4TS8A

Crystal structure of the bromodomain of human crebbp in complex with xz08
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
112
structure length
112
Chain Sequence
FKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CREB-binding protein
publication title Crystal structure of the bromodomain of human CREBBP in complex with XZ08
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 42
structure length 112
sequence length 112
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2014-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4ts8A00
3UV2A 4O71A 4UYFB 5CUCA 5FFYA 5IBNA 4TQNA 4YYHA 4Z1QA 5FE6A 3O33A 5E0RA 4BW3A 4O78A 4NS5A 5CQ6A 5F2PA 4Z6IA 5A81A 5CQ3A 4QSWA 5A83A 2DVVA 5FH6A 4IORA 4YYNA 3U5OA 5I40A 5FFVA 1WUMA 4QSRA 5E7DA 5LUUA 4KV1A 5LKZA 5I80A 5IIDA 5F3AA 4O7FA 3QZTA 4UIVA 3FKMX 5E9VA 2I7KA 4NR7A 4Q0NA 4QYDA 2RO1A 5DYXA 5LKUA 4CFLA 3S92A 2GRCA 4LRGA 4XUAA 5DLXA 3U5KA 5FG4A 4IR5A 5A82A 5HQ7A 2YW5A 4J0SA 5FH7A 5HFQA 5EGUA 5EPSA 5F62A 2H60A 5AMFA 4O7AA 1F68A 4CLBA 4YYJA 4Z6HA 2OO1A 4ZW1A 5HLSA 5EU1A 4OGIA 3QZVA 5D25A 4CUSA 4PS5A 4BJXA 5FE4A 3Q2FA 4NRBA 3LQIA 5IGLA 5HELA 5FDZA 5A5OA 4PKLA 3O34A 4Y03A 4QR5A 4C66A 5A5RA 2OUOA 5J0DA 5E9KA 5LVQA 5D3TA 4LC2A 2WP1A 2RNXA 4TTEA 5D7XA 4QC3A 4A9FA 3MQMA 5BT3A 5CS8A 5I7YA 3AADA 4UIZA 4QSQA 5DFDA 5I83A 4QEWA 5E3DA 5CRMA 4UIYA 3JVMA 4A9LA 4O77A 2MJVB 5FE8A 2E3KA 5ENHA 5L99A 2RFJA 3JVKA 4MEOA 5C87A 4ZQLA 5HEMA 3JVLA 4YY6A 4QR4A 5DW2A 4TS8A 4CFKA 4YYMA 5EA1A 3SVGA 3U5NA 4QSTA 4O76A 4XY8A 5E74A 2DVSA 4E96A 4YABA 5K29A 3IU6A 2DATA 4PCIA 4Z93A 4UIXA 4NRAA 4F3IA 3HMFA 5IGNA 2D82A 3MULA 4BHWA 5CUAA 5I7XA 4YYKA 5EISA 5CFWA 4KV4A 5CRZA 5DKCA 2OSSA 3O35A 3QZSA 5ENFA 5CQ8A 3LQHA 4A9KA 4NR4A 4MR6A 4WIVA 5CPEA 5FFWA 5HRVA 3HMEA 4BW4A 5EPBA 4YYGA 4HXOA 4NUEA 5F5ZA 5CTLA 5L96A 3ZYUA 5L8UA 5II1A 5FE5A 4IOOA 4QY4A 4HXRA 2FSAA 5I1QA 4QSPA 5CU8A 5DYCA 5D3RA 5F1HA 4PTBA 4XY9A 5ETDA 5AD2A 5EWHA 4X2IA 4TZ2A 4A9MA 5D0CA 3U5MA 5ENJA 5I88A 4IR4A 3UVDA 4TZ8A 3U5PA 5A5SA 5KTUA 4CL9A 5DYAA 2YDWA 5CQ7A 4YC9A 4YH4A 4A9OA 3DWYA 1JM4B 5TCMA 4N4HA 5ENGA 3SVHA 4OUFA 5D26A 5FE0A 3S91A 2F6NA 3D7CA 4RVRA 5D3HA 5FE3A 4TT4A 2F6JA 4J0RA 5CUGA 4YYDA 5EQ1A 3JVJA 5EP7A 4LYSA 5C89A 2RI7A 5CUEA 2R10A 5EPRA 4NR8A 2RNYA 5FBXA 5A5QA 5AD3A 4QB3A 4BW2A 5LJ1A 4CUUA 4MEPA 5KHMA 5ENEA 4N4FA 2L85A 3P1FA 4O7BA 4QSVA 5HQ6A 4HBXA 5EM3A 4O7CA 4J1PA 4LYIA 3GG3A 5ENCA 3UV4A 3O36A 3LJWA 5D3SA 3DAIA 4N4GA 3G0LA 5BT5A 3TLPA 4NUCA 5FB1A 5I29A 5G4SA 5C85A 5KTWA 5H1TA 5HCLA 4NR9A 4PY6A 4YBTA 5H85A 2WP2A 4LZRA 3UVXA 4YYIA 2KTBB 3UW9A 4YY4A 3P1CA 2YQDA 1E6IA 4Z1SA 4UIWA 4MEQA 5ACYA 4MR5A 5CY9A 4O70A 4NQNA 5JWMA 2RS9B 3RCWA 5A5PA 2RNWA 2L84A 4TYLA 4CUPA 2LSPB 4UYFA 4MR3A 4NUDA 4A9EA 5E73A 2R0VA 1WUGA 5E9YA 3MB3A 5IGKA 4WHWA 4LZSA 3UVYA 3NXBA 5CQ5A 4CUTA 4KCXA 4FLPA 5FE7A 4N4IA 4QYLA 2R0YA 5F60A 5KTXA 5D3NA 4TU6A 5DYUA 5FE1A 3O37A 4HBVA 4HXSA 5DKHA 5C8GA 4A9HA 4XYAA 5DBMA 4TT2A 5H1UA 4QEVA 4HXLA 4UYGA 4UYEA 5L97A 2E7OA 5I86A 5C4QA 5HRXA 3P5OA 5DY7A 4ALHA 3U5JA 1JSPB 4O7EA 5LKTA 5E9LA 4YK0A 4Q0OA 4QC1A 5D3JA 5EWDA 5FE2A 4O72A 3MXFA 4QSSA 3P1EA 5A7CA 5C7NA 4UIUA 4YBSA 5FH8A 4BW1A 5FE9A 5F61A 5LJ2A 5EWWA 4NQMA 3U5LA 5HFRA 2DWWA 3UVWA 5FB0A 2DVRA 2YEMA 5EI4A 5DFCA 4IOQA 4NYVA 5E9IA 5KU3A 4YATA 4AKNA 3LXJA 5F1LA 4LYWA 5AMEA 4A9IA 5BT4A 5LKXA 4DONA 2L5EA 4O75A 4NXJA 3K2JA 5A5NA 5EK9A 5TB6A 4MENA 2E7NA 5CUBA 3MUKA 4O74A 5E3GA 2D9EA 4TU4A 5F25A 5COIA 4UITA 4NYXA 2DKWA 4YAXA 5ETBA 2N9GA 3AQAA 5KO4A 5CQ4A 4OGJA 2I8NA 5DX4A 5CQAA 4CUQA 4QUTA 4QSUA 4IR6A 5DFBA 5H1VA 5D3LA 4QZSA 4UYDA 5DW1A 5A85A 4CURA 4LR6A 3ONIA 4GPJA 4HXMA 4J3IA 4QSXA 4XUBA 4YH3A 5ENBA 5IG6A 4NR5A 4IR3A 3MB4A 3G0JA 5LVRA 5D24A 5DLZA 5F36A 5D3PA 4HXKA 5LJ0A 5HENA 3LQJA 4N3WA 4QEUA 4A9NA 1ZS5A 4ALGA 5EV9A 4TT6A 2YYNA 2YELA 5L8TA 3UV5A 4HBWA 3P1DA 5IGMA 5CGPA 5CUDA 3I3JA 3Q2EA 5L98A 2YEKA 4C67A 5EVAA 5HQ5A 5II2A 4QR3A 5FG6A 4ZC9A 1X0JA 4WHUA 5FG5A 5JI8A 4LDFA 5G4RA 2DVQA 5HRWA 4QBMA 5E9MA 5I89A 5HM0A 4YADA 4HXNA 4HXPA 4YBMA 4MR4A 5EWCA 5EWVA 3HMHA 3IU5A 4QNSA 5F63A 2R0SA 4NR6A 4UYHA 4NRCA 2NXBA 5CQTA 4A9JA 5ENIA 5HJCA 5DKDA 1N72A 2G4AA 1EQFA 4HBYA 3SVFA 5CZGA 5EICA 4LZ2A 4NYWA 4QUUA 5CP5A 4PCEA
chains in the Genus database with same CATH superfamily
3UV2A 4O71A 4UYFB 5CUCA 5FFYA 5IBNA 4TQNA 4YYHA 4Z1QA 5FE6A 3O33A 5E0RA 4BW3A 4O78A 4NS5A 5CQ6A 5F2PA 4Z6IA 5A81A 5CQ3A 4QSWA 5A83A 2DVVA 5FH6A 4IORA 4YYNA 3U5OA 5I40A 5FFVA 1WUMA 4QSRA 5E7DA 5LUUA 4KV1A 5LKZA 5I80A 5IIDA 5F3AA 4O7FA 3QZTA 4UIVA 3FKMX 5E9VA 2I7KA 4NR7A 4Q0NA 4QYDA 2RO1A 5DYXA 5LKUA 4CFLA 3S92A 2GRCA 4LRGA 4XUAA 5DLXA 3U5KA 5FG4A 4IR5A 5A82A 5HQ7A 2YW5A 4J0SA 5FH7A 5HFQA 5EGUA 5EPSA 5F62A 2H60A 5AMFA 4O7AA 1F68A 4CLBA 4YYJA 4Z6HA 2OO1A 4ZW1A 5HLSA 5EU1A 4OGIA 3QZVA 5D25A 4CUSA 4PS5A 4BJXA 5FE4A 3Q2FA 4NRBA 3LQIA 5IGLA 5HELA 5FDZA 5A5OA 4PKLA 3O34A 4Y03A 4QR5A 4C66A 5A5RA 2OUOA 5J0DA 5E9KA 5LVQA 5D3TA 4LC2A 2WP1A 2RNXA 4TTEA 5D7XA 4QC3A 4A9FA 3MQMA 5BT3A 5CS8A 3VKHA 5I7YA 3AADA 4UIZA 4QSQA 5DFDA 5I83A 4QEWA 5E3DA 5CRMA 4UIYA 3JVMA 4A9LA 4O77A 2MJVB 5FE8A 2E3KA 5ENHA 5L99A 2RFJA 3JVKA 4MEOA 5C87A 4ZQLA 5HEMA 3JVLA 4YY6A 4QR4A 5DW2A 4TS8A 4CFKA 4YYMA 5EA1A 3SVGA 3U5NA 4QSTA 4O76A 4XY8A 5E74A 2DVSA 4E96A 4YABA 5K29A 3IU6A 2DATA 4PCIA 4Z93A 4UIXA 4NRAA 4F3IA 3HMFA 5IGNA 2D82A 3MULA 4BHWA 5CUAA 5I7XA 4YYKA 5EISA 3ERRA 5CFWA 4KV4A 1PUOA 5CRZA 5DKCA 2OSSA 3O35A 3QZSA 5ENFA 3D1BA 5CQ8A 3LQHA 4A9KA 4NR4A 4AKGA 4MR6A 4WIVA 5CPEA 5FFWA 5HRVA 3HMEA 4BW4A 5EPBA 4YYGA 4HXOA 4NUEA 5F5ZA 5CTLA 5L96A 3ZYUA 5L8UA 5II1A 5FE5A 4IOOA 4QY4A 4HXRA 2FSAA 5I1QA 4QSPA 5CU8A 5DYCA 4AKIA 5D3RA 5F1HA 4PTBA 4XY9A 5ETDA 5AD2A 5EWHA 4X2IA 4TZ2A 4A9MA 5D0CA 3U5MA 5ENJA 5I88A 4IR4A 3UVDA 4TZ8A 3U5PA 5A5SA 5KTUA 4CL9A 5DYAA 2YDWA 5CQ7A 4YC9A 4YH4A 2EJNA 4A9OA 3DWYA 1JM4B 5TCMA 4N4HA 5ENGA 3SVHA 4OUFA 5D26A 5FE0A 3S91A 2F6NA 3D7CA 4RVRA 5D3HA 5FE3A 4TT4A 2F6JA 4J0RA 5CUGA 4YYDA 5EQ1A 3JVJA 5EP7A 4LYSA 5C89A 2RI7A 5CUEA 2R10A 5EPRA 4NR8A 2RNYA 5FBXA 5A5QA 5AD3A 4QB3A 4BW2A 5LJ1A 4CUUA 4MEPA 5KHMA 5ENEA 4N4FA 2L85A 3P1FA 4O7BA 4QSVA 5HQ6A 4HBXA 5EM3A 4O7CA 4J1PA 4LYIA 3GG3A 5ENCA 3UV4A 3O36A 3LJWA 5D3SA 3DAIA 4N4GA 3G0LA 5BT5A 3TLPA 4NUCA 5FB1A 5I29A 5G4SA 5C85A 5KTWA 5H1TA 5HCLA 4NR9A 4PY6A 4YBTA 5H85A 2WP2A 4LZRA 3UVXA 4YYIA 2KTBB 4AI6A 3UW9A 4YY4A 3P1CA 2YQDA 1E6IA 4Z1SA 4UIWA 4MEQA 5ACYA 4MR5A 5CY9A 4O70A 4NQNA 5JWMA 2RS9B 3RCWA 5A5PA 2RNWA 2L84A 4TYLA 4CUPA 2LSPB 4UYFA 4MR3A 4NUDA 4A9EA 5E73A 2R0VA 1WUGA 5E9YA 3MB3A 5IGKA 4WHWA 4LZSA 3UVYA 3NXBA 5CQ5A 4CUTA 4KCXA 4FLPA 5FE7A 4N4IA 4QYLA 2R0YA 5F60A 5KTXA 5D3NA 4TU6A 5DYUA 5FE1A 3O37A 4HBVA 4HXSA 5DKHA 5C8GA 4A9HA 4XYAA 5DBMA 4TT2A 5H1UA 4QEVA 4HXLA 4UYGA 4UYEA 5L97A 2E7OA 5I86A 5C4QA 5HRXA 3P5OA 5DY7A 4ALHA 3U5JA 1JSPB 4O7EA 5LKTA 5E9LA 4YK0A 4Q0OA 4QC1A 5D3JA 5EWDA 5FE2A 4O72A 3MXFA 4QSSA 3P1EA 5A7CA 5C7NA 4UIUA 4YBSA 5FH8A 4BW1A 5FE9A 5F61A 5LJ2A 5EWWA 4NQMA 3U5LA 3VKGA 5HFRA 2DWWA 3UVWA 4AKHA 5FB0A 2DVRA 2YEMA 5EI4A 5DFCA 4IOQA 4NYVA 5E9IA 5KU3A 4YATA 4AKNA 3LXJA 5F1LA 4LYWA 5AMEA 4A9IA 5BT4A 5LKXA 4DONA 2L5EA 4O75A 4NXJA 3K2JA 5A5NA 5EK9A 5TB6A 4MENA 2E7NA 5CUBA 3MUKA 4O74A 5E3GA 2D9EA 4TU4A 5F25A 5COIA 4UITA 4NYXA 2DKWA 4YAXA 5ETBA 2N9GA 3AQAA 5KO4A 5CQ4A 4OGJA 2I8NA 5DX4A 5CQAA 4CUQA 4QUTA 4QSUA 4IR6A 5DFBA 5H1VA 5D3LA 4QZSA 4UYDA 5DW1A 5A85A 4CURA 4LR6A 3ONIA 4GPJA 4HXMA 4J3IA 4QSXA 4XUBA 4YH3A 5ENBA 5IG6A 4NR5A 4IR3A 3MB4A 3G0JA 5LVRA 5D24A 5DLZA 5F36A 5D3PA 4HXKA 5LJ0A 5HENA 3LQJA 4N3WA 4QEUA 4A9NA 1ZS5A 4ALGA 5EV9A 4TT6A 2YYNA 2YELA 5L8TA 3UV5A 4HBWA 3P1DA 5IGMA 5CGPA 5CUDA 3I3JA 3Q2EA 5L98A 2YEKA 4C67A 1ZKRA 5EVAA 5HQ5A 5II2A 4QR3A 5FG6A 4ZC9A 1X0JA 4WHUA 5FG5A 5JI8A 4LDFA 5G4RA 2DVQA 5HRWA 4QBMA 5E9MA 5I89A 5HM0A 4YADA 4HXNA 4HXPA 4YBMA 4MR4A 5EWCA 5EWVA 3HMHA 3IU5A 4QNSA 5F63A 2R0SA 4NR6A 4UYHA 4NRCA 3D1DA 2NXBA 5CQTA 4A9JA 5ENIA 5HJCA 5DKDA 1N72A 2G4AA 1EQFA 4HBYA 3SVFA 5CZGA 5EICA 4LZ2A 4NYWA 4QUUA 5CP5A 4PCEA
chains in the Genus database with same CATH topology
3UV2A 4O71A 4UYFB 5CUCA 5FFYA 5IBNA 4TQNA 4YYHA 4Z1QA 5FE6A 3O33A 5E0RA 4BW3A 4O78A 4NS5A 5CQ6A 5F2PA 4Z6IA 5A81A 5CQ3A 4QSWA 5A83A 2DVVA 5FH6A 4IORA 4YYNA 3U5OA 5I40A 5FFVA 1WUMA 4QSRA 5E7DA 5LUUA 4KV1A 5LKZA 5I80A 5IIDA 5F3AA 4O7FA 3QZTA 4UIVA 3FKMX 5E9VA 2I7KA 4NR7A 4Q0NA 4QYDA 2RO1A 5DYXA 5LKUA 4CFLA 3S92A 2GRCA 4LRGA 4XUAA 5DLXA 3U5KA 5FG4A 4IR5A 5A82A 5HQ7A 2YW5A 4J0SA 5FH7A 5HFQA 5EGUA 5EPSA 5F62A 2H60A 5AMFA 4O7AA 1F68A 4CLBA 4YYJA 4Z6HA 2OO1A 4ZW1A 5HLSA 5EU1A 4OGIA 3QZVA 5D25A 4CUSA 4PS5A 4BJXA 5FE4A 3Q2FA 4NRBA 3LQIA 5IGLA 5HELA 5FDZA 5A5OA 4PKLA 3O34A 4Y03A 4QR5A 4C66A 5A5RA 2OUOA 5J0DA 5E9KA 5LVQA 5D3TA 4LC2A 2WP1A 2RNXA 4TTEA 5D7XA 4QC3A 4A9FA 3MQMA 5BT3A 5CS8A 5I7YA 3AADA 4UIZA 4QSQA 5DFDA 5I83A 4QEWA 5E3DA 5CRMA 4UIYA 3JVMA 4A9LA 4O77A 2MJVB 5FE8A 2E3KA 5ENHA 5L99A 2RFJA 3JVKA 4MEOA 5C87A 4ZQLA 5HEMA 3JVLA 4YY6A 4QR4A 5DW2A 4TS8A 4CFKA 4YYMA 5EA1A 3SVGA 3U5NA 4QSTA 4O76A 4XY8A 5E74A 2DVSA 4E96A 4YABA 5K29A 3IU6A 2DATA 4PCIA 4Z93A 4UIXA 4NRAA 4F3IA 3HMFA 5IGNA 2D82A 3MULA 4BHWA 5CUAA 5I7XA 4YYKA 5EISA 5CFWA 4KV4A 5CRZA 5DKCA 2OSSA 3O35A 3QZSA 5ENFA 5CQ8A 3LQHA 4A9KA 4NR4A 4MR6A 4WIVA 5CPEA 5FFWA 5HRVA 3HMEA 4BW4A 5EPBA 4YYGA 4HXOA 4NUEA 5F5ZA 5CTLA 5L96A 3ZYUA 5L8UA 5II1A 5FE5A 4IOOA 4QY4A 4HXRA 2FSAA 5I1QA 4QSPA 5CU8A 5DYCA 5D3RA 5F1HA 4PTBA 4XY9A 5ETDA 5AD2A 5EWHA 4X2IA 4TZ2A 4A9MA 5D0CA 3U5MA 5ENJA 5I88A 4IR4A 3UVDA 4TZ8A 3U5PA 5A5SA 5KTUA 4CL9A 5DYAA 2YDWA 5CQ7A 4YC9A 4YH4A 4A9OA 3DWYA 1JM4B 5TCMA 4N4HA 5ENGA 3SVHA 4OUFA 5D26A 5FE0A 3S91A 2F6NA 3D7CA 4RVRA 5D3HA 5FE3A 4TT4A 2F6JA 4J0RA 5CUGA 4YYDA 5EQ1A 3JVJA 5EP7A 4LYSA 5C89A 2RI7A 5CUEA 2R10A 5EPRA 4NR8A 2RNYA 5FBXA 5A5QA 5AD3A 4QB3A 4BW2A 5LJ1A 4CUUA 4MEPA 5KHMA 5ENEA 4N4FA 2L85A 3P1FA 4O7BA 4QSVA 5HQ6A 4HBXA 5EM3A 4O7CA 4J1PA 4LYIA 3GG3A 5ENCA 3UV4A 3O36A 3LJWA 5D3SA 3DAIA 4N4GA 3G0LA 5BT5A 3TLPA 4NUCA 5FB1A 5I29A 5G4SA 5C85A 5KTWA 5H1TA 5HCLA 4NR9A 4PY6A 4YBTA 5H85A 2WP2A 4LZRA 3UVXA 4YYIA 2KTBB 3UW9A 4YY4A 3P1CA 2YQDA 1E6IA 4Z1SA 4UIWA 4MEQA 5ACYA 4MR5A 5CY9A 4O70A 4NQNA 5JWMA 2RS9B 3RCWA 5A5PA 2RNWA 2L84A 4TYLA 4CUPA 2LSPB 4UYFA 4MR3A 4NUDA 4A9EA 5E73A 2R0VA 1WUGA 5E9YA 3MB3A 5IGKA 4WHWA 4LZSA 3UVYA 3NXBA 5CQ5A 4CUTA 4KCXA 4FLPA 5FE7A 4N4IA 4QYLA 2R0YA 5F60A 5KTXA 5D3NA 4TU6A 5DYUA 5FE1A 3O37A 4HBVA 4HXSA 5DKHA 5C8GA 4A9HA 4XYAA 5DBMA 4TT2A 5H1UA 4QEVA 4HXLA 4UYGA 4UYEA 5L97A 2E7OA 5I86A 5C4QA 5HRXA 3P5OA 5DY7A 4ALHA 3U5JA 1JSPB 4O7EA 5LKTA 5E9LA 4YK0A 4Q0OA 4QC1A 5D3JA 5EWDA 5FE2A 4O72A 3MXFA 4QSSA 3P1EA 5A7CA 5C7NA 4UIUA 4YBSA 5FH8A 4BW1A 5FE9A 5F61A 5LJ2A 5EWWA 4NQMA 3U5LA 5HFRA 2DWWA 3UVWA 5FB0A 2DVRA 2YEMA 5EI4A 5DFCA 4IOQA 4NYVA 5E9IA 5KU3A 4YATA 4AKNA 3LXJA 5F1LA 4LYWA 5AMEA 4A9IA 5BT4A 5LKXA 4DONA 2L5EA 4O75A 4NXJA 3K2JA 5A5NA 5EK9A 5TB6A 4MENA 2E7NA 5CUBA 3MUKA 4O74A 5E3GA 2D9EA 4TU4A 5F25A 5COIA 4UITA 4NYXA 2DKWA 4YAXA 5ETBA 2N9GA 3AQAA 5KO4A 5CQ4A 4OGJA 2I8NA 5DX4A 5CQAA 4CUQA 4QUTA 4QSUA 4IR6A 5DFBA 5H1VA 5D3LA 4QZSA 4UYDA 5DW1A 5A85A 4CURA 4LR6A 3ONIA 4GPJA 4HXMA 4J3IA 4QSXA 4XUBA 4YH3A 5ENBA 5IG6A 4NR5A 4IR3A 3MB4A 3G0JA 5LVRA 5D24A 5DLZA 5F36A 5D3PA 4HXKA 5LJ0A 5HENA 3LQJA 4N3WA 4QEUA 4A9NA 1ZS5A 4ALGA 5EV9A 4TT6A 2YYNA 2YELA 5L8TA 3UV5A 4HBWA 3P1DA 5IGMA 5CGPA 5CUDA 3I3JA 3Q2EA 5L98A 2YEKA 4C67A 5EVAA 5HQ5A 5II2A 4QR3A 5FG6A 4ZC9A 1X0JA 4WHUA 5FG5A 5JI8A 4LDFA 5G4RA 2DVQA 5HRWA 4QBMA 5E9MA 5I89A 5HM0A 4YADA 4HXNA 4HXPA 4YBMA 4MR4A 5EWCA 5EWVA 3HMHA 3IU5A 4QNSA 5F63A 2R0SA 4NR6A 4UYHA 4NRCA 2NXBA 5CQTA 4A9JA 5ENIA 5HJCA 5DKDA 1N72A 2G4AA 1EQFA 4HBYA 3SVFA 5CZGA 5EICA 4LZ2A 4NYWA 4QUUA 5CP5A 4PCEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UV2 A;  4O71 A;  4UYF B;  5CUC A;  5FFY A;  5IBN A;  4TQN A;  4YYH A;  4Z1Q A;  5FE6 A;  3O33 A;  5E0R A;  4BW3 A;  4O78 A;  4NS5 A;  5CQ6 A;  5F2P A;  4Z6I A;  5A81 A;  5CQ3 A;  4QSW A;  5A83 A;  2DVV A;  5FH6 A;  4IOR A;  4YYN A;  3U5O A;  5I40 A;  5FFV A;  1WUM A;  4QSR A;  5E7D A;  5LUU A;  4KV1 A;  5LKZ A;  5I80 A;  5IID A;  5F3A A;  4O7F A;  3QZT A;  4UIV A;  3FKM X;  5E9V A;  2I7K A;  4NR7 A;  4Q0N A;  4QYD A;  2RO1 A;  5DYX A;  5LKU A;  4CFL A;  3S92 A;  2GRC A;  4LRG A;  4XUA A;  5DLX A;  3U5K A;  5FG4 A;  4IR5 A;  5A82 A;  5HQ7 A;  2YW5 A;  4J0S A;  5FH7 A;  5HFQ A;  5EGU A;  5EPS A;  5F62 A;  2H60 A;  5AMF A;  4O7A A;  1F68 A;  4CLB A;  4YYJ A;  4Z6H A;  2OO1 A;  4ZW1 A;  5HLS A;  5EU1 A;  4OGI A;  3QZV A;  5D25 A;  4CUS A;  4PS5 A;  4BJX A;  5FE4 A;  3Q2F A;  4NRB A;  3LQI A;  5IGL A;  5HEL A;  5FDZ A;  5A5O A;  4PKL A;  3O34 A;  4Y03 A;  4QR5 A;  4C66 A;  5A5R A;  2OUO A;  5J0D A;  5E9K A;  5LVQ A;  5D3T A;  4LC2 A;  2WP1 A;  2RNX A;  4TTE A;  5D7X A;  4QC3 A;  4A9F A;  3MQM A;  5BT3 A;  5CS8 A;  5I7Y A;  3AAD A;  4UIZ A;  4QSQ A;  5DFD A;  5I83 A;  4QEW A;  5E3D A;  5CRM A;  4UIY A;  3JVM A;  4A9L A;  4O77 A;  2MJV B;  5FE8 A;  2E3K A;  5ENH A;  5L99 A;  2RFJ A;  3JVK A;  4MEO A;  5C87 A;  4ZQL A;  5HEM A;  3JVL A;  4YY6 A;  4QR4 A;  5DW2 A;  4TS8 A;  4CFK A;  4YYM A;  5EA1 A;  3SVG A;  3U5N A;  4QST A;  4O76 A;  4XY8 A;  5E74 A;  2DVS A;  4E96 A;  4YAB A;  5K29 A;  3IU6 A;  2DAT A;  4PCI A;  4Z93 A;  4UIX A;  4NRA A;  4F3I A;  3HMF A;  5IGN A;  2D82 A;  3MUL A;  4BHW A;  5CUA A;  5I7X A;  4YYK A;  5EIS A;  5CFW A;  4KV4 A;  5CRZ A;  5DKC A;  2OSS A;  3O35 A;  3QZS A;  5ENF A;  5CQ8 A;  3LQH A;  4A9K A;  4NR4 A;  4MR6 A;  4WIV A;  5CPE A;  5FFW A;  5HRV A;  3HME A;  4BW4 A;  5EPB A;  4YYG A;  4HXO A;  4NUE A;  5F5Z A;  5CTL A;  5L96 A;  3ZYU A;  5L8U A;  5II1 A;  5FE5 A;  4IOO A;  4QY4 A;  4HXR A;  2FSA A;  5I1Q A;  4QSP A;  5CU8 A;  5DYC A;  5D3R A;  5F1H A;  4PTB A;  4XY9 A;  5ETD A;  5AD2 A;  5EWH A;  4X2I A;  4TZ2 A;  4A9M A;  5D0C A;  3U5M A;  5ENJ A;  5I88 A;  4IR4 A;  3UVD A;  4TZ8 A;  3U5P A;  5A5S A;  5KTU A;  4CL9 A;  5DYA A;  2YDW A;  5CQ7 A;  4YC9 A;  4YH4 A;  4A9O A;  3DWY A;  1JM4 B;  5TCM A;  4N4H A;  5ENG A;  3SVH A;  4OUF A;  5D26 A;  5FE0 A;  3S91 A;  2F6N A;  3D7C A;  4RVR A;  5D3H A;  5FE3 A;  4TT4 A;  2F6J A;  4J0R A;  5CUG A;  4YYD A;  5EQ1 A;  3JVJ A;  5EP7 A;  4LYS A;  5C89 A;  2RI7 A;  5CUE A;  2R10 A;  5EPR A;  4NR8 A;  2RNY A;  5FBX A;  5A5Q A;  5AD3 A;  4QB3 A;  4BW2 A;  5LJ1 A;  4CUU A;  4MEP A;  5KHM A;  5ENE A;  4N4F A;  2L85 A;  3P1F A;  4O7B A;  4QSV A;  5HQ6 A;  4HBX A;  5EM3 A;  4O7C A;  4J1P A;  4LYI A;  3GG3 A;  5ENC A;  3UV4 A;  3O36 A;  3LJW A;  5D3S A;  3DAI A;  4N4G A;  3G0L A;  5BT5 A;  3TLP A;  4NUC A;  5FB1 A;  5I29 A;  5G4S A;  5C85 A;  5KTW A;  5H1T A;  5HCL A;  4NR9 A;  4PY6 A;  4YBT A;  5H85 A;  2WP2 A;  4LZR A;  3UVX A;  4YYI A;  2KTB B;  3UW9 A;  4YY4 A;  3P1C A;  2YQD A;  1E6I A;  4Z1S A;  4UIW A;  4MEQ A;  5ACY A;  4MR5 A;  5CY9 A;  4O70 A;  4NQN A;  5JWM A;  2RS9 B;  3RCW A;  5A5P A;  2RNW A;  2L84 A;  4TYL A;  4CUP A;  2LSP B;  4UYF A;  4MR3 A;  4NUD A;  4A9E A;  5E73 A;  2R0V A;  1WUG A;  5E9Y A;  3MB3 A;  5IGK A;  4WHW A;  4LZS A;  3UVY A;  3NXB A;  5CQ5 A;  4CUT A;  4KCX A;  4FLP A;  5FE7 A;  4N4I A;  4QYL A;  2R0Y A;  5F60 A;  5KTX A;  5D3N A;  4TU6 A;  5DYU A;  5FE1 A;  3O37 A;  4HBV A;  4HXS A;  5DKH A;  5C8G A;  4A9H A;  4XYA A;  5DBM A;  4TT2 A;  5H1U A;  4QEV A;  4HXL A;  4UYG A;  4UYE A;  5L97 A;  2E7O A;  5I86 A;  5C4Q A;  5HRX A;  3P5O A;  5DY7 A;  4ALH A;  3U5J A;  1JSP B;  4O7E A;  5LKT A;  5E9L A;  4YK0 A;  4Q0O A;  4QC1 A;  5D3J A;  5EWD A;  5FE2 A;  4O72 A;  3MXF A;  4QSS A;  3P1E A;  5A7C A;  5C7N A;  4UIU A;  4YBS A;  5FH8 A;  4BW1 A;  5FE9 A;  5F61 A;  5LJ2 A;  5EWW A;  4NQM A;  3U5L A;  5HFR A;  2DWW A;  3UVW A;  5FB0 A;  2DVR A;  2YEM A;  5EI4 A;  5DFC A;  4IOQ A;  4NYV A;  5E9I A;  5KU3 A;  4YAT A;  4AKN A;  3LXJ A;  5F1L A;  4LYW A;  5AME A;  4A9I A;  5BT4 A;  5LKX A;  4DON A;  2L5E A;  4O75 A;  4NXJ A;  3K2J A;  5A5N A;  5EK9 A;  5TB6 A;  4MEN A;  2E7N A;  5CUB A;  3MUK A;  4O74 A;  5E3G A;  2D9E A;  4TU4 A;  5F25 A;  5COI A;  4UIT A;  4NYX A;  2DKW A;  4YAX A;  5ETB A;  2N9G A;  3AQA A;  5KO4 A;  5CQ4 A;  4OGJ A;  2I8N A;  5DX4 A;  5CQA A;  4CUQ A;  4QUT A;  4QSU A;  4IR6 A;  5DFB A;  5H1V A;  5D3L A;  4QZS A;  4UYD A;  5DW1 A;  5A85 A;  4CUR A;  4LR6 A;  3ONI A;  4GPJ A;  4HXM A;  4J3I A;  4QSX A;  4XUB A;  4YH3 A;  5ENB A;  5IG6 A;  4NR5 A;  4IR3 A;  3MB4 A;  3G0J A;  5LVR A;  5D24 A;  5DLZ A;  5F36 A;  5D3P A;  4HXK A;  5LJ0 A;  5HEN A;  3LQJ A;  4N3W A;  4QEU A;  4A9N A;  1ZS5 A;  4ALG A;  5EV9 A;  4TT6 A;  2YYN A;  2YEL A;  5L8T A;  3UV5 A;  4HBW A;  3P1D A;  5IGM A;  5CGP A;  5CUD A;  3I3J A;  3Q2E A;  5L98 A;  2YEK A;  4C67 A;  5EVA A;  5HQ5 A;  5II2 A;  4QR3 A;  5FG6 A;  4ZC9 A;  1X0J A;  4WHU A;  5FG5 A;  5JI8 A;  4LDF A;  5G4R A;  2DVQ A;  5HRW A;  4QBM A;  5E9M A;  5I89 A;  5HM0 A;  4YAD A;  4HXN A;  4HXP A;  4YBM A;  4MR4 A;  5EWC A;  5EWV A;  3HMH A;  3IU5 A;  4QNS A;  5F63 A;  2R0S A;  4NR6 A;  4UYH A;  4NRC A;  2NXB A;  5CQT A;  4A9J A;  5ENI A;  5HJC A;  5DKD A;  1N72 A;  2G4A A;  1EQF A;  4HBY A;  3SVF A;  5CZG A;  5EIC A;  4LZ2 A;  4NYW A;  4QUU A;  5CP5 A;  4PCE A; 
#chains in the Genus database with same CATH topology
 3UV2 A;  4O71 A;  4UYF B;  5CUC A;  5FFY A;  5IBN A;  4TQN A;  4YYH A;  4Z1Q A;  5FE6 A;  3O33 A;  5E0R A;  4BW3 A;  4O78 A;  4NS5 A;  5CQ6 A;  5F2P A;  4Z6I A;  5A81 A;  5CQ3 A;  4QSW A;  5A83 A;  2DVV A;  5FH6 A;  4IOR A;  4YYN A;  3U5O A;  5I40 A;  5FFV A;  1WUM A;  4QSR A;  5E7D A;  5LUU A;  4KV1 A;  5LKZ A;  5I80 A;  5IID A;  5F3A A;  4O7F A;  3QZT A;  4UIV A;  3FKM X;  5E9V A;  2I7K A;  4NR7 A;  4Q0N A;  4QYD A;  2RO1 A;  5DYX A;  5LKU A;  4CFL A;  3S92 A;  2GRC A;  4LRG A;  4XUA A;  5DLX A;  3U5K A;  5FG4 A;  4IR5 A;  5A82 A;  5HQ7 A;  2YW5 A;  4J0S A;  5FH7 A;  5HFQ A;  5EGU A;  5EPS A;  5F62 A;  2H60 A;  5AMF A;  4O7A A;  1F68 A;  4CLB A;  4YYJ A;  4Z6H A;  2OO1 A;  4ZW1 A;  5HLS A;  5EU1 A;  4OGI A;  3QZV A;  5D25 A;  4CUS A;  4PS5 A;  4BJX A;  5FE4 A;  3Q2F A;  4NRB A;  3LQI A;  5IGL A;  5HEL A;  5FDZ A;  5A5O A;  4PKL A;  3O34 A;  4Y03 A;  4QR5 A;  4C66 A;  5A5R A;  2OUO A;  5J0D A;  5E9K A;  5LVQ A;  5D3T A;  4LC2 A;  2WP1 A;  2RNX A;  4TTE A;  5D7X A;  4QC3 A;  4A9F A;  3MQM A;  5BT3 A;  5CS8 A;  3VKH A;  5I7Y A;  3AAD A;  4UIZ A;  4QSQ A;  5DFD A;  5I83 A;  4QEW A;  5E3D A;  5CRM A;  4UIY A;  3JVM A;  4A9L A;  4O77 A;  2MJV B;  5FE8 A;  2E3K A;  5ENH A;  5L99 A;  2RFJ A;  3JVK A;  4MEO A;  5C87 A;  4ZQL A;  5HEM A;  3JVL A;  4YY6 A;  4QR4 A;  5DW2 A;  4TS8 A;  4CFK A;  4YYM A;  5EA1 A;  3SVG A;  3U5N A;  4QST A;  4O76 A;  4XY8 A;  5E74 A;  2DVS A;  4E96 A;  4YAB A;  5K29 A;  3IU6 A;  2DAT A;  4PCI A;  4Z93 A;  4UIX A;  4NRA A;  4F3I A;  3HMF A;  5IGN A;  2D82 A;  3MUL A;  4BHW A;  5CUA A;  5I7X A;  4YYK A;  5EIS A;  3ERR A;  5CFW A;  4KV4 A;  1PUO A;  5CRZ A;  5DKC A;  2OSS A;  3O35 A;  3QZS A;  5ENF A;  3D1B A;  5CQ8 A;  3LQH A;  4A9K A;  4NR4 A;  4AKG A;  4MR6 A;  4WIV A;  5CPE A;  5FFW A;  5HRV A;  3HME A;  4BW4 A;  5EPB A;  4YYG A;  4HXO A;  4NUE A;  5F5Z A;  5CTL A;  5L96 A;  3ZYU A;  5L8U A;  5II1 A;  5FE5 A;  4IOO A;  4QY4 A;  4HXR A;  2FSA A;  5I1Q A;  4QSP A;  5CU8 A;  5DYC A;  4AKI A;  5D3R A;  5F1H A;  4PTB A;  4XY9 A;  5ETD A;  5AD2 A;  5EWH A;  4X2I A;  4TZ2 A;  4A9M A;  5D0C A;  3U5M A;  5ENJ A;  5I88 A;  4IR4 A;  3UVD A;  4TZ8 A;  3U5P A;  5A5S A;  5KTU A;  4CL9 A;  5DYA A;  2YDW A;  5CQ7 A;  4YC9 A;  4YH4 A;  2EJN A;  4A9O A;  3DWY A;  1JM4 B;  5TCM A;  4N4H A;  5ENG A;  3SVH A;  4OUF A;  5D26 A;  5FE0 A;  3S91 A;  2F6N A;  3D7C A;  4RVR A;  5D3H A;  5FE3 A;  4TT4 A;  2F6J A;  4J0R A;  5CUG A;  4YYD A;  5EQ1 A;  3JVJ A;  5EP7 A;  4LYS A;  5C89 A;  2RI7 A;  5CUE A;  2R10 A;  5EPR A;  4NR8 A;  2RNY A;  5FBX A;  5A5Q A;  5AD3 A;  4QB3 A;  4BW2 A;  5LJ1 A;  4CUU A;  4MEP A;  5KHM A;  5ENE A;  4N4F A;  2L85 A;  3P1F A;  4O7B A;  4QSV A;  5HQ6 A;  4HBX A;  5EM3 A;  4O7C A;  4J1P A;  4LYI A;  3GG3 A;  5ENC A;  3UV4 A;  3O36 A;  3LJW A;  5D3S A;  3DAI A;  4N4G A;  3G0L A;  5BT5 A;  3TLP A;  4NUC A;  5FB1 A;  5I29 A;  5G4S A;  5C85 A;  5KTW A;  5H1T A;  5HCL A;  4NR9 A;  4PY6 A;  4YBT A;  5H85 A;  2WP2 A;  4LZR A;  3UVX A;  4YYI A;  2KTB B;  4AI6 A;  3UW9 A;  4YY4 A;  3P1C A;  2YQD A;  1E6I A;  4Z1S A;  4UIW A;  4MEQ A;  5ACY A;  4MR5 A;  5CY9 A;  4O70 A;  4NQN A;  5JWM A;  2RS9 B;  3RCW A;  5A5P A;  2RNW A;  2L84 A;  4TYL A;  4CUP A;  2LSP B;  4UYF A;  4MR3 A;  4NUD A;  4A9E A;  5E73 A;  2R0V A;  1WUG A;  5E9Y A;  3MB3 A;  5IGK A;  4WHW A;  4LZS A;  3UVY A;  3NXB A;  5CQ5 A;  4CUT A;  4KCX A;  4FLP A;  5FE7 A;  4N4I A;  4QYL A;  2R0Y A;  5F60 A;  5KTX A;  5D3N A;  4TU6 A;  5DYU A;  5FE1 A;  3O37 A;  4HBV A;  4HXS A;  5DKH A;  5C8G A;  4A9H A;  4XYA A;  5DBM A;  4TT2 A;  5H1U A;  4QEV A;  4HXL A;  4UYG A;  4UYE A;  5L97 A;  2E7O A;  5I86 A;  5C4Q A;  5HRX A;  3P5O A;  5DY7 A;  4ALH A;  3U5J A;  1JSP B;  4O7E A;  5LKT A;  5E9L A;  4YK0 A;  4Q0O A;  4QC1 A;  5D3J A;  5EWD A;  5FE2 A;  4O72 A;  3MXF A;  4QSS A;  3P1E A;  5A7C A;  5C7N A;  4UIU A;  4YBS A;  5FH8 A;  4BW1 A;  5FE9 A;  5F61 A;  5LJ2 A;  5EWW A;  4NQM A;  3U5L A;  3VKG A;  5HFR A;  2DWW A;  3UVW A;  4AKH A;  5FB0 A;  2DVR A;  2YEM A;  5EI4 A;  5DFC A;  4IOQ A;  4NYV A;  5E9I A;  5KU3 A;  4YAT A;  4AKN A;  3LXJ A;  5F1L A;  4LYW A;  5AME A;  4A9I A;  5BT4 A;  5LKX A;  4DON A;  2L5E A;  4O75 A;  4NXJ A;  3K2J A;  5A5N A;  5EK9 A;  5TB6 A;  4MEN A;  2E7N A;  5CUB A;  3MUK A;  4O74 A;  5E3G A;  2D9E A;  4TU4 A;  5F25 A;  5COI A;  4UIT A;  4NYX A;  2DKW A;  4YAX A;  5ETB A;  2N9G A;  3AQA A;  5KO4 A;  5CQ4 A;  4OGJ A;  2I8N A;  5DX4 A;  5CQA A;  4CUQ A;  4QUT A;  4QSU A;  4IR6 A;  5DFB A;  5H1V A;  5D3L A;  4QZS A;  4UYD A;  5DW1 A;  5A85 A;  4CUR A;  4LR6 A;  3ONI A;  4GPJ A;  4HXM A;  4J3I A;  4QSX A;  4XUB A;  4YH3 A;  5ENB A;  5IG6 A;  4NR5 A;  4IR3 A;  3MB4 A;  3G0J A;  5LVR A;  5D24 A;  5DLZ A;  5F36 A;  5D3P A;  4HXK A;  5LJ0 A;  5HEN A;  3LQJ A;  4N3W A;  4QEU A;  4A9N A;  1ZS5 A;  4ALG A;  5EV9 A;  4TT6 A;  2YYN A;  2YEL A;  5L8T A;  3UV5 A;  4HBW A;  3P1D A;  5IGM A;  5CGP A;  5CUD A;  3I3J A;  3Q2E A;  5L98 A;  2YEK A;  4C67 A;  1ZKR A;  5EVA A;  5HQ5 A;  5II2 A;  4QR3 A;  5FG6 A;  4ZC9 A;  1X0J A;  4WHU A;  5FG5 A;  5JI8 A;  4LDF A;  5G4R A;  2DVQ A;  5HRW A;  4QBM A;  5E9M A;  5I89 A;  5HM0 A;  4YAD A;  4HXN A;  4HXP A;  4YBM A;  4MR4 A;  5EWC A;  5EWV A;  3HMH A;  3IU5 A;  4QNS A;  5F63 A;  2R0S A;  4NR6 A;  4UYH A;  4NRC A;  3D1D A;  2NXB A;  5CQT A;  4A9J A;  5ENI A;  5HJC A;  5DKD A;  1N72 A;  2G4A A;  1EQF A;  4HBY A;  3SVF A;  5CZG A;  5EIC A;  4LZ2 A;  4NYW A;  4QUU A;  5CP5 A;  4PCE A; 
#chains in the Genus database with same CATH homology
 3UV2 A;  4O71 A;  4UYF B;  5CUC A;  5FFY A;  5IBN A;  4TQN A;  4YYH A;  4Z1Q A;  5FE6 A;  3O33 A;  5E0R A;  4BW3 A;  4O78 A;  4NS5 A;  5CQ6 A;  5F2P A;  4Z6I A;  5A81 A;  5CQ3 A;  4QSW A;  5A83 A;  2DVV A;  5FH6 A;  4IOR A;  4YYN A;  3U5O A;  5I40 A;  5FFV A;  1WUM A;  4QSR A;  5E7D A;  5LUU A;  4KV1 A;  5LKZ A;  5I80 A;  5IID A;  5F3A A;  4O7F A;  3QZT A;  4UIV A;  3FKM X;  5E9V A;  2I7K A;  4NR7 A;  4Q0N A;  4QYD A;  2RO1 A;  5DYX A;  5LKU A;  4CFL A;  3S92 A;  2GRC A;  4LRG A;  4XUA A;  5DLX A;  3U5K A;  5FG4 A;  4IR5 A;  5A82 A;  5HQ7 A;  2YW5 A;  4J0S A;  5FH7 A;  5HFQ A;  5EGU A;  5EPS A;  5F62 A;  2H60 A;  5AMF A;  4O7A A;  1F68 A;  4CLB A;  4YYJ A;  4Z6H A;  2OO1 A;  4ZW1 A;  5HLS A;  5EU1 A;  4OGI A;  3QZV A;  5D25 A;  4CUS A;  4PS5 A;  4BJX A;  5FE4 A;  3Q2F A;  4NRB A;  3LQI A;  5IGL A;  5HEL A;  5FDZ A;  5A5O A;  4PKL A;  3O34 A;  4Y03 A;  4QR5 A;  4C66 A;  5A5R A;  2OUO A;  5J0D A;  5E9K A;  5LVQ A;  5D3T A;  4LC2 A;  2WP1 A;  2RNX A;  4TTE A;  5D7X A;  4QC3 A;  4A9F A;  3MQM A;  5BT3 A;  5CS8 A;  5I7Y A;  3AAD A;  4UIZ A;  4QSQ A;  5DFD A;  5I83 A;  4QEW A;  5E3D A;  5CRM A;  4UIY A;  3JVM A;  4A9L A;  4O77 A;  2MJV B;  5FE8 A;  2E3K A;  5ENH A;  5L99 A;  2RFJ A;  3JVK A;  4MEO A;  5C87 A;  4ZQL A;  5HEM A;  3JVL A;  4YY6 A;  4QR4 A;  5DW2 A;  4TS8 A;  4CFK A;  4YYM A;  5EA1 A;  3SVG A;  3U5N A;  4QST A;  4O76 A;  4XY8 A;  5E74 A;  2DVS A;  4E96 A;  4YAB A;  5K29 A;  3IU6 A;  2DAT A;  4PCI A;  4Z93 A;  4UIX A;  4NRA A;  4F3I A;  3HMF A;  5IGN A;  2D82 A;  3MUL A;  4BHW A;  5CUA A;  5I7X A;  4YYK A;  5EIS A;  5CFW A;  4KV4 A;  5CRZ A;  5DKC A;  2OSS A;  3O35 A;  3QZS A;  5ENF A;  5CQ8 A;  3LQH A;  4A9K A;  4NR4 A;  4MR6 A;  4WIV A;  5CPE A;  5FFW A;  5HRV A;  3HME A;  4BW4 A;  5EPB A;  4YYG A;  4HXO A;  4NUE A;  5F5Z A;  5CTL A;  5L96 A;  3ZYU A;  5L8U A;  5II1 A;  5FE5 A;  4IOO A;  4QY4 A;  4HXR A;  2FSA A;  5I1Q A;  4QSP A;  5CU8 A;  5DYC A;  5D3R A;  5F1H A;  4PTB A;  4XY9 A;  5ETD A;  5AD2 A;  5EWH A;  4X2I A;  4TZ2 A;  4A9M A;  5D0C A;  3U5M A;  5ENJ A;  5I88 A;  4IR4 A;  3UVD A;  4TZ8 A;  3U5P A;  5A5S A;  5KTU A;  4CL9 A;  5DYA A;  2YDW A;  5CQ7 A;  4YC9 A;  4YH4 A;  4A9O A;  3DWY A;  1JM4 B;  5TCM A;  4N4H A;  5ENG A;  3SVH A;  4OUF A;  5D26 A;  5FE0 A;  3S91 A;  2F6N A;  3D7C A;  4RVR A;  5D3H A;  5FE3 A;  4TT4 A;  2F6J A;  4J0R A;  5CUG A;  4YYD A;  5EQ1 A;  3JVJ A;  5EP7 A;  4LYS A;  5C89 A;  2RI7 A;  5CUE A;  2R10 A;  5EPR A;  4NR8 A;  2RNY A;  5FBX A;  5A5Q A;  5AD3 A;  4QB3 A;  4BW2 A;  5LJ1 A;  4CUU A;  4MEP A;  5KHM A;  5ENE A;  4N4F A;  2L85 A;  3P1F A;  4O7B A;  4QSV A;  5HQ6 A;  4HBX A;  5EM3 A;  4O7C A;  4J1P A;  4LYI A;  3GG3 A;  5ENC A;  3UV4 A;  3O36 A;  3LJW A;  5D3S A;  3DAI A;  4N4G A;  3G0L A;  5BT5 A;  3TLP A;  4NUC A;  5FB1 A;  5I29 A;  5G4S A;  5C85 A;  5KTW A;  5H1T A;  5HCL A;  4NR9 A;  4PY6 A;  4YBT A;  5H85 A;  2WP2 A;  4LZR A;  3UVX A;  4YYI A;  2KTB B;  3UW9 A;  4YY4 A;  3P1C A;  2YQD A;  1E6I A;  4Z1S A;  4UIW A;  4MEQ A;  5ACY A;  4MR5 A;  5CY9 A;  4O70 A;  4NQN A;  5JWM A;  2RS9 B;  3RCW A;  5A5P A;  2RNW A;  2L84 A;  4TYL A;  4CUP A;  2LSP B;  4UYF A;  4MR3 A;  4NUD A;  4A9E A;  5E73 A;  2R0V A;  1WUG A;  5E9Y A;  3MB3 A;  5IGK A;  4WHW A;  4LZS A;  3UVY A;  3NXB A;  5CQ5 A;  4CUT A;  4KCX A;  4FLP A;  5FE7 A;  4N4I A;  4QYL A;  2R0Y A;  5F60 A;  5KTX A;  5D3N A;  4TU6 A;  5DYU A;  5FE1 A;  3O37 A;  4HBV A;  4HXS A;  5DKH A;  5C8G A;  4A9H A;  4XYA A;  5DBM A;  4TT2 A;  5H1U A;  4QEV A;  4HXL A;  4UYG A;  4UYE A;  5L97 A;  2E7O A;  5I86 A;  5C4Q A;  5HRX A;  3P5O A;  5DY7 A;  4ALH A;  3U5J A;  1JSP B;  4O7E A;  5LKT A;  5E9L A;  4YK0 A;  4Q0O A;  4QC1 A;  5D3J A;  5EWD A;  5FE2 A;  4O72 A;  3MXF A;  4QSS A;  3P1E A;  5A7C A;  5C7N A;  4UIU A;  4YBS A;  5FH8 A;  4BW1 A;  5FE9 A;  5F61 A;  5LJ2 A;  5EWW A;  4NQM A;  3U5L A;  5HFR A;  2DWW A;  3UVW A;  5FB0 A;  2DVR A;  2YEM A;  5EI4 A;  5DFC A;  4IOQ A;  4NYV A;  5E9I A;  5KU3 A;  4YAT A;  4AKN A;  3LXJ A;  5F1L A;  4LYW A;  5AME A;  4A9I A;  5BT4 A;  5LKX A;  4DON A;  2L5E A;  4O75 A;  4NXJ A;  3K2J A;  5A5N A;  5EK9 A;  5TB6 A;  4MEN A;  2E7N A;  5CUB A;  3MUK A;  4O74 A;  5E3G A;  2D9E A;  4TU4 A;  5F25 A;  5COI A;  4UIT A;  4NYX A;  2DKW A;  4YAX A;  5ETB A;  2N9G A;  3AQA A;  5KO4 A;  5CQ4 A;  4OGJ A;  2I8N A;  5DX4 A;  5CQA A;  4CUQ A;  4QUT A;  4QSU A;  4IR6 A;  5DFB A;  5H1V A;  5D3L A;  4QZS A;  4UYD A;  5DW1 A;  5A85 A;  4CUR A;  4LR6 A;  3ONI A;  4GPJ A;  4HXM A;  4J3I A;  4QSX A;  4XUB A;  4YH3 A;  5ENB A;  5IG6 A;  4NR5 A;  4IR3 A;  3MB4 A;  3G0J A;  5LVR A;  5D24 A;  5DLZ A;  5F36 A;  5D3P A;  4HXK A;  5LJ0 A;  5HEN A;  3LQJ A;  4N3W A;  4QEU A;  4A9N A;  1ZS5 A;  4ALG A;  5EV9 A;  4TT6 A;  2YYN A;  2YEL A;  5L8T A;  3UV5 A;  4HBW A;  3P1D A;  5IGM A;  5CGP A;  5CUD A;  3I3J A;  3Q2E A;  5L98 A;  2YEK A;  4C67 A;  5EVA A;  5HQ5 A;  5II2 A;  4QR3 A;  5FG6 A;  4ZC9 A;  1X0J A;  4WHU A;  5FG5 A;  5JI8 A;  4LDF A;  5G4R A;  2DVQ A;  5HRW A;  4QBM A;  5E9M A;  5I89 A;  5HM0 A;  4YAD A;  4HXN A;  4HXP A;  4YBM A;  4MR4 A;  5EWC A;  5EWV A;  3HMH A;  3IU5 A;  4QNS A;  5F63 A;  2R0S A;  4NR6 A;  4UYH A;  4NRC A;  2NXB A;  5CQT A;  4A9J A;  5ENI A;  5HJC A;  5DKD A;  1N72 A;  2G4A A;  1EQF A;  4HBY A;  3SVF A;  5CZG A;  5EIC A;  4LZ2 A;  4NYW A;  4QUU A;  5CP5 A;  4PCE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...