4Z6HA

Crystal structure of brd9 bromodomain in complex with a valerolactam quinolone ligand
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
113
structure length
113
Chain Sequence
b'STPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDFGTMKDKIVANEYKSVTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMSKERLLALKRSMS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bromodomain-containing protein 9
publication title LP99: Discovery and Synthesis of the First Selective BRD7/9 Bromodomain Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 41
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4z6hA00
2E7OA 5DYAA 4UITA 4A9KA 5E74A 1X0JA 3UVWA 5II1A 3UV2A 3U5JA 3U5OA 5A5PA 4RVRA 5C4QA 5ENIA 4YYMA 5DY7A 4UIWA 5HCLA 2L85A 5LVRA 4MEQA 5EU1A 4NQMA 3MUKA 3SVFA 5F1LA 5I83A 5FG4A 3JVKA 4QB3A 4HBXA 5IGNA 4AKNA 4Z93A 5ETDA 4DONA 5AMEA 5FG5A 4NUDA 1EQFA 4HXLA 4LZRA 4HBVA 5HRXA 2DATA 4CFLA 3QZVA 5E0RA 4YYJA 4YYDA 4BJXA 4Q0NA 4N3WA 4HXRA 4O70A 4WIVA 4HBWA 4N4HA 4QSUA 4UYGA 5L98A 4LYSA 4QY4A 4PY6A 3LQHA 5E9VA 4NYXA 5DFDA 5HJCA 3NXBA 5E9LA 5G4SA 4CUTA 2YYNA 2MJVB 3U5NA 5E9KA 5G4RA 3QZTA 3UVDA 5FE2A 4NRCA 5A82A 1WUGA 5HQ6A 5EWVA 3U5PA 3U5KA 3UVXA 4YBTA 5L97A 3Q2EA 5D3NA 5CFWA 4MENA 4FLPA 4QR5A 4PCEA 4YBSA 3P1DA 5CP5A 3DAIA 4QR3A 1JSPB 2NXBA 5F5ZA 5FE6A 5IBNA 5DLXA 4QBMA 4A9JA 5D3HA 4QSPA 4TT2A 5LJ1A 3P1EA 4BW2A 5D3PA 5D3SA 5CQ5A 2DVRA 5EICA 4LYIA 2E3KA 4QC3A 3G0LA 5EGUA 4HXKA 4O7FA 2GRCA 4QSTA 4O71A 4TTEA 5EA1A 4YYGA 5HM0A 5I29A 5LKZA 5CZGA 3LJWA 5CQ3A 5HENA 4HXOA 5D26A 4CUQA 5CGPA 4MEPA 3UV4A 5A7CA 5CUBA 2YDWA 5DLZA 4QSSA 5FE9A 5CUGA 5I80A 4TZ8A 2R0VA 5CQ4A 5CUEA 5LJ2A 3P5OA 5L99A 4CUUA 5AD3A 5C85A 5DYCA 4A9OA 2YELA 5CPEA 5HQ7A 4QUTA 5H1TA 5DW2A 4HBYA 4YBMA 5I40A 4NRAA 4QSQA 4TS8A 5LKUA 3AQAA 5ACYA 4NS5A 4ZW1A 5DW1A 4J3IA 1ZS5A 5E9IA 3DWYA 1N72A 2RO1A 4KV1A 5IIDA 5FE5A 4Z1SA 2RFJA 5A5NA 4NRBA 3O37A 4ZQLA 5EWCA 3S92A 5H1UA 3P1CA 5DX4A 5CRMA 4OUFA 2RNYA 2RNXA 4NR9A 5FFVA 5CRZA 4TZ2A 4LYWA 5L96A 4LZ2A 5KTUA 4YABA 5DFBA 5E9YA 4XY8A 3SVHA 4ZC9A 5CUDA 5F25A 4QEVA 4YYHA 4IR5A 4O7AA 3G0JA 4J0RA 4YADA 5HRWA 4YY6A 4OGIA 2L5EA 4BW4A 5FBXA 2R0YA 5EQ1A 5FB0A 4C67A 3IU6A 5CQAA 4NR7A 5CQ6A 3K2JA 5FFWA 5D3JA 5ENBA 5FE3A 5EISA 2OUOA 4CUPA 1JM4B 3MQMA 4NXJA 4HXPA 5ENEA 5DFCA 5CQ8A 4O78A 5D3RA 5FB1A 4C66A 5FDZA 4NR8A 3MB4A 4UYDA 5ENCA 3U5MA 5A81A 4NUCA 4Q0OA 4IOQA 4Z1QA 2WP2A 5AMFA 2WP1A 5ENJA 4O74A 1F68A 5A5SA 5AD2A 4A9IA 5EV9A 3UVYA 5I7XA 5A83A 2RNWA 5D3LA 4IOOA 2YW5A 5KTXA 4O7CA 4XYAA 4YAXA 5EPBA 4YK0A 4CFKA 4X2IA 4J1PA 4QSXA 4A9HA 4LR6A 4CL9A 5J0DA 5JWMA 1WUMA 5F1HA 5COIA 4TU6A 4A9LA 3QZSA 5EK9A 4HXSA 5A5OA 4PS5A 5F36A 5I89A 4GPJA 5I86A 5EWWA 4J0SA 4QC1A 4UYHA 3MULA 4NR4A 3JVLA 2RI7A 5C89A 4YC9A 4MEOA 5D7XA 4LDFA 4IR4A 5E3DA 4QSRA 4QR4A 4KV4A 4UYFA 3O34A 5ENHA 3MXFA 4ALGA 4NYWA 5F3AA 5F63A 5C8GA 4BW3A 4YH4A 3UV5A 2DVVA 5CUCA 5F62A 5E7DA 5EPSA 3LQJA 5LVQA 5EWHA 3MB3A 3ZYUA 5D3TA 2L84A 4NQNA 4O7EA 4LC2A 4Z6HA 4MR5A 5FE4A 5A5RA 4QSWA 5C87A 5F60A 5FE8A 2I7KA 5LJ0A 4WHUA 5F2PA 4BW1A 3Q2FA 2YQDA 4QYLA 5II2A 5ENGA 4MR4A 4UIZA 5HFQA 5BT5A 4QNSA 4YATA 1E6IA 3IU5A 2H60A 5CQ7A 5D0CA 5LKXA 2I8NA 5HQ5A 4O75A 3SVGA 4UYEA 4QEWA 3LXJA 4LRGA 4ALHA 4E96A 5HRVA 2N9GA 5DYUA 4TT4A 2R0SA 5IGMA 5KTWA 2OSSA 2DVSA 5I7YA 5EM3A 3FKMX 4A9NA 5TCMA 3HMFA 2DKWA 4CURA 4HXNA 4XY9A 4NYVA 5C7NA 2G4AA 5HFRA 3TLPA 3I3JA 5I1QA 4PKLA 3O36A 2F6JA 4XUAA 4NR5A 4O76A 5CQTA 4QEUA 5EP7A 4CUSA 5E73A 4OGJA 3P1FA 3LQIA 5KU3A 4IORA 3HMHA 4YY4A 5LUUA 2D9EA 3O35A 3U5LA 5EVAA 5FE0A 4XUBA 5FH7A 5LKTA 5E9MA 5KHMA 4N4IA 5HEMA 4TYLA 5D24A 5FE7A 3GG3A 4A9MA 2YEKA 4MR3A 4QUUA 5IG6A 4NUEA 2KTBB 5D25A 5FFYA 3UW9A 2DVQA 2D82A 5DKHA 4N4FA 4YYKA 3JVJA 4N4GA 4UIUA 5L8UA 5CUAA 4KCXA 4QSVA 5ENFA 4TQNA 5HLSA 2YEMA 4QYDA 4UIXA 5EPRA 5FH8A 3D7CA 5DKDA 2OO1A 3ONIA 5I88A 4YH3A 4IR3A 5IGLA 5FH6A 4A9EA 4Z6IA 3AADA 5IGKA 3HMEA 5EWDA 3O33A 4YYIA 5FE1A 5L8TA 5E3GA 5F61A 2FSAA 3RCWA 4LZSA 4UYFB 4WHWA 2DWWA 5BT3A 5CS8A 4TU4A 3JVMA 2RS9B 4QZSA 5H1VA 5CU8A 5BT4A 5KO4A 2E7NA 2F6NA 4BHWA 4IR6A 5TB6A 4HXMA 4O7BA 4UIYA 4TT6A 4O72A 4F3IA 3S91A 2R10A 5EI4A 4A9FA 4CLBA 5DKCA 5DYXA 5FG6A 5JI8A 5CY9A 4MR6A 4NR6A 4UIVA 5HELA 5H85A 4PCIA 5CTLA 5A85A 4YYNA 4O77A 5K29A 2LSPB 4PTBA 5A5QA 4Y03A 5DBMA 5ETBA
chains in the Genus database with same CATH superfamily
2E7OA 5DYAA 4UITA 4A9KA 5E74A 1X0JA 3UVWA 5II1A 3UV2A 3U5JA 3U5OA 5A5PA 4RVRA 5C4QA 5ENIA 4YYMA 4AI6A 5DY7A 4UIWA 5HCLA 2L85A 5LVRA 4MEQA 5EU1A 4NQMA 3MUKA 3SVFA 5F1LA 5I83A 5FG4A 3JVKA 4QB3A 4HBXA 5IGNA 4AKNA 4Z93A 5ETDA 4DONA 5AMEA 5FG5A 4NUDA 1EQFA 4HXLA 4LZRA 4HBVA 5HRXA 2DATA 4CFLA 3QZVA 5E0RA 4YYJA 4AKGA 4YYDA 4BJXA 4Q0NA 4N3WA 4HXRA 4O70A 4WIVA 4HBWA 4N4HA 4QSUA 4UYGA 5L98A 4LYSA 4QY4A 4PY6A 3LQHA 5E9VA 4NYXA 5DFDA 5HJCA 3NXBA 5E9LA 5G4SA 4CUTA 2YYNA 2MJVB 3U5NA 5E9KA 5G4RA 3QZTA 3UVDA 5FE2A 4NRCA 5A82A 1WUGA 5HQ6A 5EWVA 3U5PA 3U5KA 3UVXA 4YBTA 5L97A 3Q2EA 5D3NA 5CFWA 4MENA 4FLPA 4QR5A 4PCEA 4YBSA 3P1DA 5CP5A 3DAIA 4QR3A 1JSPB 2NXBA 5F5ZA 5FE6A 5IBNA 5DLXA 4QBMA 4A9JA 5D3HA 4QSPA 4TT2A 5LJ1A 3P1EA 4BW2A 5D3PA 5D3SA 5CQ5A 2DVRA 5EICA 4LYIA 2E3KA 4QC3A 3G0LA 5EGUA 4HXKA 4O7FA 2GRCA 4QSTA 4O71A 4TTEA 5EA1A 4YYGA 5HM0A 5I29A 5LKZA 5CZGA 3LJWA 5CQ3A 5HENA 4HXOA 5D26A 4CUQA 5CGPA 4MEPA 3UV4A 5A7CA 5CUBA 2YDWA 5DLZA 4QSSA 5FE9A 1ZKRA 5CUGA 5I80A 4TZ8A 2R0VA 5CQ4A 5CUEA 5LJ2A 3P5OA 5L99A 4CUUA 5AD3A 5C85A 5DYCA 4A9OA 2YELA 5CPEA 5HQ7A 4QUTA 5H1TA 5DW2A 4HBYA 4YBMA 5I40A 4NRAA 4QSQA 4TS8A 5LKUA 3AQAA 5ACYA 4NS5A 4ZW1A 5DW1A 4J3IA 1ZS5A 5E9IA 3DWYA 1N72A 2RO1A 4KV1A 5IIDA 5FE5A 4Z1SA 2RFJA 5A5NA 4NRBA 3O37A 4ZQLA 5EWCA 3S92A 5H1UA 3P1CA 5DX4A 4AKIA 5CRMA 4OUFA 2RNYA 2RNXA 4NR9A 5FFVA 5CRZA 4TZ2A 4LYWA 5L96A 4LZ2A 5KTUA 4YABA 5DFBA 5E9YA 4XY8A 3SVHA 4ZC9A 5CUDA 5F25A 4QEVA 4YYHA 4IR5A 4O7AA 3G0JA 4J0RA 4YADA 5HRWA 4YY6A 4OGIA 2L5EA 4BW4A 5FBXA 2R0YA 5EQ1A 5FB0A 4C67A 3IU6A 5CQAA 4NR7A 5CQ6A 3K2JA 5FFWA 5D3JA 5ENBA 5FE3A 5EISA 2OUOA 4CUPA 1JM4B 3MQMA 4NXJA 4HXPA 5ENEA 5DFCA 5CQ8A 4O78A 5D3RA 5FB1A 4C66A 5FDZA 4NR8A 3MB4A 3VKHA 4UYDA 5ENCA 3U5MA 5A81A 3ERRA 4NUCA 4Q0OA 4IOQA 4Z1QA 2WP2A 5AMFA 2WP1A 5ENJA 4O74A 1F68A 5A5SA 5AD2A 4A9IA 3VKGA 5EV9A 3UVYA 5I7XA 5A83A 2RNWA 5D3LA 4IOOA 2YW5A 5KTXA 4O7CA 4XYAA 4YAXA 5EPBA 4YK0A 4CFKA 4X2IA 4J1PA 4QSXA 4A9HA 4LR6A 4AKHA 4CL9A 5J0DA 5JWMA 1WUMA 5F1HA 5COIA 4TU6A 4A9LA 3QZSA 5EK9A 4HXSA 5A5OA 4PS5A 5F36A 5I89A 4GPJA 5I86A 5EWWA 4J0SA 4QC1A 4UYHA 3MULA 4NR4A 3JVLA 2RI7A 5C89A 4YC9A 4MEOA 5D7XA 4LDFA 4IR4A 5E3DA 4QSRA 4QR4A 4KV4A 4UYFA 3O34A 5ENHA 3MXFA 4ALGA 4NYWA 5F3AA 5F63A 5C8GA 4BW3A 4YH4A 3UV5A 2DVVA 5CUCA 5F62A 5E7DA 5EPSA 3LQJA 5LVQA 5EWHA 3MB3A 3ZYUA 5D3TA 3D1BA 2L84A 4NQNA 4O7EA 4LC2A 4Z6HA 4MR5A 5FE4A 5A5RA 4QSWA 5C87A 5F60A 5FE8A 2I7KA 5LJ0A 4WHUA 5F2PA 4BW1A 3Q2FA 2YQDA 4QYLA 5II2A 5ENGA 4MR4A 4UIZA 5HFQA 5BT5A 4QNSA 4YATA 1E6IA 3IU5A 2H60A 5CQ7A 5D0CA 5LKXA 2I8NA 5HQ5A 4O75A 3SVGA 4UYEA 4QEWA 3LXJA 4LRGA 4ALHA 4E96A 5HRVA 2N9GA 5DYUA 4TT4A 2R0SA 5IGMA 5KTWA 2OSSA 2DVSA 5I7YA 5EM3A 3FKMX 4A9NA 5TCMA 3HMFA 2DKWA 4CURA 4HXNA 4XY9A 4NYVA 5C7NA 2G4AA 5HFRA 3TLPA 3I3JA 5I1QA 4PKLA 3O36A 2F6JA 4XUAA 4NR5A 4O76A 5CQTA 4QEUA 5EP7A 4CUSA 5E73A 4OGJA 3P1FA 3LQIA 5KU3A 4IORA 3HMHA 4YY4A 5LUUA 2D9EA 3O35A 3U5LA 5EVAA 5FE0A 4XUBA 5FH7A 5LKTA 5E9MA 5KHMA 4N4IA 5HEMA 4TYLA 5D24A 5FE7A 3GG3A 4A9MA 2YEKA 4MR3A 4QUUA 5IG6A 4NUEA 2KTBB 5D25A 5FFYA 3UW9A 2DVQA 2D82A 2EJNA 5DKHA 4N4FA 4YYKA 3JVJA 4N4GA 4UIUA 5L8UA 5CUAA 4KCXA 4QSVA 5ENFA 4TQNA 5HLSA 2YEMA 4QYDA 1PUOA 4UIXA 5EPRA 5FH8A 3D7CA 5DKDA 2OO1A 3ONIA 5I88A 4YH3A 4IR3A 5IGLA 5FH6A 4A9EA 4Z6IA 3AADA 5IGKA 3HMEA 5EWDA 3O33A 4YYIA 5FE1A 5L8TA 5E3GA 5F61A 2FSAA 3RCWA 4LZSA 4UYFB 3D1DA 2DWWA 4WHWA 5BT3A 5CS8A 4TU4A 3JVMA 2RS9B 4QZSA 5H1VA 5CU8A 5BT4A 5KO4A 2E7NA 2F6NA 4BHWA 4IR6A 5TB6A 4HXMA 4O7BA 4UIYA 4TT6A 4O72A 4F3IA 3S91A 2R10A 5EI4A 4A9FA 4CLBA 5DKCA 5DYXA 5FG6A 5JI8A 5CY9A 4MR6A 4NR6A 4UIVA 5HELA 5H85A 4PCIA 5CTLA 5A85A 4YYNA 4O77A 5K29A 2LSPB 4PTBA 5A5QA 4Y03A 5DBMA 5ETBA
chains in the Genus database with same CATH topology
2E7OA 5DYAA 4UITA 4A9KA 5E74A 1X0JA 3UVWA 5II1A 3UV2A 3U5JA 3U5OA 5A5PA 4RVRA 5C4QA 5ENIA 4YYMA 5DY7A 4UIWA 5HCLA 2L85A 5LVRA 4MEQA 5EU1A 4NQMA 3MUKA 3SVFA 5F1LA 5I83A 5FG4A 3JVKA 4QB3A 4HBXA 5IGNA 4AKNA 4Z93A 5ETDA 4DONA 5AMEA 5FG5A 4NUDA 1EQFA 4HXLA 4LZRA 4HBVA 5HRXA 2DATA 4CFLA 3QZVA 5E0RA 4YYJA 4YYDA 4BJXA 4Q0NA 4N3WA 4HXRA 4O70A 4WIVA 4HBWA 4N4HA 4QSUA 4UYGA 5L98A 4LYSA 4QY4A 4PY6A 3LQHA 5E9VA 4NYXA 5DFDA 5HJCA 3NXBA 5E9LA 5G4SA 4CUTA 2YYNA 2MJVB 3U5NA 5E9KA 5G4RA 3QZTA 3UVDA 5FE2A 4NRCA 5A82A 1WUGA 5HQ6A 5EWVA 3U5PA 3U5KA 3UVXA 4YBTA 5L97A 3Q2EA 5D3NA 5CFWA 4MENA 4FLPA 4QR5A 4PCEA 4YBSA 3P1DA 5CP5A 3DAIA 4QR3A 1JSPB 2NXBA 5F5ZA 5FE6A 5IBNA 5DLXA 4QBMA 4A9JA 5D3HA 4QSPA 4TT2A 5LJ1A 3P1EA 4BW2A 5D3PA 5D3SA 5CQ5A 2DVRA 5EICA 4LYIA 2E3KA 4QC3A 3G0LA 5EGUA 4HXKA 4O7FA 2GRCA 4QSTA 4O71A 4TTEA 5EA1A 4YYGA 5HM0A 5I29A 5LKZA 5CZGA 3LJWA 5CQ3A 5HENA 4HXOA 5D26A 4CUQA 5CGPA 4MEPA 3UV4A 5A7CA 5CUBA 2YDWA 5DLZA 4QSSA 5FE9A 5CUGA 5I80A 4TZ8A 2R0VA 5CQ4A 5CUEA 5LJ2A 3P5OA 5L99A 4CUUA 5AD3A 5C85A 5DYCA 4A9OA 2YELA 5CPEA 5HQ7A 4QUTA 5H1TA 5DW2A 4HBYA 4YBMA 5I40A 4NRAA 4QSQA 4TS8A 5LKUA 3AQAA 5ACYA 4NS5A 4ZW1A 5DW1A 4J3IA 1ZS5A 5E9IA 3DWYA 1N72A 2RO1A 4KV1A 5IIDA 5FE5A 4Z1SA 2RFJA 5A5NA 4NRBA 3O37A 4ZQLA 5EWCA 3S92A 5H1UA 3P1CA 5DX4A 5CRMA 4OUFA 2RNYA 2RNXA 4NR9A 5FFVA 5CRZA 4TZ2A 4LYWA 5L96A 4LZ2A 5KTUA 4YABA 5DFBA 5E9YA 4XY8A 3SVHA 4ZC9A 5CUDA 5F25A 4QEVA 4YYHA 4IR5A 4O7AA 3G0JA 4J0RA 4YADA 5HRWA 4YY6A 4OGIA 2L5EA 4BW4A 5FBXA 2R0YA 5EQ1A 5FB0A 4C67A 3IU6A 5CQAA 4NR7A 5CQ6A 3K2JA 5FFWA 5D3JA 5ENBA 5FE3A 5EISA 2OUOA 4CUPA 1JM4B 3MQMA 4NXJA 4HXPA 5ENEA 5DFCA 5CQ8A 4O78A 5D3RA 5FB1A 4C66A 5FDZA 4NR8A 3MB4A 4UYDA 5ENCA 3U5MA 5A81A 4NUCA 4Q0OA 4IOQA 4Z1QA 2WP2A 5AMFA 2WP1A 5ENJA 4O74A 1F68A 5A5SA 5AD2A 4A9IA 5EV9A 3UVYA 5I7XA 5A83A 2RNWA 5D3LA 4IOOA 2YW5A 5KTXA 4O7CA 4XYAA 4YAXA 5EPBA 4YK0A 4CFKA 4X2IA 4J1PA 4QSXA 4A9HA 4LR6A 4CL9A 5J0DA 5JWMA 1WUMA 5F1HA 5COIA 4TU6A 4A9LA 3QZSA 5EK9A 4HXSA 5A5OA 4PS5A 5F36A 5I89A 4GPJA 5I86A 5EWWA 4J0SA 4QC1A 4UYHA 3MULA 4NR4A 3JVLA 2RI7A 5C89A 4YC9A 4MEOA 5D7XA 4LDFA 4IR4A 5E3DA 4QSRA 4QR4A 4KV4A 4UYFA 3O34A 5ENHA 3MXFA 4ALGA 4NYWA 5F3AA 5F63A 5C8GA 4BW3A 4YH4A 3UV5A 2DVVA 5CUCA 5F62A 5E7DA 5EPSA 3LQJA 5LVQA 5EWHA 3MB3A 3ZYUA 5D3TA 2L84A 4NQNA 4O7EA 4LC2A 4Z6HA 4MR5A 5FE4A 5A5RA 4QSWA 5C87A 5F60A 5FE8A 2I7KA 5LJ0A 4WHUA 5F2PA 4BW1A 3Q2FA 2YQDA 4QYLA 5II2A 5ENGA 4MR4A 4UIZA 5HFQA 5BT5A 4QNSA 4YATA 1E6IA 3IU5A 2H60A 5CQ7A 5D0CA 5LKXA 2I8NA 5HQ5A 4O75A 3SVGA 4UYEA 4QEWA 3LXJA 4LRGA 4ALHA 4E96A 5HRVA 2N9GA 5DYUA 4TT4A 2R0SA 5IGMA 5KTWA 2OSSA 2DVSA 5I7YA 5EM3A 3FKMX 4A9NA 5TCMA 3HMFA 2DKWA 4CURA 4HXNA 4XY9A 4NYVA 5C7NA 2G4AA 5HFRA 3TLPA 3I3JA 5I1QA 4PKLA 3O36A 2F6JA 4XUAA 4NR5A 4O76A 5CQTA 4QEUA 5EP7A 4CUSA 5E73A 4OGJA 3P1FA 3LQIA 5KU3A 4IORA 3HMHA 4YY4A 5LUUA 2D9EA 3O35A 3U5LA 5EVAA 5FE0A 4XUBA 5FH7A 5LKTA 5E9MA 5KHMA 4N4IA 5HEMA 4TYLA 5D24A 5FE7A 3GG3A 4A9MA 2YEKA 4MR3A 4QUUA 5IG6A 4NUEA 2KTBB 5D25A 5FFYA 3UW9A 2DVQA 2D82A 5DKHA 4N4FA 4YYKA 3JVJA 4N4GA 4UIUA 5L8UA 5CUAA 4KCXA 4QSVA 5ENFA 4TQNA 5HLSA 2YEMA 4QYDA 4UIXA 5EPRA 5FH8A 3D7CA 5DKDA 2OO1A 3ONIA 5I88A 4YH3A 4IR3A 5IGLA 5FH6A 4A9EA 4Z6IA 3AADA 5IGKA 3HMEA 5EWDA 3O33A 4YYIA 5FE1A 5L8TA 5E3GA 5F61A 2FSAA 3RCWA 4LZSA 4UYFB 4WHWA 2DWWA 5BT3A 5CS8A 4TU4A 3JVMA 2RS9B 4QZSA 5H1VA 5CU8A 5BT4A 5KO4A 2E7NA 2F6NA 4BHWA 4IR6A 5TB6A 4HXMA 4O7BA 4UIYA 4TT6A 4O72A 4F3IA 3S91A 2R10A 5EI4A 4A9FA 4CLBA 5DKCA 5DYXA 5FG6A 5JI8A 5CY9A 4MR6A 4NR6A 4UIVA 5HELA 5H85A 4PCIA 5CTLA 5A85A 4YYNA 4O77A 5K29A 2LSPB 4PTBA 5A5QA 4Y03A 5DBMA 5ETBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E7O A;  5DYA A;  4UIT A;  4A9K A;  5E74 A;  1X0J A;  3UVW A;  5II1 A;  3UV2 A;  3U5J A;  3U5O A;  5A5P A;  4RVR A;  5C4Q A;  5ENI A;  4YYM A;  5DY7 A;  4UIW A;  5HCL A;  2L85 A;  5LVR A;  4MEQ A;  5EU1 A;  4NQM A;  3MUK A;  3SVF A;  5F1L A;  5I83 A;  5FG4 A;  3JVK A;  4QB3 A;  4HBX A;  5IGN A;  4AKN A;  4Z93 A;  5ETD A;  4DON A;  5AME A;  5FG5 A;  4NUD A;  1EQF A;  4HXL A;  4LZR A;  4HBV A;  5HRX A;  2DAT A;  4CFL A;  3QZV A;  5E0R A;  4YYJ A;  4YYD A;  4BJX A;  4Q0N A;  4N3W A;  4HXR A;  4O70 A;  4WIV A;  4HBW A;  4N4H A;  4QSU A;  4UYG A;  5L98 A;  4LYS A;  4QY4 A;  4PY6 A;  3LQH A;  5E9V A;  4NYX A;  5DFD A;  5HJC A;  3NXB A;  5E9L A;  5G4S A;  4CUT A;  2YYN A;  2MJV B;  3U5N A;  5E9K A;  5G4R A;  3QZT A;  3UVD A;  5FE2 A;  4NRC A;  5A82 A;  1WUG A;  5HQ6 A;  5EWV A;  3U5P A;  3U5K A;  3UVX A;  4YBT A;  5L97 A;  3Q2E A;  5D3N A;  5CFW A;  4MEN A;  4FLP A;  4QR5 A;  4PCE A;  4YBS A;  3P1D A;  5CP5 A;  3DAI A;  4QR3 A;  1JSP B;  2NXB A;  5F5Z A;  5FE6 A;  5IBN A;  5DLX A;  4QBM A;  4A9J A;  5D3H A;  4QSP A;  4TT2 A;  5LJ1 A;  3P1E A;  4BW2 A;  5D3P A;  5D3S A;  5CQ5 A;  2DVR A;  5EIC A;  4LYI A;  2E3K A;  4QC3 A;  3G0L A;  5EGU A;  4HXK A;  4O7F A;  2GRC A;  4QST A;  4O71 A;  4TTE A;  5EA1 A;  4YYG A;  5HM0 A;  5I29 A;  5LKZ A;  5CZG A;  3LJW A;  5CQ3 A;  5HEN A;  4HXO A;  5D26 A;  4CUQ A;  5CGP A;  4MEP A;  3UV4 A;  5A7C A;  5CUB A;  2YDW A;  5DLZ A;  4QSS A;  5FE9 A;  5CUG A;  5I80 A;  4TZ8 A;  2R0V A;  5CQ4 A;  5CUE A;  5LJ2 A;  3P5O A;  5L99 A;  4CUU A;  5AD3 A;  5C85 A;  5DYC A;  4A9O A;  2YEL A;  5CPE A;  5HQ7 A;  4QUT A;  5H1T A;  5DW2 A;  4HBY A;  4YBM A;  5I40 A;  4NRA A;  4QSQ A;  4TS8 A;  5LKU A;  3AQA A;  5ACY A;  4NS5 A;  4ZW1 A;  5DW1 A;  4J3I A;  1ZS5 A;  5E9I A;  3DWY A;  1N72 A;  2RO1 A;  4KV1 A;  5IID A;  5FE5 A;  4Z1S A;  2RFJ A;  5A5N A;  4NRB A;  3O37 A;  4ZQL A;  5EWC A;  3S92 A;  5H1U A;  3P1C A;  5DX4 A;  5CRM A;  4OUF A;  2RNY A;  2RNX A;  4NR9 A;  5FFV A;  5CRZ A;  4TZ2 A;  4LYW A;  5L96 A;  4LZ2 A;  5KTU A;  4YAB A;  5DFB A;  5E9Y A;  4XY8 A;  3SVH A;  4ZC9 A;  5CUD A;  5F25 A;  4QEV A;  4YYH A;  4IR5 A;  4O7A A;  3G0J A;  4J0R A;  4YAD A;  5HRW A;  4YY6 A;  4OGI A;  2L5E A;  4BW4 A;  5FBX A;  2R0Y A;  5EQ1 A;  5FB0 A;  4C67 A;  3IU6 A;  5CQA A;  4NR7 A;  5CQ6 A;  3K2J A;  5FFW A;  5D3J A;  5ENB A;  5FE3 A;  5EIS A;  2OUO A;  4CUP A;  1JM4 B;  3MQM A;  4NXJ A;  4HXP A;  5ENE A;  5DFC A;  5CQ8 A;  4O78 A;  5D3R A;  5FB1 A;  4C66 A;  5FDZ A;  4NR8 A;  3MB4 A;  4UYD A;  5ENC A;  3U5M A;  5A81 A;  4NUC A;  4Q0O A;  4IOQ A;  4Z1Q A;  2WP2 A;  5AMF A;  2WP1 A;  5ENJ A;  4O74 A;  1F68 A;  5A5S A;  5AD2 A;  4A9I A;  5EV9 A;  3UVY A;  5I7X A;  5A83 A;  2RNW A;  5D3L A;  4IOO A;  2YW5 A;  5KTX A;  4O7C A;  4XYA A;  4YAX A;  5EPB A;  4YK0 A;  4CFK A;  4X2I A;  4J1P A;  4QSX A;  4A9H A;  4LR6 A;  4CL9 A;  5J0D A;  5JWM A;  1WUM A;  5F1H A;  5COI A;  4TU6 A;  4A9L A;  3QZS A;  5EK9 A;  4HXS A;  5A5O A;  4PS5 A;  5F36 A;  5I89 A;  4GPJ A;  5I86 A;  5EWW A;  4J0S A;  4QC1 A;  4UYH A;  3MUL A;  4NR4 A;  3JVL A;  2RI7 A;  5C89 A;  4YC9 A;  4MEO A;  5D7X A;  4LDF A;  4IR4 A;  5E3D A;  4QSR A;  4QR4 A;  4KV4 A;  4UYF A;  3O34 A;  5ENH A;  3MXF A;  4ALG A;  4NYW A;  5F3A A;  5F63 A;  5C8G A;  4BW3 A;  4YH4 A;  3UV5 A;  2DVV A;  5CUC A;  5F62 A;  5E7D A;  5EPS A;  3LQJ A;  5LVQ A;  5EWH A;  3MB3 A;  3ZYU A;  5D3T A;  2L84 A;  4NQN A;  4O7E A;  4LC2 A;  4Z6H A;  4MR5 A;  5FE4 A;  5A5R A;  4QSW A;  5C87 A;  5F60 A;  5FE8 A;  2I7K A;  5LJ0 A;  4WHU A;  5F2P A;  4BW1 A;  3Q2F A;  2YQD A;  4QYL A;  5II2 A;  5ENG A;  4MR4 A;  4UIZ A;  5HFQ A;  5BT5 A;  4QNS A;  4YAT A;  1E6I A;  3IU5 A;  2H60 A;  5CQ7 A;  5D0C A;  5LKX A;  2I8N A;  5HQ5 A;  4O75 A;  3SVG A;  4UYE A;  4QEW A;  3LXJ A;  4LRG A;  4ALH A;  4E96 A;  5HRV A;  2N9G A;  5DYU A;  4TT4 A;  2R0S A;  5IGM A;  5KTW A;  2OSS A;  2DVS A;  5I7Y A;  5EM3 A;  3FKM X;  4A9N A;  5TCM A;  3HMF A;  2DKW A;  4CUR A;  4HXN A;  4XY9 A;  4NYV A;  5C7N A;  2G4A A;  5HFR A;  3TLP A;  3I3J A;  5I1Q A;  4PKL A;  3O36 A;  2F6J A;  4XUA A;  4NR5 A;  4O76 A;  5CQT A;  4QEU A;  5EP7 A;  4CUS A;  5E73 A;  4OGJ A;  3P1F A;  3LQI A;  5KU3 A;  4IOR A;  3HMH A;  4YY4 A;  5LUU A;  2D9E A;  3O35 A;  3U5L A;  5EVA A;  5FE0 A;  4XUB A;  5FH7 A;  5LKT A;  5E9M A;  5KHM A;  4N4I A;  5HEM A;  4TYL A;  5D24 A;  5FE7 A;  3GG3 A;  4A9M A;  2YEK A;  4MR3 A;  4QUU A;  5IG6 A;  4NUE A;  2KTB B;  5D25 A;  5FFY A;  3UW9 A;  2DVQ A;  2D82 A;  5DKH A;  4N4F A;  4YYK A;  3JVJ A;  4N4G A;  4UIU A;  5L8U A;  5CUA A;  4KCX A;  4QSV A;  5ENF A;  4TQN A;  5HLS A;  2YEM A;  4QYD A;  4UIX A;  5EPR A;  5FH8 A;  3D7C A;  5DKD A;  2OO1 A;  3ONI A;  5I88 A;  4YH3 A;  4IR3 A;  5IGL A;  5FH6 A;  4A9E A;  4Z6I A;  3AAD A;  5IGK A;  3HME A;  5EWD A;  3O33 A;  4YYI A;  5FE1 A;  5L8T A;  5E3G A;  5F61 A;  2FSA A;  3RCW A;  4LZS A;  4UYF B;  4WHW A;  2DWW A;  5BT3 A;  5CS8 A;  4TU4 A;  3JVM A;  2RS9 B;  4QZS A;  5H1V A;  5CU8 A;  5BT4 A;  5KO4 A;  2E7N A;  2F6N A;  4BHW A;  4IR6 A;  5TB6 A;  4HXM A;  4O7B A;  4UIY A;  4TT6 A;  4O72 A;  4F3I A;  3S91 A;  2R10 A;  5EI4 A;  4A9F A;  4CLB A;  5DKC A;  5DYX A;  5FG6 A;  5JI8 A;  5CY9 A;  4MR6 A;  4NR6 A;  4UIV A;  5HEL A;  5H85 A;  4PCI A;  5CTL A;  5A85 A;  4YYN A;  4O77 A;  5K29 A;  2LSP B;  4PTB A;  5A5Q A;  4Y03 A;  5DBM A;  5ETB A; 
#chains in the Genus database with same CATH topology
 2E7O A;  5DYA A;  4UIT A;  4A9K A;  5E74 A;  1X0J A;  3UVW A;  5II1 A;  3UV2 A;  3U5J A;  3U5O A;  5A5P A;  4RVR A;  5C4Q A;  5ENI A;  4YYM A;  4AI6 A;  5DY7 A;  4UIW A;  5HCL A;  2L85 A;  5LVR A;  4MEQ A;  5EU1 A;  4NQM A;  3MUK A;  3SVF A;  5F1L A;  5I83 A;  5FG4 A;  3JVK A;  4QB3 A;  4HBX A;  5IGN A;  4AKN A;  4Z93 A;  5ETD A;  4DON A;  5AME A;  5FG5 A;  4NUD A;  1EQF A;  4HXL A;  4LZR A;  4HBV A;  5HRX A;  2DAT A;  4CFL A;  3QZV A;  5E0R A;  4YYJ A;  4AKG A;  4YYD A;  4BJX A;  4Q0N A;  4N3W A;  4HXR A;  4O70 A;  4WIV A;  4HBW A;  4N4H A;  4QSU A;  4UYG A;  5L98 A;  4LYS A;  4QY4 A;  4PY6 A;  3LQH A;  5E9V A;  4NYX A;  5DFD A;  5HJC A;  3NXB A;  5E9L A;  5G4S A;  4CUT A;  2YYN A;  2MJV B;  3U5N A;  5E9K A;  5G4R A;  3QZT A;  3UVD A;  5FE2 A;  4NRC A;  5A82 A;  1WUG A;  5HQ6 A;  5EWV A;  3U5P A;  3U5K A;  3UVX A;  4YBT A;  5L97 A;  3Q2E A;  5D3N A;  5CFW A;  4MEN A;  4FLP A;  4QR5 A;  4PCE A;  4YBS A;  3P1D A;  5CP5 A;  3DAI A;  4QR3 A;  1JSP B;  2NXB A;  5F5Z A;  5FE6 A;  5IBN A;  5DLX A;  4QBM A;  4A9J A;  5D3H A;  4QSP A;  4TT2 A;  5LJ1 A;  3P1E A;  4BW2 A;  5D3P A;  5D3S A;  5CQ5 A;  2DVR A;  5EIC A;  4LYI A;  2E3K A;  4QC3 A;  3G0L A;  5EGU A;  4HXK A;  4O7F A;  2GRC A;  4QST A;  4O71 A;  4TTE A;  5EA1 A;  4YYG A;  5HM0 A;  5I29 A;  5LKZ A;  5CZG A;  3LJW A;  5CQ3 A;  5HEN A;  4HXO A;  5D26 A;  4CUQ A;  5CGP A;  4MEP A;  3UV4 A;  5A7C A;  5CUB A;  2YDW A;  5DLZ A;  4QSS A;  5FE9 A;  1ZKR A;  5CUG A;  5I80 A;  4TZ8 A;  2R0V A;  5CQ4 A;  5CUE A;  5LJ2 A;  3P5O A;  5L99 A;  4CUU A;  5AD3 A;  5C85 A;  5DYC A;  4A9O A;  2YEL A;  5CPE A;  5HQ7 A;  4QUT A;  5H1T A;  5DW2 A;  4HBY A;  4YBM A;  5I40 A;  4NRA A;  4QSQ A;  4TS8 A;  5LKU A;  3AQA A;  5ACY A;  4NS5 A;  4ZW1 A;  5DW1 A;  4J3I A;  1ZS5 A;  5E9I A;  3DWY A;  1N72 A;  2RO1 A;  4KV1 A;  5IID A;  5FE5 A;  4Z1S A;  2RFJ A;  5A5N A;  4NRB A;  3O37 A;  4ZQL A;  5EWC A;  3S92 A;  5H1U A;  3P1C A;  5DX4 A;  4AKI A;  5CRM A;  4OUF A;  2RNY A;  2RNX A;  4NR9 A;  5FFV A;  5CRZ A;  4TZ2 A;  4LYW A;  5L96 A;  4LZ2 A;  5KTU A;  4YAB A;  5DFB A;  5E9Y A;  4XY8 A;  3SVH A;  4ZC9 A;  5CUD A;  5F25 A;  4QEV A;  4YYH A;  4IR5 A;  4O7A A;  3G0J A;  4J0R A;  4YAD A;  5HRW A;  4YY6 A;  4OGI A;  2L5E A;  4BW4 A;  5FBX A;  2R0Y A;  5EQ1 A;  5FB0 A;  4C67 A;  3IU6 A;  5CQA A;  4NR7 A;  5CQ6 A;  3K2J A;  5FFW A;  5D3J A;  5ENB A;  5FE3 A;  5EIS A;  2OUO A;  4CUP A;  1JM4 B;  3MQM A;  4NXJ A;  4HXP A;  5ENE A;  5DFC A;  5CQ8 A;  4O78 A;  5D3R A;  5FB1 A;  4C66 A;  5FDZ A;  4NR8 A;  3MB4 A;  3VKH A;  4UYD A;  5ENC A;  3U5M A;  5A81 A;  3ERR A;  4NUC A;  4Q0O A;  4IOQ A;  4Z1Q A;  2WP2 A;  5AMF A;  2WP1 A;  5ENJ A;  4O74 A;  1F68 A;  5A5S A;  5AD2 A;  4A9I A;  3VKG A;  5EV9 A;  3UVY A;  5I7X A;  5A83 A;  2RNW A;  5D3L A;  4IOO A;  2YW5 A;  5KTX A;  4O7C A;  4XYA A;  4YAX A;  5EPB A;  4YK0 A;  4CFK A;  4X2I A;  4J1P A;  4QSX A;  4A9H A;  4LR6 A;  4AKH A;  4CL9 A;  5J0D A;  5JWM A;  1WUM A;  5F1H A;  5COI A;  4TU6 A;  4A9L A;  3QZS A;  5EK9 A;  4HXS A;  5A5O A;  4PS5 A;  5F36 A;  5I89 A;  4GPJ A;  5I86 A;  5EWW A;  4J0S A;  4QC1 A;  4UYH A;  3MUL A;  4NR4 A;  3JVL A;  2RI7 A;  5C89 A;  4YC9 A;  4MEO A;  5D7X A;  4LDF A;  4IR4 A;  5E3D A;  4QSR A;  4QR4 A;  4KV4 A;  4UYF A;  3O34 A;  5ENH A;  3MXF A;  4ALG A;  4NYW A;  5F3A A;  5F63 A;  5C8G A;  4BW3 A;  4YH4 A;  3UV5 A;  2DVV A;  5CUC A;  5F62 A;  5E7D A;  5EPS A;  3LQJ A;  5LVQ A;  5EWH A;  3MB3 A;  3ZYU A;  5D3T A;  3D1B A;  2L84 A;  4NQN A;  4O7E A;  4LC2 A;  4Z6H A;  4MR5 A;  5FE4 A;  5A5R A;  4QSW A;  5C87 A;  5F60 A;  5FE8 A;  2I7K A;  5LJ0 A;  4WHU A;  5F2P A;  4BW1 A;  3Q2F A;  2YQD A;  4QYL A;  5II2 A;  5ENG A;  4MR4 A;  4UIZ A;  5HFQ A;  5BT5 A;  4QNS A;  4YAT A;  1E6I A;  3IU5 A;  2H60 A;  5CQ7 A;  5D0C A;  5LKX A;  2I8N A;  5HQ5 A;  4O75 A;  3SVG A;  4UYE A;  4QEW A;  3LXJ A;  4LRG A;  4ALH A;  4E96 A;  5HRV A;  2N9G A;  5DYU A;  4TT4 A;  2R0S A;  5IGM A;  5KTW A;  2OSS A;  2DVS A;  5I7Y A;  5EM3 A;  3FKM X;  4A9N A;  5TCM A;  3HMF A;  2DKW A;  4CUR A;  4HXN A;  4XY9 A;  4NYV A;  5C7N A;  2G4A A;  5HFR A;  3TLP A;  3I3J A;  5I1Q A;  4PKL A;  3O36 A;  2F6J A;  4XUA A;  4NR5 A;  4O76 A;  5CQT A;  4QEU A;  5EP7 A;  4CUS A;  5E73 A;  4OGJ A;  3P1F A;  3LQI A;  5KU3 A;  4IOR A;  3HMH A;  4YY4 A;  5LUU A;  2D9E A;  3O35 A;  3U5L A;  5EVA A;  5FE0 A;  4XUB A;  5FH7 A;  5LKT A;  5E9M A;  5KHM A;  4N4I A;  5HEM A;  4TYL A;  5D24 A;  5FE7 A;  3GG3 A;  4A9M A;  2YEK A;  4MR3 A;  4QUU A;  5IG6 A;  4NUE A;  2KTB B;  5D25 A;  5FFY A;  3UW9 A;  2DVQ A;  2D82 A;  2EJN A;  5DKH A;  4N4F A;  4YYK A;  3JVJ A;  4N4G A;  4UIU A;  5L8U A;  5CUA A;  4KCX A;  4QSV A;  5ENF A;  4TQN A;  5HLS A;  2YEM A;  4QYD A;  1PUO A;  4UIX A;  5EPR A;  5FH8 A;  3D7C A;  5DKD A;  2OO1 A;  3ONI A;  5I88 A;  4YH3 A;  4IR3 A;  5IGL A;  5FH6 A;  4A9E A;  4Z6I A;  3AAD A;  5IGK A;  3HME A;  5EWD A;  3O33 A;  4YYI A;  5FE1 A;  5L8T A;  5E3G A;  5F61 A;  2FSA A;  3RCW A;  4LZS A;  4UYF B;  3D1D A;  2DWW A;  4WHW A;  5BT3 A;  5CS8 A;  4TU4 A;  3JVM A;  2RS9 B;  4QZS A;  5H1V A;  5CU8 A;  5BT4 A;  5KO4 A;  2E7N A;  2F6N A;  4BHW A;  4IR6 A;  5TB6 A;  4HXM A;  4O7B A;  4UIY A;  4TT6 A;  4O72 A;  4F3I A;  3S91 A;  2R10 A;  5EI4 A;  4A9F A;  4CLB A;  5DKC A;  5DYX A;  5FG6 A;  5JI8 A;  5CY9 A;  4MR6 A;  4NR6 A;  4UIV A;  5HEL A;  5H85 A;  4PCI A;  5CTL A;  5A85 A;  4YYN A;  4O77 A;  5K29 A;  2LSP B;  4PTB A;  5A5Q A;  4Y03 A;  5DBM A;  5ETB A; 
#chains in the Genus database with same CATH homology
 2E7O A;  5DYA A;  4UIT A;  4A9K A;  5E74 A;  1X0J A;  3UVW A;  5II1 A;  3UV2 A;  3U5J A;  3U5O A;  5A5P A;  4RVR A;  5C4Q A;  5ENI A;  4YYM A;  5DY7 A;  4UIW A;  5HCL A;  2L85 A;  5LVR A;  4MEQ A;  5EU1 A;  4NQM A;  3MUK A;  3SVF A;  5F1L A;  5I83 A;  5FG4 A;  3JVK A;  4QB3 A;  4HBX A;  5IGN A;  4AKN A;  4Z93 A;  5ETD A;  4DON A;  5AME A;  5FG5 A;  4NUD A;  1EQF A;  4HXL A;  4LZR A;  4HBV A;  5HRX A;  2DAT A;  4CFL A;  3QZV A;  5E0R A;  4YYJ A;  4YYD A;  4BJX A;  4Q0N A;  4N3W A;  4HXR A;  4O70 A;  4WIV A;  4HBW A;  4N4H A;  4QSU A;  4UYG A;  5L98 A;  4LYS A;  4QY4 A;  4PY6 A;  3LQH A;  5E9V A;  4NYX A;  5DFD A;  5HJC A;  3NXB A;  5E9L A;  5G4S A;  4CUT A;  2YYN A;  2MJV B;  3U5N A;  5E9K A;  5G4R A;  3QZT A;  3UVD A;  5FE2 A;  4NRC A;  5A82 A;  1WUG A;  5HQ6 A;  5EWV A;  3U5P A;  3U5K A;  3UVX A;  4YBT A;  5L97 A;  3Q2E A;  5D3N A;  5CFW A;  4MEN A;  4FLP A;  4QR5 A;  4PCE A;  4YBS A;  3P1D A;  5CP5 A;  3DAI A;  4QR3 A;  1JSP B;  2NXB A;  5F5Z A;  5FE6 A;  5IBN A;  5DLX A;  4QBM A;  4A9J A;  5D3H A;  4QSP A;  4TT2 A;  5LJ1 A;  3P1E A;  4BW2 A;  5D3P A;  5D3S A;  5CQ5 A;  2DVR A;  5EIC A;  4LYI A;  2E3K A;  4QC3 A;  3G0L A;  5EGU A;  4HXK A;  4O7F A;  2GRC A;  4QST A;  4O71 A;  4TTE A;  5EA1 A;  4YYG A;  5HM0 A;  5I29 A;  5LKZ A;  5CZG A;  3LJW A;  5CQ3 A;  5HEN A;  4HXO A;  5D26 A;  4CUQ A;  5CGP A;  4MEP A;  3UV4 A;  5A7C A;  5CUB A;  2YDW A;  5DLZ A;  4QSS A;  5FE9 A;  5CUG A;  5I80 A;  4TZ8 A;  2R0V A;  5CQ4 A;  5CUE A;  5LJ2 A;  3P5O A;  5L99 A;  4CUU A;  5AD3 A;  5C85 A;  5DYC A;  4A9O A;  2YEL A;  5CPE A;  5HQ7 A;  4QUT A;  5H1T A;  5DW2 A;  4HBY A;  4YBM A;  5I40 A;  4NRA A;  4QSQ A;  4TS8 A;  5LKU A;  3AQA A;  5ACY A;  4NS5 A;  4ZW1 A;  5DW1 A;  4J3I A;  1ZS5 A;  5E9I A;  3DWY A;  1N72 A;  2RO1 A;  4KV1 A;  5IID A;  5FE5 A;  4Z1S A;  2RFJ A;  5A5N A;  4NRB A;  3O37 A;  4ZQL A;  5EWC A;  3S92 A;  5H1U A;  3P1C A;  5DX4 A;  5CRM A;  4OUF A;  2RNY A;  2RNX A;  4NR9 A;  5FFV A;  5CRZ A;  4TZ2 A;  4LYW A;  5L96 A;  4LZ2 A;  5KTU A;  4YAB A;  5DFB A;  5E9Y A;  4XY8 A;  3SVH A;  4ZC9 A;  5CUD A;  5F25 A;  4QEV A;  4YYH A;  4IR5 A;  4O7A A;  3G0J A;  4J0R A;  4YAD A;  5HRW A;  4YY6 A;  4OGI A;  2L5E A;  4BW4 A;  5FBX A;  2R0Y A;  5EQ1 A;  5FB0 A;  4C67 A;  3IU6 A;  5CQA A;  4NR7 A;  5CQ6 A;  3K2J A;  5FFW A;  5D3J A;  5ENB A;  5FE3 A;  5EIS A;  2OUO A;  4CUP A;  1JM4 B;  3MQM A;  4NXJ A;  4HXP A;  5ENE A;  5DFC A;  5CQ8 A;  4O78 A;  5D3R A;  5FB1 A;  4C66 A;  5FDZ A;  4NR8 A;  3MB4 A;  4UYD A;  5ENC A;  3U5M A;  5A81 A;  4NUC A;  4Q0O A;  4IOQ A;  4Z1Q A;  2WP2 A;  5AMF A;  2WP1 A;  5ENJ A;  4O74 A;  1F68 A;  5A5S A;  5AD2 A;  4A9I A;  5EV9 A;  3UVY A;  5I7X A;  5A83 A;  2RNW A;  5D3L A;  4IOO A;  2YW5 A;  5KTX A;  4O7C A;  4XYA A;  4YAX A;  5EPB A;  4YK0 A;  4CFK A;  4X2I A;  4J1P A;  4QSX A;  4A9H A;  4LR6 A;  4CL9 A;  5J0D A;  5JWM A;  1WUM A;  5F1H A;  5COI A;  4TU6 A;  4A9L A;  3QZS A;  5EK9 A;  4HXS A;  5A5O A;  4PS5 A;  5F36 A;  5I89 A;  4GPJ A;  5I86 A;  5EWW A;  4J0S A;  4QC1 A;  4UYH A;  3MUL A;  4NR4 A;  3JVL A;  2RI7 A;  5C89 A;  4YC9 A;  4MEO A;  5D7X A;  4LDF A;  4IR4 A;  5E3D A;  4QSR A;  4QR4 A;  4KV4 A;  4UYF A;  3O34 A;  5ENH A;  3MXF A;  4ALG A;  4NYW A;  5F3A A;  5F63 A;  5C8G A;  4BW3 A;  4YH4 A;  3UV5 A;  2DVV A;  5CUC A;  5F62 A;  5E7D A;  5EPS A;  3LQJ A;  5LVQ A;  5EWH A;  3MB3 A;  3ZYU A;  5D3T A;  2L84 A;  4NQN A;  4O7E A;  4LC2 A;  4Z6H A;  4MR5 A;  5FE4 A;  5A5R A;  4QSW A;  5C87 A;  5F60 A;  5FE8 A;  2I7K A;  5LJ0 A;  4WHU A;  5F2P A;  4BW1 A;  3Q2F A;  2YQD A;  4QYL A;  5II2 A;  5ENG A;  4MR4 A;  4UIZ A;  5HFQ A;  5BT5 A;  4QNS A;  4YAT A;  1E6I A;  3IU5 A;  2H60 A;  5CQ7 A;  5D0C A;  5LKX A;  2I8N A;  5HQ5 A;  4O75 A;  3SVG A;  4UYE A;  4QEW A;  3LXJ A;  4LRG A;  4ALH A;  4E96 A;  5HRV A;  2N9G A;  5DYU A;  4TT4 A;  2R0S A;  5IGM A;  5KTW A;  2OSS A;  2DVS A;  5I7Y A;  5EM3 A;  3FKM X;  4A9N A;  5TCM A;  3HMF A;  2DKW A;  4CUR A;  4HXN A;  4XY9 A;  4NYV A;  5C7N A;  2G4A A;  5HFR A;  3TLP A;  3I3J A;  5I1Q A;  4PKL A;  3O36 A;  2F6J A;  4XUA A;  4NR5 A;  4O76 A;  5CQT A;  4QEU A;  5EP7 A;  4CUS A;  5E73 A;  4OGJ A;  3P1F A;  3LQI A;  5KU3 A;  4IOR A;  3HMH A;  4YY4 A;  5LUU A;  2D9E A;  3O35 A;  3U5L A;  5EVA A;  5FE0 A;  4XUB A;  5FH7 A;  5LKT A;  5E9M A;  5KHM A;  4N4I A;  5HEM A;  4TYL A;  5D24 A;  5FE7 A;  3GG3 A;  4A9M A;  2YEK A;  4MR3 A;  4QUU A;  5IG6 A;  4NUE A;  2KTB B;  5D25 A;  5FFY A;  3UW9 A;  2DVQ A;  2D82 A;  5DKH A;  4N4F A;  4YYK A;  3JVJ A;  4N4G A;  4UIU A;  5L8U A;  5CUA A;  4KCX A;  4QSV A;  5ENF A;  4TQN A;  5HLS A;  2YEM A;  4QYD A;  4UIX A;  5EPR A;  5FH8 A;  3D7C A;  5DKD A;  2OO1 A;  3ONI A;  5I88 A;  4YH3 A;  4IR3 A;  5IGL A;  5FH6 A;  4A9E A;  4Z6I A;  3AAD A;  5IGK A;  3HME A;  5EWD A;  3O33 A;  4YYI A;  5FE1 A;  5L8T A;  5E3G A;  5F61 A;  2FSA A;  3RCW A;  4LZS A;  4UYF B;  4WHW A;  2DWW A;  5BT3 A;  5CS8 A;  4TU4 A;  3JVM A;  2RS9 B;  4QZS A;  5H1V A;  5CU8 A;  5BT4 A;  5KO4 A;  2E7N A;  2F6N A;  4BHW A;  4IR6 A;  5TB6 A;  4HXM A;  4O7B A;  4UIY A;  4TT6 A;  4O72 A;  4F3I A;  3S91 A;  2R10 A;  5EI4 A;  4A9F A;  4CLB A;  5DKC A;  5DYX A;  5FG6 A;  5JI8 A;  5CY9 A;  4MR6 A;  4NR6 A;  4UIV A;  5HEL A;  5H85 A;  4PCI A;  5CTL A;  5A85 A;  4YYN A;  4O77 A;  5K29 A;  2LSP B;  4PTB A;  5A5Q A;  4Y03 A;  5DBM A;  5ETB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...