYG A;  4A9E A;  5A82 A;  3LQH A;  5EWW A;  2OSS A;  4QSU A;  4UIY A;  2WP2 A;  1WUM A;  4O7E A;  4YAT A;  3IU6 A;  4MEN A;  4TU6 A;  2D82 A;  4NRA A;  3MUL A;  4HXM A;  4NR4 A;  4YYD A;  5TB6 A;  4C67 A;  4KV1 A;  5L8U A;  4NUE A;  5EWC A;  5AD2 A;  4QC3 A;  4NUC A;  5CGP A;  5HLS A;  5F1L A;  4QSW A;  2YYN A;  4QNS A;  4O7B A;  5ENJ A;  4PTB A;  5H85 A;  4QUT A;  5CU8 A;  5HFQ A;  5A5N A;  2DAT A;  4UYE A;  5HRW A;  3P5O A;  5FG4 A;  1EQF A;  5DW2 A;  4OGJ A;  3TLP A;  3LJW A;  5DKD A;  2WP1 A;  4MEO A;  2YEL A;  2E7N A;  1ZS5 A;  3U5N A;  5F60 A;  4A9H A;  5A5Q A;  3GG3 A;  2YQD A;  4Q0O A;  4TQN A;  5II1 A;  2DKW A;  4NUD A;  5D3J A;  4QEW A;  4CFK A;  5LVR A;  5LJ1 A;  3P1E A;  4BW3 A;  5A85 A;  5J0D A;  3P1F A;  4PKL A;  5COI A;  4YK0 A;  5BT3 A;  4UIV A;  5BT4 A;  4TS8 A;  4A9L A;  5ENF A;  5C87 A;  3Q2E A;  5D3L A;  5E9K A;  5EWV A;  4ALG A;  4TU4 A;  5CS8 A;  5I80 A;  3O36 A;  5FE1 A;  5FH6 A;  3MQM A;  2DVR A;  4NYV A;  4YAD A;  5EP7 A;  4BJX A;  5HQ7 A;  4YAB A;  4LZ2 A;  4TYL A;  4LRG A;  5FH7 A;  5EIC A;  5FBX A;  3UW9 A;  5F61 A;  4NR5 A;  4YYH A;  4QUU A;  4QR4 A;  4N4G A;  4YBM A;  2E7O A;  4HXL A;  2RI7 A;  5FFY A;  4O72 A;  4QB3 A;  5AMF A;  1JSP B;  5DYA A;  5F1H A;  5LKZ A;  3LXJ A;  3U5O A;  4CLB A;  5A5O A;  4UIX A;  5FG5 A;  4NR7 A;  3G0L A;  4OGI A;  4XUA A;  5E73 A;  2MJV B;  5KU3 A;  3NXB A;  4O7F A;  3Q2F A;  5DYU A;  4OUF A;  3LQJ A;  4J0S A;  5DFD A;  4XUB A;  2R10 A;  4NYX A;  4N3W A;  5C7N A;  2DWW A;  5ETD A;  5DYC A;  4MEP A;  3MUK A;  5D3H A;  5EGU A;  3RCW A;  2YEK A;  3D7C A;  3P1C A;  2DVV A;  5EK9 A;  3AQA A;  5K29 A;  2N9G A;  5EU1 A;  5H1V A;  5I83 A;  4YYJ A;  5EPB A;  5A7C A;  5A81 A;  3QZV A;  5CQ4 A;  5DKC A;  2RFJ A;  4CUP A;  5CQ8 A;  5EA1 A;  5KTX A;  5IGL A;  5FE3 A;  5IID A;  4N4H A;  2GRC A;  4XY8 A;  5C85 A;  5CQT A;  3JVL A;  4O74 A;  4A9J A;  4GPJ A;  4LC2 A;  5CUC A;  4LYI A;  4LZS A;  5LJ2 A;  5I29 A;  4QSX A;  3UVX A;  4NR6 A;  4YBT A;  4YH3 A;  4LYS A;  4UYF A;  2YW5 A;  3U5J A;  4YH4 A;  5FFW A;  4QEU A;  5C89 A;  5FG6 A;  5DFB A;  5L98 A;  4LYW A;  5IG6 A;  2I8N A;  4X2I A;  5ENH A;  5A5P A;  5L97 A;  5F62 A;  5FE8 A;  5KHM A;  4MR3 A;  5ACY A;  5CQ7 A;  4HBX A;  3ONI A;  4WHU A;  5FE2 A;  3UV5 A;  5F5Z A;  5D7X A;  4YBS A;  2LSP B;  4HBW A;  5ETB A;  4IOO A;  1X0J A;  3FKM X;  4BW2 A;  4UIU A;  4QR3 A;  5I86 A;  3UV4 A;  4A9F A;  2NXB A;  5ENE A;  4IOR A;  3K2J A;  3QZS A;  4J1P A;  4J3I A;  5KO4 A;  5LKT A;  4TZ8 A;  4YYM A;  5CQ6 A;  1E6I A;  2YDW A;  5E7D A;  5I7Y A;  5DX4 A;  4MEQ A;  4O76 A;  4QC1 A;  3S92 A;  5AD3 A;  5EPS A;  3U5L A;  5HFR A;  4UIZ A;  4UYD A;  4Z1Q A;  5C8G A;  5KTU A;  5JI8 A;  2R0S A;  5HQ5 A;  4MR4 A;  5F25 A;  5EVA A;  3LQI A;  4NYW A;  4A9K A;  4CUQ A;  5CPE A;  5I1Q A;  5ENB A;  4HXN A;  4QYD A;  5D3P A;  4CFL A;  4YYI A;  4RVR A;  4MR5 A;  4YY4 A;  4N4I A;  4QEV A;  3O35 A;  4QBM A;  5DW1 A;  2R0V A;  5ENG A;  5CRZ A;  5CFW A;  4AKN A;  4QZS A;  2FSA A;  5LUU A;  5A5R A;  5EV9 A;  5ENI A;  5IBN A;  5DKH A;  5CTL A;  5G4R A;  2RNW A;  5HRX A;  2E3K A;  4XY9 A;  4PS5 A;  4CUS A;  3O33 A;  4HXK A;  4QSR A;  5I7X A;  4LZR A;  4NRC A;  1WUG A;  5FDZ A;  4YC9 A;  5E3G A;  2F6N A;  4WIV A;  4Y03 A;  5I88 A;  3UVW A;  2I7K A;  3U5M A;  4LR6 A;  1F68 A;  3O37 A;  4BW4 A;  4WHW A;  4O7C A;  4J0R A;  5IGN A;  4NR8 A;  5FFV A;  4LDF A;  4HXS A;  4UYF B;  5HQ6 A;  3UV2 A;  5C4Q A;  2OUO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...