4TS8A

Crystal structure of the bromodomain of human crebbp in complex with xz08
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
112
structure length
112
Chain Sequence
FKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CREB-binding protein
publication title Crystal structure of the bromodomain of human CREBBP in complex with XZ08
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 42
structure length 112
sequence length 112
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2014-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4ts8A00
5DKHA 4YK0A 5FFWA 5FH7A 3O35A 5CQ3A 5D3LA 4HXMA 3SVHA 3JVJA 4YYKA 5II1A 4QSPA 5CPEA 5EWHA 5K29A 4BW2A 2N9GA 4QYLA 4UIWA 4PCEA 5I40A 4XY8A 4QY4A 4NR7A 5E9KA 5D25A 5LUUA 5FG6A 4UYDA 4PCIA 5AD2A 5EPBA 4MEPA 4TYLA 4WHWA 5FE1A 5BT4A 5FE8A 5TCMA 3FKMX 4UYEA 3HMHA 5FE2A 2I7KA 5TB6A 5ENBA 5HFQA 2DVQA 5HRXA 5LKUA 5F25A 5A82A 5CQ8A 4BW4A 5A5QA 4Z1SA 5AMFA 5CTLA 5E9IA 4NXJA 5I88A 5DX4A 5LKTA 4MR4A 3UVWA 5EQ1A 4O7AA 4PY6A 3SVGA 5FE5A 5G4SA 5FE9A 5ENCA 5FB1A 4NRAA 2E3KA 4A9NA 4O78A 4TT6A 5EU1A 4PTBA 4OGJA 4BJXA 4QZSA 5H85A 5DKDA 5FFVA 5FE7A 3P5OA 4QSRA 5H1TA 5DYXA 5EM3A 4QNSA 4YY4A 4O77A 3Q2FA 4LYSA 5C8GA 3MULA 3U5MA 5I1QA 3U5OA 4TQNA 5FBXA 2YW5A 4TS8A 3DAIA 4LRGA 4TU4A 4LZ2A 5HQ6A 4NQNA 4Q0OA 5DLXA 5FDZA 4PS5A 4Z6HA 4A9FA 3ZYUA 5CQ6A 3G0LA 4ZQLA 4YYDA 4UIXA 2I8NA 4LZRA 5EPRA 4YH3A 4XUBA 2DVVA 3UVDA 4O7EA 5II2A 5E3GA 5E7DA 4UYHA 5EK9A 5CQTA 3O37A 5EWWA 2DVSA 1WUMA 5CUBA 5DFDA 4MR3A 4NYXA 4YC9A 4YY6A 5C87A 5ETDA 4CUSA 4QUUA 4XUAA 5L8UA 3U5PA 4NS5A 4YAXA 4NUCA 4HBYA 4YH4A 3LQHA 4NYWA 2RS9B 5DFBA 5HFRA 5A5NA 4A9JA 2YEMA 3U5JA 5A5RA 5IGMA 4J0SA 2L5EA 4A9HA 4OGIA 3G0JA 4NR8A 4KCXA 4TTEA 5FB0A 3LQIA 5IGLA 1F68A 3U5LA 2FSAA 4HXKA 3P1CA 3IU5A 3P1DA 5FH6A 5CUCA 4QSWA 4QB3A 4C67A 1ZS5A 2YYNA 2H60A 5IIDA 2F6NA 5KTUA 5L96A 4UYGA 5D3HA 5IGNA 4MENA 3QZSA 4HXNA 5EV9A 2OUOA 2YQDA 4O72A 5D3JA 5IG6A 3UW9A 4IR4A 5D3NA 5EA1A 4HBVA 3UVXA 4F3IA 3QZTA 5CQ4A 5C89A 4MEOA 5KHMA 4Z1QA 4HXRA 4A9OA 5E0RA 4CUTA 4NRCA 4TU6A 4HXPA 4NUEA 4WHUA 5HLSA 4QUTA 3DWYA 2DVRA 4YBTA 5F2PA 4LYIA 2RI7A 5EWVA 3QZVA 4FLPA 5CRZA 4HXSA 5KU3A 5A81A 4A9KA 5D3TA 5CFWA 3O36A 5ENGA 5F1LA 4NQMA 3O33A 3AADA 2WP1A 3LXJA 5F1HA 4Q0NA 4CUQA 4QC1A 4QBMA 4O70A 5CUAA 5C4QA 4A9IA 4O71A 5FE3A 5H1VA 4YADA 4LR6A 4N4FA 4QEVA 3P1FA 4TZ8A 4UIZA 5HQ5A 5HEMA 4HBWA 5E73A 4NUDA 4NYVA 4A9MA 5EGUA 5A5PA 3SVFA 5I80A 4ALGA 5FE0A 5DYAA 5CU8A 5FG4A 2NXBA 2YDWA 2E7OA 4N4IA 5E74A 5BT3A 3P1EA 5LVRA 3IU6A 4O74A 5I89A 4YYIA 4RVRA 4IR5A 4MR6A 4QSQA 4YYMA 3JVKA 4CFLA 5ENJA 5J0DA 3U5KA 3RCWA 4NR9A 5CZGA 2RO1A 5F61A 5EVAA 3I3JA 4QEWA 4YYGA 4A9EA 4DONA 3JVLA 3MXFA 5DYCA 4IR3A 2R0SA 5AMEA 5HRWA 4CUUA 2RFJA 5A85A 3S92A 4YBSA 4BW3A 5E9MA 4X2IA 4O7FA 2R10A 5L97A 4Y03A 5HM0A 4BW1A 5BT5A 3GG3A 1N72A 5F62A 5E3DA 4LYWA 4LDFA 4IOOA 4YATA 5H1UA 5CQ7A 2GRCA 2RNXA 5E9YA 2YEKA 4Z6IA 5EISA 2RNYA 5F36A 5G4RA 5FE6A 2MJVB 3HMEA 3MB4A 4XYAA 5L99A 2YELA 3UV5A 4J1PA 2G4AA 5AD3A 5CGPA 4YBMA 5JWMA 4QYDA 5DLZA 5I86A 5A83A 5EWDA 5DBMA 3ONIA 1E6IA 4WIVA 5CQ5A 2LSPB 5DYUA 4QR3A 5F3AA 3JVMA 4UIYA 5HENA 1JSPB 4NR4A 5EPSA 4CFKA 4UYFB 5DW1A 4HXOA 5ETBA 4KV4A 5CS8A 5I7XA 3MB3A 1WUGA 4NR5A 5F63A 4UIUA 4N4HA 5FE4A 4QEUA 5LJ2A 5D3SA 4CL9A 4YABA 4HBXA 5F60A 5D24A 5ENIA 4QSUA 5LKZA 3UV4A 4A9LA 5C7NA 4QSXA 5C85A 4UYFA 4LZSA 3LJWA 5CUDA 4ALHA 4BHWA 5I29A 5COIA 4QC3A 4QR4A 4QR5A 4O76A 4O7BA 3Q2EA 5FG5A 5L8TA 3MQMA 4TT4A 5A7CA 2DATA 3K2JA 2R0YA 4XY9A 5EICA 4CURA 5EI4A 5ENEA 4TT2A 2KTBB 4KV1A 2RNWA 3UVYA 2DKWA 1JM4B 2OO1A 5E9VA 5DFCA 4CLBA 4J0RA 5EWCA 4YYHA 2OSSA 1X0JA 2F6JA 5ENFA 5CQAA 4MR5A 5D7XA 5CY9A 4IR6A 4MEQA 5E9LA 3HMFA 2D82A 2D9EA 2R0VA 5CRMA 5ACYA 4YYNA 4NR6A 4AKNA 4QSTA 5A5OA 1EQFA 4CUPA 4C66A 4UITA 4NRBA 4PKLA 5LJ1A 5FH8A 4N4GA 5D3RA 4LC2A 2E7NA 5JI8A 5LJ0A 5DW2A 3O34A 3S91A 4HXLA 5I7YA 5I83A 5IGKA 4QSSA 5CUGA 2L84A 4O7CA 5HRVA 4O75A 5LVQA 4IORA 3NXBA 5F5ZA 5LKXA 3U5NA 5IBNA 4J3IA 3D7CA 5HJCA 4YYJA 5CUEA 4E96A 5KO4A 5EP7A 4GPJA 4TZ2A 5D3PA 5KTXA 3UV2A 5HCLA 5ENHA 2L85A 5D0CA 2DWWA 5HQ7A 3AQAA 3MUKA 4N3WA 2WP2A 4ZC9A 4ZW1A 5HELA 4UIVA 5DKCA 3LQJA 3TLPA 5DY7A 4QSVA 4OUFA 4Z93A 5L98A 4IOQA 5A5SA 5FFYA 5CP5A 5D26A 5KTWA
chains in the Genus database with same CATH superfamily
5DKHA 4YK0A 5FFWA 5FH7A 3O35A 5CQ3A 5D3LA 4HXMA 3SVHA 3JVJA 4YYKA 5II1A 4QSPA 5CPEA 5EWHA 5K29A 4BW2A 2N9GA 4QYLA 4UIWA 4PCEA 5I40A 4XY8A 4QY4A 4NR7A 5E9KA 5D25A 5LUUA 5FG6A 4UYDA 4PCIA 5AD2A 5EPBA 4MEPA 4TYLA 4WHWA 5FE1A 5BT4A 5FE8A 5TCMA 3FKMX 4UYEA 3HMHA 5FE2A 2I7KA 5TB6A 5ENBA 5HFQA 2EJNA 2DVQA 5HRXA 5LKUA 5F25A 5A82A 5CQ8A 4BW4A 5A5QA 4Z1SA 5AMFA 5CTLA 5E9IA 4NXJA 5I88A 5DX4A 5LKTA 4MR4A 3UVWA 5EQ1A 4O7AA 4PY6A 3SVGA 5FE5A 5G4SA 5FE9A 3VKHA 5ENCA 5FB1A 4NRAA 2E3KA 4A9NA 4O78A 4TT6A 5EU1A 4PTBA 4OGJA 4BJXA 4QZSA 5H85A 5DKDA 5FFVA 5FE7A 3P5OA 4QSRA 5H1TA 5DYXA 5EM3A 4QNSA 4YY4A 4O77A 3Q2FA 4LYSA 5C8GA 3MULA 3U5MA 5I1QA 3U5OA 4TQNA 5FBXA 2YW5A 4TS8A 3DAIA 4LRGA 4TU4A 4LZ2A 5HQ6A 4NQNA 4Q0OA 5DLXA 5FDZA 4PS5A 4Z6HA 4A9FA 3ZYUA 5CQ6A 3G0LA 4ZQLA 4YYDA 4UIXA 2I8NA 4LZRA 5EPRA 4YH3A 4XUBA 2DVVA 3UVDA 4O7EA 5II2A 5E3GA 5E7DA 4UYHA 5EK9A 5CQTA 3O37A 5EWWA 2DVSA 1WUMA 5CUBA 5DFDA 4MR3A 4NYXA 4YC9A 4YY6A 5C87A 5ETDA 4CUSA 4QUUA 4XUAA 5L8UA 3U5PA 4NS5A 4YAXA 4NUCA 4HBYA 4YH4A 3LQHA 4NYWA 2RS9B 5DFBA 5HFRA 5A5NA 4A9JA 2YEMA 3U5JA 5A5RA 5IGMA 4J0SA 4AKGA 2L5EA 4A9HA 4OGIA 3G0JA 4NR8A 4KCXA 4TTEA 5FB0A 3LQIA 5IGLA 1F68A 3U5LA 2FSAA 4HXKA 3P1CA 3IU5A 3P1DA 5FH6A 5CUCA 4QSWA 4QB3A 4C67A 1ZS5A 2YYNA 2H60A 5IIDA 2F6NA 5KTUA 5L96A 4UYGA 5D3HA 3D1BA 5IGNA 4MENA 3QZSA 4HXNA 5EV9A 2OUOA 2YQDA 4O72A 5D3JA 5IG6A 3UW9A 4IR4A 5D3NA 5EA1A 4HBVA 3UVXA 4F3IA 3QZTA 5CQ4A 4AKIA 5C89A 4MEOA 5KHMA 4Z1QA 4HXRA 4A9OA 5E0RA 4CUTA 4NRCA 4TU6A 4HXPA 4NUEA 4WHUA 5HLSA 4QUTA 3DWYA 3VKGA 2DVRA 4YBTA 5F2PA 4LYIA 2RI7A 5EWVA 3QZVA 4FLPA 5CRZA 4HXSA 5KU3A 5A81A 4A9KA 5D3TA 5CFWA 3O36A 5ENGA 5F1LA 4NQMA 3O33A 3AADA 2WP1A 3LXJA 5F1HA 4Q0NA 4CUQA 4QC1A 4QBMA 4O70A 5CUAA 3D1DA 5C4QA 4A9IA 4O71A 5FE3A 5H1VA 4YADA 4LR6A 4N4FA 4QEVA 3P1FA 4TZ8A 4UIZA 5HQ5A 5HEMA 4HBWA 5E73A 4NUDA 4NYVA 4A9MA 5EGUA 5A5PA 3SVFA 5I80A 4ALGA 5FE0A 5DYAA 5CU8A 5FG4A 2NXBA 2YDWA 2E7OA 4N4IA 5E74A 5BT3A 3P1EA 5LVRA 3IU6A 4O74A 5I89A 4YYIA 4RVRA 4IR5A 4MR6A 4QSQA 4YYMA 3JVKA 4CFLA 5ENJA 5J0DA 3U5KA 3RCWA 4NR9A 5CZGA 2RO1A 5F61A 5EVAA 3I3JA 4QEWA 4YYGA 4A9EA 4DONA 3JVLA 3MXFA 5DYCA 4IR3A 2R0SA 5AMEA 5HRWA 4CUUA 2RFJA 5A85A 3S92A 4YBSA 4BW3A 5E9MA 4X2IA 4O7FA 2R10A 5L97A 4Y03A 5HM0A 4BW1A 5BT5A 3GG3A 1N72A 5F62A 5E3DA 4LYWA 4LDFA 4IOOA 4YATA 5H1UA 5CQ7A 2GRCA 2RNXA 5E9YA 2YEKA 4Z6IA 5EISA 2RNYA 5F36A 5G4RA 5FE6A 2MJVB 3HMEA 3MB4A 4XYAA 5L99A 2YELA 3UV5A 1ZKRA 4J1PA 2G4AA 5AD3A 5CGPA 4YBMA 5JWMA 4QYDA 5DLZA 5I86A 5A83A 5EWDA 5DBMA 3ONIA 1E6IA 4WIVA 5CQ5A 2LSPB 5DYUA 4QR3A 5F3AA 3JVMA 4UIYA 5HENA 1JSPB 4NR4A 5EPSA 4CFKA 4UYFB 5DW1A 4HXOA 5ETBA 4AKHA 4KV4A 5CS8A 5I7XA 3MB3A 1WUGA 4NR5A 5F63A 4UIUA 4N4HA 5FE4A 4QEUA 3ERRA 5LJ2A 5D3SA 4CL9A 4YABA 4HBXA 5F60A 5D24A 5ENIA 4QSUA 5LKZA 3UV4A 4A9LA 5C7NA 4QSXA 5C85A 4UYFA 4LZSA 3LJWA 5CUDA 4ALHA 4BHWA 5I29A 5COIA 4QC3A 4QR4A 4QR5A 4O76A 4O7BA 3Q2EA 5FG5A 5L8TA 3MQMA 4TT4A 5A7CA 2DATA 3K2JA 2R0YA 4XY9A 5EICA 4CURA 5EI4A 5ENEA 4TT2A 2KTBB 4KV1A 4AI6A 2RNWA 3UVYA 2DKWA 1JM4B 2OO1A 5E9VA 5DFCA 4CLBA 4J0RA 5EWCA 4YYHA 2OSSA 1X0JA 2F6JA 5ENFA 5CQAA 4MR5A 5D7XA 5CY9A 4IR6A 4MEQA 5E9LA 3HMFA 2D82A 2D9EA 2R0VA 5CRMA 5ACYA 4YYNA 4NR6A 4AKNA 4QSTA 5A5OA 1EQFA 4CUPA 4C66A 4UITA 4NRBA 4PKLA 5LJ1A 5FH8A 4N4GA 5D3RA 4LC2A 2E7NA 5JI8A 5LJ0A 5DW2A 3O34A 3S91A 4HXLA 5I7YA 5I83A 5IGKA 4QSSA 5CUGA 2L84A 4O7CA 5HRVA 4O75A 5LVQA 4IORA 3NXBA 5F5ZA 5LKXA 3U5NA 5IBNA 4J3IA 3D7CA 5HJCA 1PUOA 4YYJA 5CUEA 4E96A 5KO4A 5EP7A 4GPJA 4TZ2A 5D3PA 5KTXA 3UV2A 5HCLA 5ENHA 2L85A 5D0CA 2DWWA 5HQ7A 3AQAA 3MUKA 4N3WA 2WP2A 4ZC9A 4ZW1A 5HELA 4UIVA 5DKCA 3LQJA 3TLPA 5DY7A 4QSVA 4OUFA 4Z93A 5L98A 4IOQA 5A5SA 5FFYA 5CP5A 5D26A 5KTWA
chains in the Genus database with same CATH topology
5DKHA 4YK0A 5FFWA 5FH7A 3O35A 5CQ3A 5D3LA 4HXMA 3SVHA 3JVJA 4YYKA 5II1A 4QSPA 5CPEA 5EWHA 5K29A 4BW2A 2N9GA 4QYLA 4UIWA 4PCEA 5I40A 4XY8A 4QY4A 4NR7A 5E9KA 5D25A 5LUUA 5FG6A 4UYDA 4PCIA 5AD2A 5EPBA 4MEPA 4TYLA 4WHWA 5FE1A 5BT4A 5FE8A 5TCMA 3FKMX 4UYEA 3HMHA 5FE2A 2I7KA 5TB6A 5ENBA 5HFQA 2DVQA 5HRXA 5LKUA 5F25A 5A82A 5CQ8A 4BW4A 5A5QA 4Z1SA 5AMFA 5CTLA 5E9IA 4NXJA 5I88A 5DX4A 5LKTA 4MR4A 3UVWA 5EQ1A 4O7AA 4PY6A 3SVGA 5FE5A 5G4SA 5FE9A 5ENCA 5FB1A 4NRAA 2E3KA 4A9NA 4O78A 4TT6A 5EU1A 4PTBA 4OGJA 4BJXA 4QZSA 5H85A 5DKDA 5FFVA 5FE7A 3P5OA 4QSRA 5H1TA 5DYXA 5EM3A 4QNSA 4YY4A 4O77A 3Q2FA 4LYSA 5C8GA 3MULA 3U5MA 5I1QA 3U5OA 4TQNA 5FBXA 2YW5A 4TS8A 3DAIA 4LRGA 4TU4A 4LZ2A 5HQ6A 4NQNA 4Q0OA 5DLXA 5FDZA 4PS5A 4Z6HA 4A9FA 3ZYUA 5CQ6A 3G0LA 4ZQLA 4YYDA 4UIXA 2I8NA 4LZRA 5EPRA 4YH3A 4XUBA 2DVVA 3UVDA 4O7EA 5II2A 5E3GA 5E7DA 4UYHA 5EK9A 5CQTA 3O37A 5EWWA 2DVSA 1WUMA 5CUBA 5DFDA 4MR3A 4NYXA 4YC9A 4YY6A 5C87A 5ETDA 4CUSA 4QUUA 4XUAA 5L8UA 3U5PA 4NS5A 4YAXA 4NUCA 4HBYA 4YH4A 3LQHA 4NYWA 2RS9B 5DFBA 5HFRA 5A5NA 4A9JA 2YEMA 3U5JA 5A5RA 5IGMA 4J0SA 2L5EA 4A9HA 4OGIA 3G0JA 4NR8A 4KCXA 4TTEA 5FB0A 3LQIA 5IGLA 1F68A 3U5LA 2FSAA 4HXKA 3P1CA 3IU5A 3P1DA 5FH6A 5CUCA 4QSWA 4QB3A 4C67A 1ZS5A 2YYNA 2H60A 5IIDA 2F6NA 5KTUA 5L96A 4UYGA 5D3HA 5IGNA 4MENA 3QZSA 4HXNA 5EV9A 2OUOA 2YQDA 4O72A 5D3JA 5IG6A 3UW9A 4IR4A 5D3NA 5EA1A 4HBVA 3UVXA 4F3IA 3QZTA 5CQ4A 5C89A 4MEOA 5KHMA 4Z1QA 4HXRA 4A9OA 5E0RA 4CUTA 4NRCA 4TU6A 4HXPA 4NUEA 4WHUA 5HLSA 4QUTA 3DWYA 2DVRA 4YBTA 5F2PA 4LYIA 2RI7A 5EWVA 3QZVA 4FLPA 5CRZA 4HXSA 5KU3A 5A81A 4A9KA 5D3TA 5CFWA 3O36A 5ENGA 5F1LA 4NQMA 3O33A 3AADA 2WP1A 3LXJA 5F1HA 4Q0NA 4CUQA 4QC1A 4QBMA 4O70A 5CUAA 5C4QA 4A9IA 4O71A 5FE3A 5H1VA 4YADA 4LR6A 4N4FA 4QEVA 3P1FA 4TZ8A 4UIZA 5HQ5A 5HEMA 4HBWA 5E73A 4NUDA 4NYVA 4A9MA 5EGUA 5A5PA 3SVFA 5I80A 4ALGA 5FE0A 5DYAA 5CU8A 5FG4A 2NXBA 2YDWA 2E7OA 4N4IA 5E74A 5BT3A 3P1EA 5LVRA 3IU6A 4O74A 5I89A 4YYIA 4RVRA 4IR5A 4MR6A 4QSQA 4YYMA 3JVKA 4CFLA 5ENJA 5J0DA 3U5KA 3RCWA 4NR9A 5CZGA 2RO1A 5F61A 5EVAA 3I3JA 4QEWA 4YYGA 4A9EA 4DONA 3JVLA 3MXFA 5DYCA 4IR3A 2R0SA 5AMEA 5HRWA 4CUUA 2RFJA 5A85A 3S92A 4YBSA 4BW3A 5E9MA 4X2IA 4O7FA 2R10A 5L97A 4Y03A 5HM0A 4BW1A 5BT5A 3GG3A 1N72A 5F62A 5E3DA 4LYWA 4LDFA 4IOOA 4YATA 5H1UA 5CQ7A 2GRCA 2RNXA 5E9YA 2YEKA 4Z6IA 5EISA 2RNYA 5F36A 5G4RA 5FE6A 2MJVB 3HMEA 3MB4A 4XYAA 5L99A 2YELA 3UV5A 4J1PA 2G4AA 5AD3A 5CGPA 4YBMA 5JWMA 4QYDA 5DLZA 5I86A 5A83A 5EWDA 5DBMA 3ONIA 1E6IA 4WIVA 5CQ5A 2LSPB 5DYUA 4QR3A 5F3AA 3JVMA 4UIYA 5HENA 1JSPB 4NR4A 5EPSA 4CFKA 4UYFB 5DW1A 4HXOA 5ETBA 4KV4A 5CS8A 5I7XA 3MB3A 1WUGA 4NR5A 5F63A 4UIUA 4N4HA 5FE4A 4QEUA 5LJ2A 5D3SA 4CL9A 4YABA 4HBXA 5F60A 5D24A 5ENIA 4QSUA 5LKZA 3UV4A 4A9LA 5C7NA 4QSXA 5C85A 4UYFA 4LZSA 3LJWA 5CUDA 4ALHA 4BHWA 5I29A 5COIA 4QC3A 4QR4A 4QR5A 4O76A 4O7BA 3Q2EA 5FG5A 5L8TA 3MQMA 4TT4A 5A7CA 2DATA 3K2JA 2R0YA 4XY9A 5EICA 4CURA 5EI4A 5ENEA 4TT2A 2KTBB 4KV1A 2RNWA 3UVYA 2DKWA 1JM4B 2OO1A 5E9VA 5DFCA 4CLBA 4J0RA 5EWCA 4YYHA 2OSSA 1X0JA 2F6JA 5ENFA 5CQAA 4MR5A 5D7XA 5CY9A 4IR6A 4MEQA 5E9LA 3HMFA 2D82A 2D9EA 2R0VA 5CRMA 5ACYA 4YYNA 4NR6A 4AKNA 4QSTA 5A5OA 1EQFA 4CUPA 4C66A 4UITA 4NRBA 4PKLA 5LJ1A 5FH8A 4N4GA 5D3RA 4LC2A 2E7NA 5JI8A 5LJ0A 5DW2A 3O34A 3S91A 4HXLA 5I7YA 5I83A 5IGKA 4QSSA 5CUGA 2L84A 4O7CA 5HRVA 4O75A 5LVQA 4IORA 3NXBA 5F5ZA 5LKXA 3U5NA 5IBNA 4J3IA 3D7CA 5HJCA 4YYJA 5CUEA 4E96A 5KO4A 5EP7A 4GPJA 4TZ2A 5D3PA 5KTXA 3UV2A 5HCLA 5ENHA 2L85A 5D0CA 2DWWA 5HQ7A 3AQAA 3MUKA 4N3WA 2WP2A 4ZC9A 4ZW1A 5HELA 4UIVA 5DKCA 3LQJA 3TLPA 5DY7A 4QSVA 4OUFA 4Z93A 5L98A 4IOQA 5A5SA 5FFYA 5CP5A 5D26A 5KTWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DKH A;  4YK0 A;  5FFW A;  5FH7 A;  3O35 A;  5CQ3 A;  5D3L A;  4HXM A;  3SVH A;  3JVJ A;  4YYK A;  5II1 A;  4QSP A;  5CPE A;  5EWH A;  5K29 A;  4BW2 A;  2N9G A;  4QYL A;  4UIW A;  4PCE A;  5I40 A;  4XY8 A;  4QY4 A;  4NR7 A;  5E9K A;  5D25 A;  5LUU A;  5FG6 A;  4UYD A;  4PCI A;  5AD2 A;  5EPB A;  4MEP A;  4TYL A;  4WHW A;  5FE1 A;  5BT4 A;  5FE8 A;  5TCM A;  3FKM X;  4UYE A;  3HMH A;  5FE2 A;  2I7K A;  5TB6 A;  5ENB A;  5HFQ A;  2DVQ A;  5HRX A;  5LKU A;  5F25 A;  5A82 A;  5CQ8 A;  4BW4 A;  5A5Q A;  4Z1S A;  5AMF A;  5CTL A;  5E9I A;  4NXJ A;  5I88 A;  5DX4 A;  5LKT A;  4MR4 A;  3UVW A;  5EQ1 A;  4O7A A;  4PY6 A;  3SVG A;  5FE5 A;  5G4S A;  5FE9 A;  5ENC A;  5FB1 A;  4NRA A;  2E3K A;  4A9N A;  4O78 A;  4TT6 A;  5EU1 A;  4PTB A;  4OGJ A;  4BJX A;  4QZS A;  5H85 A;  5DKD A;  5FFV A;  5FE7 A;  3P5O A;  4QSR A;  5H1T A;  5DYX A;  5EM3 A;  4QNS A;  4YY4 A;  4O77 A;  3Q2F A;  4LYS A;  5C8G A;  3MUL A;  3U5M A;  5I1Q A;  3U5O A;  4TQN A;  5FBX A;  2YW5 A;  4TS8 A;  3DAI A;  4LRG A;  4TU4 A;  4LZ2 A;  5HQ6 A;  4NQN A;  4Q0O A;  5DLX A;  5FDZ A;  4PS5 A;  4Z6H A;  4A9F A;  3ZYU A;  5CQ6 A;  3G0L A;  4ZQL A;  4YYD A;  4UIX A;  2I8N A;  4LZR A;  5EPR A;  4YH3 A;  4XUB A;  2DVV A;  3UVD A;  4O7E A;  5II2 A;  5E3G A;  5E7D A;  4UYH A;  5EK9 A;  5CQT A;  3O37 A;  5EWW A;  2DVS A;  1WUM A;  5CUB A;  5DFD A;  4MR3 A;  4NYX A;  4YC9 A;  4YY6 A;  5C87 A;  5ETD A;  4CUS A;  4QUU A;  4XUA A;  5L8U A;  3U5P A;  4NS5 A;  4YAX A;  4NUC A;  4HBY A;  4YH4 A;  3LQH A;  4NYW A;  2RS9 B;  5DFB A;  5HFR A;  5A5N A;  4A9J A;  2YEM A;  3U5J A;  5A5R A;  5IGM A;  4J0S A;  2L5E A;  4A9H A;  4OGI A;  3G0J A;  4NR8 A;  4KCX A;  4TTE A;  5FB0 A;  3LQI A;  5IGL A;  1F68 A;  3U5L A;  2FSA A;  4HXK A;  3P1C A;  3IU5 A;  3P1D A;  5FH6 A;  5CUC A;  4QSW A;  4QB3 A;  4C67 A;  1ZS5 A;  2YYN A;  2H60 A;  5IID A;  2F6N A;  5KTU A;  5L96 A;  4UYG A;  5D3H A;  5IGN A;  4MEN A;  3QZS A;  4HXN A;  5EV9 A;  2OUO A;  2YQD A;  4O72 A;  5D3J A;  5IG6 A;  3UW9 A;  4IR4 A;  5D3N A;  5EA1 A;  4HBV A;  3UVX A;  4F3I A;  3QZT A;  5CQ4 A;  5C89 A;  4MEO A;  5KHM A;  4Z1Q A;  4HXR A;  4A9O A;  5E0R A;  4CUT A;  4NRC A;  4TU6 A;  4HXP A;  4NUE A;  4WHU A;  5HLS A;  4QUT A;  3DWY A;  2DVR A;  4YBT A;  5F2P A;  4LYI A;  2RI7 A;  5EWV A;  3QZV A;  4FLP A;  5CRZ A;  4HXS A;  5KU3 A;  5A81 A;  4A9K A;  5D3T A;  5CFW A;  3O36 A;  5ENG A;  5F1L A;  4NQM A;  3O33 A;  3AAD A;  2WP1 A;  3LXJ A;  5F1H A;  4Q0N A;  4CUQ A;  4QC1 A;  4QBM A;  4O70 A;  5CUA A;  5C4Q A;  4A9I A;  4O71 A;  5FE3 A;  5H1V A;  4YAD A;  4LR6 A;  4N4F A;  4QEV A;  3P1F A;  4TZ8 A;  4UIZ A;  5HQ5 A;  5HEM A;  4HBW A;  5E73 A;  4NUD A;  4NYV A;  4A9M A;  5EGU A;  5A5P A;  3SVF A;  5I80 A;  4ALG A;  5FE0 A;  5DYA A;  5CU8 A;  5FG4 A;  2NXB A;  2YDW A;  2E7O A;  4N4I A;  5E74 A;  5BT3 A;  3P1E A;  5LVR A;  3IU6 A;  4O74 A;  5I89 A;  4YYI A;  4RVR A;  4IR5 A;  4MR6 A;  4QSQ A;  4YYM A;  3JVK A;  4CFL A;  5ENJ A;  5J0D A;  3U5K A;  3RCW A;  4NR9 A;  5CZG A;  2RO1 A;  5F61 A;  5EVA A;  3I3J A;  4QEW A;  4YYG A;  4A9E A;  4DON A;  3JVL A;  3MXF A;  5DYC A;  4IR3 A;  2R0S A;  5AME A;  5HRW A;  4CUU A;  2RFJ A;  5A85 A;  3S92 A;  4YBS A;  4BW3 A;  5E9M A;  4X2I A;  4O7F A;  2R10 A;  5L97 A;  4Y03 A;  5HM0 A;  4BW1 A;  5BT5 A;  3GG3 A;  1N72 A;  5F62 A;  5E3D A;  4LYW A;  4LDF A;  4IOO A;  4YAT A;  5H1U A;  5CQ7 A;  2GRC A;  2RNX A;  5E9Y A;  2YEK A;  4Z6I A;  5EIS A;  2RNY A;  5F36 A;  5G4R A;  5FE6 A;  2MJV B;  3HME A;  3MB4 A;  4XYA A;  5L99 A;  2YEL A;  3UV5 A;  4J1P A;  2G4A A;  5AD3 A;  5CGP A;  4YBM A;  5JWM A;  4QYD A;  5DLZ A;  5I86 A;  5A83 A;  5EWD A;  5DBM A;  3ONI A;  1E6I A;  4WIV A;  5CQ5 A;  2LSP B;  5DYU A;  4QR3 A;  5F3A A;  3JVM A;  4UIY A;  5HEN A;  1JSP B;  4NR4 A;  5EPS A;  4CFK A;  4UYF B;  5DW1 A;  4HXO A;  5ETB A;  4KV4 A;  5CS8 A;  5I7X A;  3MB3 A;  1WUG A;  4NR5 A;  5F63 A;  4UIU A;  4N4H A;  5FE4 A;  4QEU A;  5LJ2 A;  5D3S A;  4CL9 A;  4YAB A;  4HBX A;  5F60 A;  5D24 A;  5ENI A;  4QSU A;  5LKZ A;  3UV4 A;  4A9L A;  5C7N A;  4QSX A;  5C85 A;  4UYF A;  4LZS A;  3LJW A;  5CUD A;  4ALH A;  4BHW A;  5I29 A;  5COI A;  4QC3 A;  4QR4 A;  4QR5 A;  4O76 A;  4O7B A;  3Q2E A;  5FG5 A;  5L8T A;  3MQM A;  4TT4 A;  5A7C A;  2DAT A;  3K2J A;  2R0Y A;  4XY9 A;  5EIC A;  4CUR A;  5EI4 A;  5ENE A;  4TT2 A;  2KTB B;  4KV1 A;  2RNW A;  3UVY A;  2DKW A;  1JM4 B;  2OO1 A;  5E9V A;  5DFC A;  4CLB A;  4J0R A;  5EWC A;  4YYH A;  2OSS A;  1X0J A;  2F6J A;  5ENF A;  5CQA A;  4MR5 A;  5D7X A;  5CY9 A;  4IR6 A;  4MEQ A;  5E9L A;  3HMF A;  2D82 A;  2D9E A;  2R0V A;  5CRM A;  5ACY A;  4YYN A;  4NR6 A;  4AKN A;  4QST A;  5A5O A;  1EQF A;  4CUP A;  4C66 A;  4UIT A;  4NRB A;  4PKL A;  5LJ1 A;  5FH8 A;  4N4G A;  5D3R A;  4LC2 A;  2E7N A;  5JI8 A;  5LJ0 A;  5DW2 A;  3O34 A;  3S91 A;  4HXL A;  5I7Y A;  5I83 A;  5IGK A;  4QSS A;  5CUG A;  2L84 A;  4O7C A;  5HRV A;  4O75 A;  5LVQ A;  4IOR A;  3NXB A;  5F5Z A;  5LKX A;  3U5N A;  5IBN A;  4J3I A;  3D7C A;  5HJC A;  4YYJ A;  5CUE A;  4E96 A;  5KO4 A;  5EP7 A;  4GPJ A;  4TZ2 A;  5D3P A;  5KTX A;  3UV2 A;  5HCL A;  5ENH A;  2L85 A;  5D0C A;  2DWW A;  5HQ7 A;  3AQA A;  3MUK A;  4N3W A;  2WP2 A;  4ZC9 A;  4ZW1 A;  5HEL A;  4UIV A;  5DKC A;  3LQJ A;  3TLP A;  5DY7 A;  4QSV A;  4OUF A;  4Z93 A;  5L98 A;  4IOQ A;  5A5S A;  5FFY A;  5CP5 A;  5D26 A;  5KTW A; 
#chains in the Genus database with same CATH topology
 5DKH A;  4YK0 A;  5FFW A;  5FH7 A;  3O35 A;  5CQ3 A;  5D3L A;  4HXM A;  3SVH A;  3JVJ A;  4YYK A;  5II1 A;  4QSP A;  5CPE A;  5EWH A;  5K29 A;  4BW2 A;  2N9G A;  4QYL A;  4UIW A;  4PCE A;  5I40 A;  4XY8 A;  4QY4 A;  4NR7 A;  5E9K A;  5D25 A;  5LUU A;  5FG6 A;  4UYD A;  4PCI A;  5AD2 A;  5EPB A;  4MEP A;  4TYL A;  4WHW A;  5FE1 A;  5BT4 A;  5FE8 A;  5TCM A;  3FKM X;  4UYE A;  3HMH A;  5FE2 A;  2I7K A;  5TB6 A;  5ENB A;  5HFQ A;  2EJN A;  2DVQ A;  5HRX A;  5LKU A;  5F25 A;  5A82 A;  5CQ8 A;  4BW4 A;  5A5Q A;  4Z1S A;  5AMF A;  5CTL A;  5E9I A;  4NXJ A;  5I88 A;  5DX4 A;  5LKT A;  4MR4 A;  3UVW A;  5EQ1 A;  4O7A A;  4PY6 A;  3SVG A;  5FE5 A;  5G4S A;  5FE9 A;  3VKH A;  5ENC A;  5FB1 A;  4NRA A;  2E3K A;  4A9N A;  4O78 A;  4TT6 A;  5EU1 A;  4PTB A;  4OGJ A;  4BJX A;  4QZS A;  5H85 A;  5DKD A;  5FFV A;  5FE7 A;  3P5O A;  4QSR A;  5H1T A;  5DYX A;  5EM3 A;  4QNS A;  4YY4 A;  4O77 A;  3Q2F A;  4LYS A;  5C8G A;  3MUL A;  3U5M A;  5I1Q A;  3U5O A;  4TQN A;  5FBX A;  2YW5 A;  4TS8 A;  3DAI A;  4LRG A;  4TU4 A;  4LZ2 A;  5HQ6 A;  4NQN A;  4Q0O A;  5DLX A;  5FDZ A;  4PS5 A;  4Z6H A;  4A9F A;  3ZYU A;  5CQ6 A;  3G0L A;  4ZQL A;  4YYD A;  4UIX A;  2I8N A;  4LZR A;  5EPR A;  4YH3 A;  4XUB A;  2DVV A;  3UVD A;  4O7E A;  5II2 A;  5E3G A;  5E7D A;  4UYH A;  5EK9 A;  5CQT A;  3O37 A;  5EWW A;  2DVS A;  1WUM A;  5CUB A;  5DFD A;  4MR3 A;  4NYX A;  4YC9 A;  4YY6 A;  5C87 A;  5ETD A;  4CUS A;  4QUU A;  4XUA A;  5L8U A;  3U5P A;  4NS5 A;  4YAX A;  4NUC A;  4HBY A;  4YH4 A;  3LQH A;  4NYW A;  2RS9 B;  5DFB A;  5HFR A;  5A5N A;  4A9J A;  2YEM A;  3U5J A;  5A5R A;  5IGM A;  4J0S A;  4AKG A;  2L5E A;  4A9H A;  4OGI A;  3G0J A;  4NR8 A;  4KCX A;  4TTE A;  5FB0 A;  3LQI A;  5IGL A;  1F68 A;  3U5L A;  2FSA A;  4HXK A;  3P1C A;  3IU5 A;  3P1D A;  5FH6 A;  5CUC A;  4QSW A;  4QB3 A;  4C67 A;  1ZS5 A;  2YYN A;  2H60 A;  5IID A;  2F6N A;  5KTU A;  5L96 A;  4UYG A;  5D3H A;  3D1B A;  5IGN A;  4MEN A;  3QZS A;  4HXN A;  5EV9 A;  2OUO A;  2YQD A;  4O72 A;  5D3J A;  5IG6 A;  3UW9 A;  4IR4 A;  5D3N A;  5EA1 A;  4HBV A;  3UVX A;  4F3I A;  3QZT A;  5CQ4 A;  4AKI A;  5C89 A;  4MEO A;  5KHM A;  4Z1Q A;  4HXR A;  4A9O A;  5E0R A;  4CUT A;  4NRC A;  4TU6 A;  4HXP A;  4NUE A;  4WHU A;  5HLS A;  4QUT A;  3DWY A;  3VKG A;  2DVR A;  4YBT A;  5F2P A;  4LYI A;  2RI7 A;  5EWV A;  3QZV A;  4FLP A;  5CRZ A;  4HXS A;  5KU3 A;  5A81 A;  4A9K A;  5D3T A;  5CFW A;  3O36 A;  5ENG A;  5F1L A;  4NQM A;  3O33 A;  3AAD A;  2WP1 A;  3LXJ A;  5F1H A;  4Q0N A;  4CUQ A;  4QC1 A;  4QBM A;  4O70 A;  5CUA A;  3D1D A;  5C4Q A;  4A9I A;  4O71 A;  5FE3 A;  5H1V A;  4YAD A;  4LR6 A;  4N4F A;  4QEV A;  3P1F A;  4TZ8 A;  4UIZ A;  5HQ5 A;  5HEM A;  4HBW A;  5E73 A;  4NUD A;  4NYV A;  4A9M A;  5EGU A;  5A5P A;  3SVF A;  5I80 A;  4ALG A;  5FE0 A;  5DYA A;  5CU8 A;  5FG4 A;  2NXB A;  2YDW A;  2E7O A;  4N4I A;  5E74 A;  5BT3 A;  3P1E A;  5LVR A;  3IU6 A;  4O74 A;  5I89 A;  4YYI A;  4RVR A;  4IR5 A;  4MR6 A;  4QSQ A;  4YYM A;  3JVK A;  4CFL A;  5ENJ A;  5J0D A;  3U5K A;  3RCW A;  4NR9 A;  5CZG A;  2RO1 A;  5F61 A;  5EVA A;  3I3J A;  4QEW A;  4YYG A;  4A9E A;  4DON A;  3JVL A;  3MXF A;  5DYC A;  4IR3 A;  2R0S A;  5AME A;  5HRW A;  4CUU A;  2RFJ A;  5A85 A;  3S92 A;  4YBS A;  4BW3 A;  5E9M A;  4X2I A;  4O7F A;  2R10 A;  5L97 A;  4Y03 A;  5HM0 A;  4BW1 A;  5BT5 A;  3GG3 A;  1N72 A;  5F62 A;  5E3D A;  4LYW A;  4LDF A;  4IOO A;  4YAT A;  5H1U A;  5CQ7 A;  2GRC A;  2RNX A;  5E9Y A;  2YEK A;  4Z6I A;  5EIS A;  2RNY A;  5F36 A;  5G4R A;  5FE6 A;  2MJV B;  3HME A;  3MB4 A;  4XYA A;  5L99 A;  2YEL A;  3UV5 A;  1ZKR A;  4J1P A;  2G4A A;  5AD3 A;  5CGP A;  4YBM A;  5JWM A;  4QYD A;  5DLZ A;  5I86 A;  5A83 A;  5EWD A;  5DBM A;  3ONI A;  1E6I A;  4WIV A;  5CQ5 A;  2LSP B;  5DYU A;  4QR3 A;  5F3A A;  3JVM A;  4UIY A;  5HEN A;  1JSP B;  4NR4 A;  5EPS A;  4CFK A;  4UYF B;  5DW1 A;  4HXO A;  5ETB A;  4AKH A;  4KV4 A;  5CS8 A;  5I7X A;  3MB3 A;  1WUG A;  4NR5 A;  5F63 A;  4UIU A;  4N4H A;  5FE4 A;  4QEU A;  3ERR A;  5LJ2 A;  5D3S A;  4CL9 A;  4YAB A;  4HBX A;  5F60 A;  5D24 A;  5ENI A;  4QSU A;  5LKZ A;  3UV4 A;  4A9L A;  5C7N A;  4QSX A;  5C85 A;  4UYF A;  4LZS A;  3LJW A;  5CUD A;  4ALH A;  4BHW A;  5I29 A;  5COI A;  4QC3 A;  4QR4 A;  4QR5 A;  4O76 A;  4O7B A;  3Q2E A;  5FG5 A;  5L8T A;  3MQM A;  4TT4 A;  5A7C A;  2DAT A;  3K2J A;  2R0Y A;  4XY9 A;  5EIC A;  4CUR A;  5EI4 A;  5ENE A;  4TT2 A;  2KTB B;  4KV1 A;  4AI6 A;  2RNW A;  3UVY A;  2DKW A;  1JM4 B;  2OO1 A;  5E9V A;  5DFC A;  4CLB A;  4J0R A;  5EWC A;  4YYH A;  2OSS A;  1X0J A;  2F6J A;  5ENF A;  5CQA A;  4MR5 A;  5D7X A;  5CY9 A;  4IR6 A;  4MEQ A;  5E9L A;  3HMF A;  2D82 A;  2D9E A;  2R0V A;  5CRM A;  5ACY A;  4YYN A;  4NR6 A;  4AKN A;  4QST A;  5A5O A;  1EQF A;  4CUP A;  4C66 A;  4UIT A;  4NRB A;  4PKL A;  5LJ1 A;  5FH8 A;  4N4G A;  5D3R A;  4LC2 A;  2E7N A;  5JI8 A;  5LJ0 A;  5DW2 A;  3O34 A;  3S91 A;  4HXL A;  5I7Y A;  5I83 A;  5IGK A;  4QSS A;  5CUG A;  2L84 A;  4O7C A;  5HRV A;  4O75 A;  5LVQ A;  4IOR A;  3NXB A;  5F5Z A;  5LKX A;  3U5N A;  5IBN A;  4J3I A;  3D7C A;  5HJC A;  1PUO A;  4YYJ A;  5CUE A;  4E96 A;  5KO4 A;  5EP7 A;  4GPJ A;  4TZ2 A;  5D3P A;  5KTX A;  3UV2 A;  5HCL A;  5ENH A;  2L85 A;  5D0C A;  2DWW A;  5HQ7 A;  3AQA A;  3MUK A;  4N3W A;  2WP2 A;  4ZC9 A;  4ZW1 A;  5HEL A;  4UIV A;  5DKC A;  3LQJ A;  3TLP A;  5DY7 A;  4QSV A;  4OUF A;  4Z93 A;  5L98 A;  4IOQ A;  5A5S A;  5FFY A;  5CP5 A;  5D26 A;  5KTW A; 
#chains in the Genus database with same CATH homology
 5DKH A;  4YK0 A;  5FFW A;  5FH7 A;  3O35 A;  5CQ3 A;  5D3L A;  4HXM A;  3SVH A;  3JVJ A;  4YYK A;  5II1 A;  4QSP A;  5CPE A;  5EWH A;  5K29 A;  4BW2 A;  2N9G A;  4QYL A;  4UIW A;  4PCE A;  5I40 A;  4XY8 A;  4QY4 A;  4NR7 A;  5E9K A;  5D25 A;  5LUU A;  5FG6 A;  4UYD A;  4PCI A;  5AD2 A;  5EPB A;  4MEP A;  4TYL A;  4WHW A;  5FE1 A;  5BT4 A;  5FE8 A;  5TCM A;  3FKM X;  4UYE A;  3HMH A;  5FE2 A;  2I7K A;  5TB6 A;  5ENB A;  5HFQ A;  2DVQ A;  5HRX A;  5LKU A;  5F25 A;  5A82 A;  5CQ8 A;  4BW4 A;  5A5Q A;  4Z1S A;  5AMF A;  5CTL A;  5E9I A;  4NXJ A;  5I88 A;  5DX4 A;  5LKT A;  4MR4 A;  3UVW A;  5EQ1 A;  4O7A A;  4PY6 A;  3SVG A;  5FE5 A;  5G4S A;  5FE9 A;  5ENC A;  5FB1 A;  4NRA A;  2E3K A;  4A9N A;  4O78 A;  4TT6 A;  5EU1 A;  4PTB A;  4OGJ A;  4BJX A;  4QZS A;  5H85 A;  5DKD A;  5FFV A;  5FE7 A;  3P5O A;  4QSR A;  5H1T A;  5DYX A;  5EM3 A;  4QNS A;  4YY4 A;  4O77 A;  3Q2F A;  4LYS A;  5C8G A;  3MUL A;  3U5M A;  5I1Q A;  3U5O A;  4TQN A;  5FBX A;  2YW5 A;  4TS8 A;  3DAI A;  4LRG A;  4TU4 A;  4LZ2 A;  5HQ6 A;  4NQN A;  4Q0O A;  5DLX A;  5FDZ A;  4PS5 A;  4Z6H A;  4A9F A;  3ZYU A;  5CQ6 A;  3G0L A;  4ZQL A;  4YYD A;  4UIX A;  2I8N A;  4LZR A;  5EPR A;  4YH3 A;  4XUB A;  2DVV A;  3UVD A;  4O7E A;  5II2 A;  5E3G A;  5E7D A;  4UYH A;  5EK9 A;  5CQT A;  3O37 A;  5EWW A;  2DVS A;  1WUM A;  5CUB A;  5DFD A;  4MR3 A;  4NYX A;  4YC9 A;  4YY6 A;  5C87 A;  5ETD A;  4CUS A;  4QUU A;  4XUA A;  5L8U A;  3U5P A;  4NS5 A;  4YAX A;  4NUC A;  4HBY A;  4YH4 A;  3LQH A;  4NYW A;  2RS9 B;  5DFB A;  5HFR A;  5A5N A;  4A9J A;  2YEM A;  3U5J A;  5A5R A;  5IGM A;  4J0S A;  2L5E A;  4A9H A;  4OGI A;  3G0J A;  4NR8 A;  4KCX A;  4TTE A;  5FB0 A;  3LQI A;  5IGL A;  1F68 A;  3U5L A;  2FSA A;  4HXK A;  3P1C A;  3IU5 A;  3P1D A;  5FH6 A;  5CUC A;  4QSW A;  4QB3 A;  4C67 A;  1ZS5 A;  2YYN A;  2H60 A;  5IID A;  2F6N A;  5KTU A;  5L96 A;  4UYG A;  5D3H A;  5IGN A;  4MEN A;  3QZS A;  4HXN A;  5EV9 A;  2OUO A;  2YQD A;  4O72 A;  5D3J A;  5IG6 A;  3UW9 A;  4IR4 A;  5D3N A;  5EA1 A;  4HBV A;  3UVX A;  4F3I A;  3QZT A;  5CQ4 A;  5C89 A;  4MEO A;  5KHM A;  4Z1Q A;  4HXR A;  4A9O A;  5E0R A;  4CUT A;  4NRC A;  4TU6 A;  4HXP A;  4NUE A;  4WHU A;  5HLS A;  4QUT A;  3DWY A;  2DVR A;  4YBT A;  5F2P A;  4LYI A;  2RI7 A;  5EWV A;  3QZV A;  4FLP A;  5CRZ A;  4HXS A;  5KU3 A;  5A81 A;  4A9K A;  5D3T A;  5CFW A;  3O36 A;  5ENG A;  5F1L A;  4NQM A;  3O33 A;  3AAD A;  2WP1 A;  3LXJ A;  5F1H A;  4Q0N A;  4CUQ A;  4QC1 A;  4QBM A;  4O70 A;  5CUA A;  5C4Q A;  4A9I A;  4O71 A;  5FE3 A;  5H1V A;  4YAD A;  4LR6 A;  4N4F A;  4QEV A;  3P1F A;  4TZ8 A;  4UIZ A;  5HQ5 A;  5HEM A;  4HBW A;  5E73 A;  4NUD A;  4NYV A;  4A9M A;  5EGU A;  5A5P A;  3SVF A;  5I80 A;  4ALG A;  5FE0 A;  5DYA A;  5CU8 A;  5FG4 A;  2NXB A;  2YDW A;  2E7O A;  4N4I A;  5E74 A;  5BT3 A;  3P1E A;  5LVR A;  3IU6 A;  4O74 A;  5I89 A;  4YYI A;  4RVR A;  4IR5 A;  4MR6 A;  4QSQ A;  4YYM A;  3JVK A;  4CFL A;  5ENJ A;  5J0D A;  3U5K A;  3RCW A;  4NR9 A;  5CZG A;  2RO1 A;  5F61 A;  5EVA A;  3I3J A;  4QEW A;  4YYG A;  4A9E A;  4DON A;  3JVL A;  3MXF A;  5DYC A;  4IR3 A;  2R0S A;  5AME A;  5HRW A;  4CUU A;  2RFJ A;  5A85 A;  3S92 A;  4YBS A;  4BW3 A;  5E9M A;  4X2I A;  4O7F A;  2R10 A;  5L97 A;  4Y03 A;  5HM0 A;  4BW1 A;  5BT5 A;  3GG3 A;  1N72 A;  5F62 A;  5E3D A;  4LYW A;  4LDF A;  4IOO A;  4YAT A;  5H1U A;  5CQ7 A;  2GRC A;  2RNX A;  5E9Y A;  2YEK A;  4Z6I A;  5EIS A;  2RNY A;  5F36 A;  5G4R A;  5FE6 A;  2MJV B;  3HME A;  3MB4 A;  4XYA A;  5L99 A;  2YEL A;  3UV5 A;  4J1P A;  2G4A A;  5AD3 A;  5CGP A;  4YBM A;  5JWM A;  4QYD A;  5DLZ A;  5I86 A;  5A83 A;  5EWD A;  5DBM A;  3ONI A;  1E6I A;  4WIV A;  5CQ5 A;  2LSP B;  5DYU A;  4QR3 A;  5F3A A;  3JVM A;  4UIY A;  5HEN A;  1JSP B;  4NR4 A;  5EPS A;  4CFK A;  4UYF B;  5DW1 A;  4HXO A;  5ETB A;  4KV4 A;  5CS8 A;  5I7X A;  3MB3 A;  1WUG A;  4NR5 A;  5F63 A;  4UIU A;  4N4H A;  5FE4 A;  4QEU A;  5LJ2 A;  5D3S A;  4CL9 A;  4YAB A;  4HBX A;  5F60 A;  5D24 A;  5ENI A;  4QSU A;  5LKZ A;  3UV4 A;  4A9L A;  5C7N A;  4QSX A;  5C85 A;  4UYF A;  4LZS A;  3LJW A;  5CUD A;  4ALH A;  4BHW A;  5I29 A;  5COI A;  4QC3 A;  4QR4 A;  4QR5 A;  4O76 A;  4O7B A;  3Q2E A;  5FG5 A;  5L8T A;  3MQM A;  4TT4 A;  5A7C A;  2DAT A;  3K2J A;  2R0Y A;  4XY9 A;  5EIC A;  4CUR A;  5EI4 A;  5ENE A;  4TT2 A;  2KTB B;  4KV1 A;  2RNW A;  3UVY A;  2DKW A;  1JM4 B;  2OO1 A;  5E9V A;  5DFC A;  4CLB A;  4J0R A;  5EWC A;  4YYH A;  2OSS A;  1X0J A;  2F6J A;  5ENF A;  5CQA A;  4MR5 A;  5D7X A;  5CY9 A;  4IR6 A;  4MEQ A;  5E9L A;  3HMF A;  2D82 A;  2D9E A;  2R0V A;  5CRM A;  5ACY A;  4YYN A;  4NR6 A;  4AKN A;  4QST A;  5A5O A;  1EQF A;  4CUP A;  4C66 A;  4UIT A;  4NRB A;  4PKL A;  5LJ1 A;  5FH8 A;  4N4G A;  5D3R A;  4LC2 A;  2E7N A;  5JI8 A;  5LJ0 A;  5DW2 A;  3O34 A;  3S91 A;  4HXL A;  5I7Y A;  5I83 A;  5IGK A;  4QSS A;  5CUG A;  2L84 A;  4O7C A;  5HRV A;  4O75 A;  5LVQ A;  4IOR A;  3NXB A;  5F5Z A;  5LKX A;  3U5N A;  5IBN A;  4J3I A;  3D7C A;  5HJC A;  4YYJ A;  5CUE A;  4E96 A;  5KO4 A;  5EP7 A;  4GPJ A;  4TZ2 A;  5D3P A;  5KTX A;  3UV2 A;  5HCL A;  5ENH A;  2L85 A;  5D0C A;  2DWW A;  5HQ7 A;  3AQA A;  3MUK A;  4N3W A;  2WP2 A;  4ZC9 A;  4ZW1 A;  5HEL A;  4UIV A;  5DKC A;  3LQJ A;  3TLP A;  5DY7 A;  4QSV A;  4OUF A;  4Z93 A;  5L98 A;  4IOQ A;  5A5S A;  5FFY A;  5CP5 A;  5D26 A;  5KTW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...