4TS8A

Crystal structure of the bromodomain of human crebbp in complex with xz08
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
112
structure length
112
Chain Sequence
FKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords CREB-binding protein
publication title Crystal structure of the bromodomain of human CREBBP in complex with XZ08
rcsb
source organism Homo sapiens
total genus 42
structure length 112
sequence length 112
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2014-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4ts8A00
4PTBA 4QR4A 5L98A 4UYDA 4AKNA 3UVWA 4XY9A 3U5LA 5A5OA 2YEKA 3O35A 5ENIA 5IG6A 3UV2A 3QZVA 5A83A 3LQJA 5D3PA 3MXFA 4NS5A 3IU6A 5LUUA 5LVQA 5CRMA 2OSSA 2RNWA 2RNXA 3FKMX 5ETDA 5CQ7A 4CFLA 4TTEA 2LSPB 5FFWA 5I7YA 5ENHA 2YELA 4QEUA 4HXLA 4QSUA 5LVRA 4UIXA 4NR9A 5A82A 4QSQA 5FH6A 5E3GA 2R0VA 5E9VA 3S92A 5DKDA 5E73A 4YBSA 4NUDA 4CL9A 3UVYA 4C66A 4N3WA 5EP7A 5I86A 4BHWA 2MJVB 4QEVA 4YY6A 4YYGA 2WP1A 5L8TA 4Z6HA 4YYIA 4YYJA 2RS9B 4ZQLA 4LDFA 5L96A 5F61A 5IGLA 4TZ2A 5HFQA 4YYKA 4KCXA 4A9LA 1X0JA 5FDZA 4N4FA 5I83A 5BT3A 4LZRA 4TT6A 3MB3A 4J1PA 3UW9A 4A9MA 4A9JA 4TT2A 5ENJA 4QUTA 5I7XA 4IOQA 3K2JA 5HQ5A 5L97A 4NRAA 2RI7A 4PKLA 2DWWA 5C89A 5LJ2A 5DW2A 4QR3A 2RFJA 4A9IA 4HXPA 5DLZA 5EPBA 4O78A 5F60A 3MUKA 4HBVA 4WIVA 5DBMA 4QSPA 5CUCA 5CGPA 4O77A 3MB4A 5KO4A 3LQHA 5D24A 2DKWA 4MR5A 4YATA 5G4SA 4IR5A 5A7CA 5CQ6A 3U5PA 4TU6A 5E3DA 1JSPB 4PCIA 4NUCA 5C8GA 4O71A 4YK0A 5LKZA 2YW5A 2OO1A 5EWWA 4Z1SA 2FSAA 5E0RA 5EPSA 5DLXA 3O37A 2L5EA 3P1FA 4YABA 4LYWA 5FE5A 4WHUA 4Q0NA 5CQ4A 5FG6A 4QUUA 5E9LA 4A9EA 5FFYA 5EU1A 5F63A 4QYLA 5DW1A 5LKXA 5H1UA 5FE7A 4CURA 5EWDA 2OUOA 5CS8A 4QB3A 4LYSA 2DATA 5A81A 5A5QA 5DFBA 5LKTA 5ENCA 4YYDA 2NXBA 4CUQA 5FFVA 4FLPA 4UYFA 4NUEA 2G4AA 4J0RA 4NR6A 5KHMA 1F68A 4A9NA 2H60A 4YBTA 4N4IA 5EWCA 4QSVA 5FE0A 5KTXA 5DFCA 5CY9A 1WUGA 2F6JA 5E9IA 4XYAA 4LC2A 4NR7A 4QBMA 5DYUA 4MEPA 5ACYA 5F36A 5DKHA 3I3JA 4N4GA 5IGNA 4ZC9A 4UYGA 4HXOA 5I1QA 5D3RA 3MQMA 3U5NA 5FH8A 4IORA 5KTWA 4O75A 4O7FA 5J0DA 5CQ3A 5EWVA 4QR5A 4HXNA 4LZSA 2DVSA 4ZW1A 3O34A 5FG4A 4TS8A 3RCWA 5FB1A 4O72A 2WP2A 4QSTA 5F5ZA 5CQTA 2YYNA 5JWMA 4OGIA 4XY8A 5ENEA 5FG5A 5HJCA 4PY6A 3ZYUA 3GG3A 4UIUA 4MR6A 5C85A 5F62A 3U5OA 4BW2A 5C4QA 5FE4A 3U5JA 2YDWA 3TLPA 3LQIA 4C67A 5D25A 4HXSA 2GRCA 5H1VA 4HBWA 3S91A 5EWHA 5F1HA 5HRVA 4NR8A 4NR5A 2R0SA 4NYXA 1E6IA 5EQ1A 5EPRA 5ENFA 4CFKA 4HBXA 5FE8A 3Q2EA 5CQ8A 4UITA 3MULA 4GPJA 2I7KA 5E7DA 4OUFA 5II2A 3P1CA 5A5RA 4ALHA 5HRWA 2E3KA 5L99A 4UIZA 1EQFA 1N72A 4O7BA 5CPEA 5FH7A 5G4RA 3JVKA 3LXJA 4UYFB 4TU4A 4NXJA 4PS5A 5HM0A 5A85A 4YYHA 4CUUA 3SVGA 3JVMA 5F2PA 4QSSA 5H85A 2YQDA 4UYEA 5AD3A 5IIDA 5KU3A 4LR6A 2E7OA 5HCLA 4Z93A 5FBXA 5D7XA 4IOOA 4YYNA 5E9MA 5AMEA 4A9FA 4YH4A 2R0YA 5EGUA 3ONIA 5FE6A 5IGMA 2DVVA 3HMEA 5BT5A 5AMFA 5A5PA 5KTUA 5A5SA 4QSWA 2L85A 4TZ8A 5EA1A 5H1TA 5COIA 4CUSA 3QZSA 5HFRA 4NYVA 4UYHA 4Z6IA 4F3IA 5LJ1A 5DY7A 3G0LA 5DKCA 3Q2FA 2F6NA 4MR3A 5C7NA 5E9KA 2DVQA 3JVJA 5ETBA 5CUEA 4UIWA 4QZSA 3P5OA 5LKUA 4TYLA 3DAIA 4WHWA 4NR4A 4BW4A 5BT4A 2D9EA 5D3LA 4O70A 4UIYA 1WUMA 5CUGA 3LJWA 4X2IA 4NYWA 4TT4A 4XUBA 5HLSA 4BW3A 4HXRA 4YC9A 4YBMA 5FE9A 5CZGA 5DYXA 3P1DA 4QC3A 4QC1A 4YAXA 5D3JA 4QEWA 5CU8A 4YH3A 4HXKA 4QSXA 5JI8A 5HENA 4QNSA 4J3IA 5I88A 4OGJA 3P1EA 5IGKA 3SVHA 5D3HA 4O7EA 5CFWA 5D3TA 4TQNA 4MR4A 4MEOA 5E74A 4A9KA 5EK9A 4YADA 5CUDA 4DONA 5A5NA 4CUTA 5EVAA 5CP5A 5FB0A 4NQMA 5HRXA 5HELA 4NRCA 5EISA 5FE3A 3AQAA 4O7AA 4IR3A 4IR6A 4A9OA 4O76A 3D7CA 4Y03A 5EI4A 5ENGA 5II1A 4O7CA 5CUBA 4CUPA 5C87A 1JM4B 3G0JA 5LJ0A 4J0SA 3UV4A 4CLBA 5CUAA 5AD2A 4BJXA 3HMHA 3QZTA 5EICA 4YYMA 4LZ2A 2KTBB 2RNYA 5EV9A 4YY4A 5D26A 2E7NA 5CTLA 5D3SA 5DYAA 4QY4A 5I40A 5HQ6A 4LRGA 2D82A 2RO1A 2L84A 5CQAA 2R10A 4BW1A 5CRZA 3UVDA 2YEMA 4HXMA 3NXBA 5DX4A 4ALGA 3UVXA 4NQNA 4IR4A 4KV4A 4A9HA 4MEQA 5F25A 5EM3A 4QSRA 4Q0OA 4KV1A 4QYDA 5L8UA 5D3NA 4PCEA 5HEMA 4MENA 5I80A 5DYCA 5HQ7A 4LYIA 3O33A 5ENBA 3HMFA 3AADA 4UIVA 3JVLA 5CQ5A 4Z1QA 1ZS5A 5FE1A 5DFDA 5I89A 3IU5A 2N9GA 3U5MA 5TCMA 4N4HA 3U5KA 4RVRA 5F3AA 5FE2A 5F1LA 5I29A 3SVFA 4O74A 5E9YA 3DWYA 3O36A 5TB6A 4E96A 2I8NA 3UV5A 2DVRA 4HBYA 5K29A 5IBNA 4NRBA 4XUAA 5D0CA
chains in the Genus database with same CATH superfamily
4PTBA 4QR4A 5L98A 4UYDA 4AKNA 3UVWA 4XY9A 3U5LA 5A5OA 2YEKA 3O35A 5ENIA 5IG6A 3UV2A 3QZVA 5A83A 3LQJA 5D3PA 3MXFA 4NS5A 3IU6A 5LUUA 5LVQA 5CRMA 2OSSA 2RNWA 2RNXA 3FKMX 5ETDA 5CQ7A 4CFLA 4TTEA 2LSPB 5FFWA 5I7YA 5ENHA 2YELA 4QEUA 4HXLA 4QSUA 5LVRA 4UIXA 4NR9A 5A82A 4QSQA 5FH6A 5E3GA 2R0VA 5E9VA 3S92A 5DKDA 5E73A 4YBSA 4NUDA 4CL9A 3UVYA 4C66A 4N3WA 5EP7A 5I86A 4BHWA 2MJVB 4QEVA 4YY6A 4YYGA 2WP1A 5L8TA 4Z6HA 4YYIA 4YYJA 2RS9B 4ZQLA 4LDFA 5L96A 5F61A 5IGLA 4TZ2A 5HFQA 4YYKA 4KCXA 4A9LA 1X0JA 5FDZA 4N4FA 5I83A 5BT3A 4LZRA 4TT6A 3VKHA 3MB3A 4J1PA 3UW9A 4A9MA 4A9JA 4TT2A 5ENJA 4QUTA 5I7XA 4IOQA 3K2JA 5HQ5A 5L97A 4NRAA 2RI7A 4PKLA 2DWWA 5C89A 5LJ2A 5DW2A 4QR3A 2RFJA 4A9IA 4HXPA 5DLZA 5EPBA 4O78A 5F60A 3MUKA 4HBVA 4WIVA 5DBMA 4QSPA 5CUCA 5CGPA 4O77A 3MB4A 5KO4A 3LQHA 5D24A 2DKWA 4MR5A 4YATA 5G4SA 4IR5A 5A7CA 5CQ6A 3U5PA 4TU6A 5E3DA 1JSPB 4PCIA 4NUCA 5C8GA 4O71A 4YK0A 5LKZA 2YW5A 2OO1A 5EWWA 3ERRA 4Z1SA 2FSAA 5E0RA 5EPSA 5DLXA 3O37A 2L5EA 3P1FA 4YABA 4LYWA 5FE5A 4WHUA 4Q0NA 5CQ4A 5FG6A 4QUUA 5E9LA 4A9EA 5FFYA 5EU1A 5F63A 4AKGA 4QYLA 5DW1A 5LKXA 5H1UA 5FE7A 4CURA 5EWDA 2OUOA 5CS8A 4QB3A 4LYSA 2DATA 5A81A 5A5QA 5DFBA 5LKTA 5ENCA 4YYDA 2NXBA 4CUQA 5FFVA 4FLPA 4UYFA 4NUEA 2G4AA 4J0RA 4NR6A 5KHMA 1F68A 4A9NA 2H60A 4YBTA 4N4IA 5EWCA 4QSVA 5FE0A 5KTXA 5DFCA 5CY9A 1WUGA 2F6JA 5E9IA 4XYAA 4LC2A 4NR7A 4QBMA 5DYUA 4MEPA 5ACYA 5F36A 5DKHA 3I3JA 4N4GA 5IGNA 4ZC9A 4UYGA 4HXOA 5I1QA 5D3RA 3MQMA 3U5NA 4AI6A 5FH8A 4IORA 5KTWA 4O75A 4O7FA 5J0DA 5CQ3A 5EWVA 4QR5A 4HXNA 4LZSA 2DVSA 4ZW1A 3O34A 5FG4A 4TS8A 3RCWA 5FB1A 4O72A 2WP2A 4QSTA 5F5ZA 5CQTA 2YYNA 5JWMA 4OGIA 4XY8A 5ENEA 5FG5A 5HJCA 4PY6A 3ZYUA 3GG3A 4UIUA 3VKGA 4MR6A 5C85A 5F62A 3U5OA 4BW2A 5C4QA 5FE4A 3U5JA 2YDWA 3TLPA 3D1DA 3LQIA 4C67A 5D25A 4HXSA 2GRCA 5H1VA 4HBWA 3S91A 5EWHA 5F1HA 5HRVA 4NR8A 4NR5A 2R0SA 4NYXA 1E6IA 5EQ1A 5EPRA 5ENFA 4CFKA 4HBXA 5FE8A 3Q2EA 5CQ8A 4UITA 3MULA 4GPJA 2I7KA 5E7DA 4OUFA 5II2A 3P1CA 5A5RA 4ALHA 5HRWA 2E3KA 5L99A 4UIZA 1PUOA 1EQFA 1N72A 4O7BA 5CPEA 5FH7A 5G4RA 3JVKA 3LXJA 4UYFB 4TU4A 4NXJA 4PS5A 5HM0A 5A85A 4YYHA 4CUUA 3SVGA 3JVMA 3D1BA 4QSSA 5F2PA 5H85A 2YQDA 4UYEA 5AD3A 5IIDA 5KU3A 4LR6A 2E7OA 5HCLA 4Z93A 5FBXA 5D7XA 4IOOA 4AKIA 4YYNA 5E9MA 5AMEA 4A9FA 4YH4A 2R0YA 5EGUA 3ONIA 5FE6A 5IGMA 2DVVA 3HMEA 5BT5A 5AMFA 5A5PA 5KTUA 5A5SA 4QSWA 2L85A 4TZ8A 5EA1A 5H1TA 5COIA 4CUSA 3QZSA 5HFRA 4NYVA 4UYHA 4Z6IA 4F3IA 5LJ1A 5DY7A 3G0LA 4AKHA 5DKCA 3Q2FA 2F6NA 4MR3A 5C7NA 5E9KA 2DVQA 3JVJA 5ETBA 5CUEA 4UIWA 4QZSA 3P5OA 5LKUA 4TYLA 3DAIA 4WHWA 4NR4A 4BW4A 5BT4A 2D9EA 5D3LA 4O70A 4UIYA 1WUMA 5CUGA 3LJWA 4X2IA 4NYWA 4TT4A 4XUBA 5HLSA 4BW3A 4HXRA 4YC9A 4YBMA 5FE9A 5CZGA 5DYXA 3P1DA 4QC3A 4QC1A 4YAXA 5D3JA 4QEWA 5CU8A 4YH3A 4HXKA 4QSXA 5JI8A 5HENA 4QNSA 4J3IA 5I88A 4OGJA 3P1EA 5IGKA 3SVHA 5D3HA 4O7EA 5CFWA 5D3TA 4TQNA 4MR4A 4MEOA 5E74A 4A9KA 5EK9A 4YADA 5CUDA 4DONA 5A5NA 4CUTA 5EVAA 5CP5A 5FB0A 4NQMA 5HRXA 5HELA 4NRCA 5EISA 5FE3A 3AQAA 4O7AA 4IR3A 4IR6A 4A9OA 4O76A 3D7CA 4Y03A 5EI4A 5ENGA 5II1A 4O7CA 5CUBA 4CUPA 2EJNA 5C87A 1JM4B 3G0JA 5LJ0A 4J0SA 3UV4A 4CLBA 5CUAA 5AD2A 4BJXA 3HMHA 3QZTA 5EICA 4YYMA 4LZ2A 2KTBB 2RNYA 5EV9A 4YY4A 5D26A 2E7NA 5CTLA 5D3SA 5DYAA 4QY4A 5I40A 5HQ6A 4LRGA 2D82A 1ZKRA 2RO1A 2L84A 5CQAA 2R10A 4BW1A 5CRZA 3UVDA 2YEMA 4HXMA 3NXBA 5DX4A 4ALGA 3UVXA 4NQNA 4IR4A 4KV4A 4A9HA 4MEQA 5F25A 5EM3A 4QSRA 4Q0OA 4KV1A 4QYDA 5L8UA 5D3NA 4PCEA 5HEMA 4MENA 5I80A 5DYCA 5HQ7A 4LYIA 3O33A 5ENBA 3HMFA 3AADA 4UIVA 3JVLA 5CQ5A 4Z1QA 1ZS5A 5FE1A 5DFDA 5I89A 3IU5A 2N9GA 3U5MA 5TCMA 4N4HA 3U5KA 4RVRA 5F3AA 5FE2A 5F1LA 5I29A 3SVFA 4O74A 5E9YA 3DWYA 3O36A 5TB6A 4E96A 2I8NA 3UV5A 2DVRA 4HBYA 5K29A 5IBNA 4NRBA 4XUAA 5D0CA
chains in the Genus database with same CATH topology
4PTBA 4QR4A 5L98A 4UYDA 4AKNA 3UVWA 4XY9A 3U5LA 5A5OA 2YEKA 3O35A 5ENIA 5IG6A 3UV2A 3QZVA 5A83A 3LQJA 5D3PA 3MXFA 4NS5A 3IU6A 5LUUA 5LVQA 5CRMA 2OSSA 2RNWA 2RNXA 3FKMX 5ETDA 5CQ7A 4CFLA 4TTEA 2LSPB 5FFWA 5I7YA 5ENHA 2YELA 4QEUA 4HXLA 4QSUA 5LVRA 4UIXA 4NR9A 5A82A 4QSQA 5FH6A 5E3GA 2R0VA 5E9VA 3S92A 5DKDA 5E73A 4YBSA 4NUDA 4CL9A 3UVYA 4C66A 4N3WA 5EP7A 5I86A 4BHWA 2MJVB 4QEVA 4YY6A 4YYGA 2WP1A 5L8TA 4Z6HA 4YYIA 4YYJA 2RS9B 4ZQLA 4LDFA 5L96A 5F61A 5IGLA 4TZ2A 5HFQA 4YYKA 4KCXA 4A9LA 1X0JA 5FDZA 4N4FA 5I83A 5BT3A 4LZRA 4TT6A 3MB3A 4J1PA 3UW9A 4A9MA 4A9JA 4TT2A 5ENJA 4QUTA 5I7XA 4IOQA 3K2JA 5HQ5A 5L97A 4NRAA 2RI7A 4PKLA 2DWWA 5C89A 5LJ2A 5DW2A 4QR3A 2RFJA 4A9IA 4HXPA 5DLZA 5EPBA 4O78A 5F60A 3MUKA 4HBVA 4WIVA 5DBMA 4QSPA 5CUCA 5CGPA 4O77A 3MB4A 5KO4A 3LQHA 5D24A 2DKWA 4MR5A 4YATA 5G4SA 4IR5A 5A7CA 5CQ6A 3U5PA 4TU6A 5E3DA 1JSPB 4PCIA 4NUCA 5C8GA 4O71A 4YK0A 5LKZA 2YW5A 2OO1A 5EWWA 4Z1SA 2FSAA 5E0RA 5EPSA 5DLXA 3O37A 2L5EA 3P1FA 4YABA 4LYWA 5FE5A 4WHUA 4Q0NA 5CQ4A 5FG6A 4QUUA 5E9LA 4A9EA 5FFYA 5EU1A 5F63A 4QYLA 5DW1A 5LKXA 5H1UA 5FE7A 4CURA 5EWDA 2OUOA 5CS8A 4QB3A 4LYSA 2DATA 5A81A 5A5QA 5DFBA 5LKTA 5ENCA 4YYDA 2NXBA 4CUQA 5FFVA 4FLPA 4UYFA 4NUEA 2G4AA 4J0RA 4NR6A 5KHMA 1F68A 4A9NA 2H60A 4YBTA 4N4IA 5EWCA 4QSVA 5FE0A 5KTXA 5DFCA 5CY9A 1WUGA 2F6JA 5E9IA 4XYAA 4LC2A 4NR7A 4QBMA 5DYUA 4MEPA 5ACYA 5F36A 5DKHA 3I3JA 4N4GA 5IGNA 4ZC9A 4UYGA 4HXOA 5I1QA 5D3RA 3MQMA 3U5NA 5FH8A 4IORA 5KTWA 4O75A 4O7FA 5J0DA 5CQ3A 5EWVA 4QR5A 4HXNA 4LZSA 2DVSA 4ZW1A 3O34A 5FG4A 4TS8A 3RCWA 5FB1A 4O72A 2WP2A 4QSTA 5F5ZA 5CQTA 2YYNA 5JWMA 4OGIA 4XY8A 5ENEA 5FG5A 5HJCA 4PY6A 3ZYUA 3GG3A 4UIUA 4MR6A 5C85A 5F62A 3U5OA 4BW2A 5C4QA 5FE4A 3U5JA 2YDWA 3TLPA 3LQIA 4C67A 5D25A 4HXSA 2GRCA 5H1VA 4HBWA 3S91A 5EWHA 5F1HA 5HRVA 4NR8A 4NR5A 2R0SA 4NYXA 1E6IA 5EQ1A 5EPRA 5ENFA 4CFKA 4HBXA 5FE8A 3Q2EA 5CQ8A 4UITA 3MULA 4GPJA 2I7KA 5E7DA 4OUFA 5II2A 3P1CA 5A5RA 4ALHA 5HRWA 2E3KA 5L99A 4UIZA 1EQFA 1N72A 4O7BA 5CPEA 5FH7A 5G4RA 3JVKA 3LXJA 4UYFB 4TU4A 4NXJA 4PS5A 5HM0A 5A85A 4YYHA 4CUUA 3SVGA 3JVMA 5F2PA 4QSSA 5H85A 2YQDA 4UYEA 5AD3A 5IIDA 5KU3A 4LR6A 2E7OA 5HCLA 4Z93A 5FBXA 5D7XA 4IOOA 4YYNA 5E9MA 5AMEA 4A9FA 4YH4A 2R0YA 5EGUA 3ONIA 5FE6A 5IGMA 2DVVA 3HMEA 5BT5A 5AMFA 5A5PA 5KTUA 5A5SA 4QSWA 2L85A 4TZ8A 5EA1A 5H1TA 5COIA 4CUSA 3QZSA 5HFRA 4NYVA 4UYHA 4Z6IA 4F3IA 5LJ1A 5DY7A 3G0LA 5DKCA 3Q2FA 2F6NA 4MR3A 5C7NA 5E9KA 2DVQA 3JVJA 5ETBA 5CUEA 4UIWA 4QZSA 3P5OA 5LKUA 4TYLA 3DAIA 4WHWA 4NR4A 4BW4A 5BT4A 2D9EA 5D3LA 4O70A 4UIYA 1WUMA 5CUGA 3LJWA 4X2IA 4NYWA 4TT4A 4XUBA 5HLSA 4BW3A 4HXRA 4YC9A 4YBMA 5FE9A 5CZGA 5DYXA 3P1DA 4QC3A 4QC1A 4YAXA 5D3JA 4QEWA 5CU8A 4YH3A 4HXKA 4QSXA 5JI8A 5HENA 4QNSA 4J3IA 5I88A 4OGJA 3P1EA 5IGKA 3SVHA 5D3HA 4O7EA 5CFWA 5D3TA 4TQNA 4MR4A 4MEOA 5E74A 4A9KA 5EK9A 4YADA 5CUDA 4DONA 5A5NA 4CUTA 5EVAA 5CP5A 5FB0A 4NQMA 5HRXA 5HELA 4NRCA 5EISA 5FE3A 3AQAA 4O7AA 4IR3A 4IR6A 4A9OA 4O76A 3D7CA 4Y03A 5EI4A 5ENGA 5II1A 4O7CA 5CUBA 4CUPA 5C87A 1JM4B 3G0JA 5LJ0A 4J0SA 3UV4A 4CLBA 5CUAA 5AD2A 4BJXA 3HMHA 3QZTA 5EICA 4YYMA 4LZ2A 2KTBB 2RNYA 5EV9A 4YY4A 5D26A 2E7NA 5CTLA 5D3SA 5DYAA 4QY4A 5I40A 5HQ6A 4LRGA 2D82A 2RO1A 2L84A 5CQAA 2R10A 4BW1A 5CRZA 3UVDA 2YEMA 4HXMA 3NXBA 5DX4A 4ALGA 3UVXA 4NQNA 4IR4A 4KV4A 4A9HA 4MEQA 5F25A 5EM3A 4QSRA 4Q0OA 4KV1A 4QYDA 5L8UA 5D3NA 4PCEA 5HEMA 4MENA 5I80A 5DYCA 5HQ7A 4LYIA 3O33A 5ENBA 3HMFA 3AADA 4UIVA 3JVLA 5CQ5A 4Z1QA 1ZS5A 5FE1A 5DFDA 5I89A 3IU5A 2N9GA 3U5MA 5TCMA 4N4HA 3U5KA 4RVRA 5F3AA 5FE2A 5F1LA 5I29A 3SVFA 4O74A 5E9YA 3DWYA 3O36A 5TB6A 4E96A 2I8NA 3UV5A 2DVRA 4HBYA 5K29A 5IBNA 4NRBA 4XUAA 5D0CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PTB A;  4QR4 A;  5L98 A;  4UYD A;  4AKN A;  3UVW A;  4XY9 A;  3U5L A;  5A5O A;  2YEK A;  3O35 A;  5ENI A;  5IG6 A;  3UV2 A;  3QZV A;  5A83 A;  3LQJ A;  5D3P A;  3MXF A;  4NS5 A;  3IU6 A;  5LUU A;  5LVQ A;  5CRM A;  2OSS A;  2RNW A;  2RNX A;  3FKM X;  5ETD A;  5CQ7 A;  4CFL A;  4TTE A;  2LSP B;  5FFW A;  5I7Y A;  5ENH A;  2YEL A;  4QEU A;  4HXL A;  4QSU A;  5LVR A;  4UIX A;  4NR9 A;  5A82 A;  4QSQ A;  5FH6 A;  5E3G A;  2R0V A;  5E9V A;  3S92 A;  5DKD A;  5E73 A;  4YBS A;  4NUD A;  4CL9 A;  3UVY A;  4C66 A;  4N3W A;  5EP7 A;  5I86 A;  4BHW A;  2MJV B;  4QEV A;  4YY6 A;  4YYG A;  2WP1 A;  5L8T A;  4Z6H A;  4YYI A;  4YYJ A;  2RS9 B;  4ZQL A;  4LDF A;  5L96 A;  5F61 A;  5IGL A;  4TZ2 A;  5HFQ A;  4YYK A;  4KCX A;  4A9L A;  1X0J A;  5FDZ A;  4N4F A;  5I83 A;  5BT3 A;  4LZR A;  4TT6 A;  3MB3 A;  4J1P A;  3UW9 A;  4A9M A;  4A9J A;  4TT2 A;  5ENJ A;  4QUT A;  5I7X A;  4IOQ A;  3K2J A;  5HQ5 A;  5L97 A;  4NRA A;  2RI7 A;  4PKL A;  2DWW A;  5C89 A;  5LJ2 A;  5DW2 A;  4QR3 A;  2RFJ A;  4A9I A;  4HXP A;  5DLZ A;  5EPB A;  4O78 A;  5F60 A;  3MUK A;  4HBV A;  4WIV A;  5DBM A;  4QSP A;  5CUC A;  5CGP A;  4O77 A;  3MB4 A;  5KO4 A;  3LQH A;  5D24 A;  2DKW A;  4MR5 A;  4YAT A;  5G4S A;  4IR5 A;  5A7C A;  5CQ6 A;  3U5P A;  4TU6 A;  5E3D A;  1JSP B;  4PCI A;  4NUC A;  5C8G A;  4O71 A;  4YK0 A;  5LKZ A;  2YW5 A;  2OO1 A;  5EWW A;  4Z1S A;  2FSA A;  5E0R A;  5EPS A;  5DLX A;  3O37 A;  2L5E A;  3P1F A;  4YAB A;  4LYW A;  5FE5 A;  4WHU A;  4Q0N A;  5CQ4 A;  5FG6 A;  4QUU A;  5E9L A;  4A9E A;  5FFY A;  5EU1 A;  5F63 A;  4QYL A;  5DW1 A;  5LKX A;  5H1U A;  5FE7 A;  4CUR A;  5EWD A;  2OUO A;  5CS8 A;  4QB3 A;  4LYS A;  2DAT A;  5A81 A;  5A5Q A;  5DFB A;  5LKT A;  5ENC A;  4YYD A;  2NXB A;  4CUQ A;  5FFV A;  4FLP A;  4UYF A;  4NUE A;  2G4A A;  4J0R A;  4NR6 A;  5KHM A;  1F68 A;  4A9N A;  2H60 A;  4YBT A;  4N4I A;  5EWC A;  4QSV A;  5FE0 A;  5KTX A;  5DFC A;  5CY9 A;  1WUG A;  2F6J A;  5E9I A;  4XYA A;  4LC2 A;  4NR7 A;  4QBM A;  5DYU A;  4MEP A;  5ACY A;  5F36 A;  5DKH A;  3I3J A;  4N4G A;  5IGN A;  4ZC9 A;  4UYG A;  4HXO A;  5I1Q A;  5D3R A;  3MQM A;  3U5N A;  5FH8 A;  4IOR A;  5KTW A;  4O75 A;  4O7F A;  5J0D A;  5CQ3 A;  5EWV A;  4QR5 A;  4HXN A;  4LZS A;  2DVS A;  4ZW1 A;  3O34 A;  5FG4 A;  4TS8 A;  3RCW A;  5FB1 A;  4O72 A;  2WP2 A;  4QST A;  5F5Z A;  5CQT A;  2YYN A;  5JWM A;  4OGI A;  4XY8 A;  5ENE A;  5FG5 A;  5HJC A;  4PY6 A;  3ZYU A;  3GG3 A;  4UIU A;  4MR6 A;  5C85 A;  5F62 A;  3U5O A;  4BW2 A;  5C4Q A;  5FE4 A;  3U5J A;  2YDW A;  3TLP A;  3LQI A;  4C67 A;  5D25 A;  4HXS A;  2GRC A;  5H1V A;  4HBW A;  3S91 A;  5EWH A;  5F1H A;  5HRV A;  4NR8 A;  4NR5 A;  2R0S A;  4NYX A;  1E6I A;  5EQ1 A;  5EPR A;  5ENF A;  4CFK A;  4HBX A;  5FE8 A;  3Q2E A;  5CQ8 A;  4UIT A;  3MUL A;  4GPJ A;  2I7K A;  5E7D A;  4OUF A;  5II2 A;  3P1C A;  5A5R A;  4ALH A;  5HRW A;  2E3K A;  5L99 A;  4UIZ A;  1EQF A;  1N72 A;  4O7B A;  5CPE A;  5FH7 A;  5G4R A;  3JVK A;  3LXJ A;  4UYF B;  4TU4 A;  4NXJ A;  4PS5 A;  5HM0 A;  5A85 A;  4YYH A;  4CUU A;  3SVG A;  3JVM A;  5F2P A;  4QSS A;  5H85 A;  2YQD A;  4UYE A;  5AD3 A;  5IID A;  5KU3 A;  4LR6 A;  2E7O A;  5HCL A;  4Z93 A;  5FBX A;  5D7X A;  4IOO A;  4YYN A;  5E9M A;  5AME A;  4A9F A;  4YH4 A;  2R0Y A;  5EGU A;  3ONI A;  5FE6 A;  5IGM A;  2DVV A;  3HME A;  5BT5 A;  5AMF A;  5A5P A;  5KTU A;  5A5S A;  4QSW A;  2L85 A;  4TZ8 A;  5EA1 A;  5H1T A;  5COI A;  4CUS A;  3QZS A;  5HFR A;  4NYV A;  4UYH A;  4Z6I A;  4F3I A;  5LJ1 A;  5DY7 A;  3G0L A;  5DKC A;  3Q2F A;  2F6N A;  4MR3 A;  5C7N A;  5E9K A;  2DVQ A;  3JVJ A;  5ETB A;  5CUE A;  4UIW A;  4QZS A;  3P5O A;  5LKU A;  4TYL A;  3DAI A;  4WHW A;  4NR4 A;  4BW4 A;  5BT4 A;  2D9E A;  5D3L A;  4O70 A;  4UIY A;  1WUM A;  5CUG A;  3LJW A;  4X2I A;  4NYW A;  4TT4 A;  4XUB A;  5HLS A;  4BW3 A;  4HXR A;  4YC9 A;  4YBM A;  5FE9 A;  5CZG A;  5DYX A;  3P1D A;  4QC3 A;  4QC1 A;  4YAX A;  5D3J A;  4QEW A;  5CU8 A;  4YH3 A;  4HXK A;  4QSX A;  5JI8 A;  5HEN A;  4QNS A;  4J3I A;  5I88 A;  4OGJ A;  3P1E A;  5IGK A;  3SVH A;  5D3H A;  4O7E A;  5CFW A;  5D3T A;  4TQN A;  4MR4 A;  4MEO A;  5E74 A;  4A9K A;  5EK9 A;  4YAD A;  5CUD A;  4DON A;  5A5N A;  4CUT A;  5EVA A;  5CP5 A;  5FB0 A;  4NQM A;  5HRX A;  5HEL A;  4NRC A;  5EIS A;  5FE3 A;  3AQA A;  4O7A A;  4IR3 A;  4IR6 A;  4A9O A;  4O76 A;  3D7C A;  4Y03 A;  5EI4 A;  5ENG A;  5II1 A;  4O7C A;  5CUB A;  4CUP A;  5C87 A;  1JM4 B;  3G0J A;  5LJ0 A;  4J0S A;  3UV4 A;  4CLB A;  5CUA A;  5AD2 A;  4BJX A;  3HMH A;  3QZT A;  5EIC A;  4YYM A;  4LZ2 A;  2KTB B;  2RNY A;  5EV9 A;  4YY4 A;  5D26 A;  2E7N A;  5CTL A;  5D3S A;  5DYA A;  4QY4 A;  5I40 A;  5HQ6 A;  4LRG A;  2D82 A;  2RO1 A;  2L84 A;  5CQA A;  2R10 A;  4BW1 A;  5CRZ A;  3UVD A;  2YEM A;  4HXM A;  3NXB A;  5DX4 A;  4ALG A;  3UVX A;  4NQN A;  4IR4 A;  4KV4 A;  4A9H A;  4MEQ A;  5F25 A;  5EM3 A;  4QSR A;  4Q0O A;  4KV1 A;  4QYD A;  5L8U A;  5D3N A;  4PCE A;  5HEM A;  4MEN A;  5I80 A;  5DYC A;  5HQ7 A;  4LYI A;  3O33 A;  5ENB A;  3HMF A;  3AAD A;  4UIV A;  3JVL A;  5CQ5 A;  4Z1Q A;  1ZS5 A;  5FE1 A;  5DFD A;  5I89 A;  3IU5 A;  2N9G A;  3U5M A;  5TCM A;  4N4H A;  3U5K A;  4RVR A;  5F3A A;  5FE2 A;  5F1L A;  5I29 A;  3SVF A;  4O74 A;  5E9Y A;  3DWY A;  3O36 A;  5TB6 A;  4E96 A;  2I8N A;  3UV5 A;  2DVR A;  4HBY A;  5K29 A;  5IBN A;  4NRB A;  4XUA A;  5D0C A; 
#chains in the Genus database with same CATH topology
 4PTB A;  4QR4 A;  5L98 A;  4UYD A;  4AKN A;  3UVW A;  4XY9 A;  3U5L A;  5A5O A;  2YEK A;  3O35 A;  5ENI A;  5IG6 A;  3UV2 A;  3QZV A;  5A83 A;  3LQJ A;  5D3P A;  3MXF A;  4NS5 A;  3IU6 A;  5LUU A;  5LVQ A;  5CRM A;  2OSS A;  2RNW A;  2RNX A;  3FKM X;  5ETD A;  5CQ7 A;  4CFL A;  4TTE A;  2LSP B;  5FFW A;  5I7Y A;  5ENH A;  2YEL A;  4QEU A;  4HXL A;  4QSU A;  5LVR A;  4UIX A;  4NR9 A;  5A82 A;  4QSQ A;  5FH6 A;  5E3G A;  2R0V A;  5E9V A;  3S92 A;  5DKD A;  5E73 A;  4YBS A;  4NUD A;  4CL9 A;  3UVY A;  4C66 A;  4N3W A;  5EP7 A;  5I86 A;  4BHW A;  2MJV B;  4QEV A;  4YY6 A;  4YYG A;  2WP1 A;  5L8T A;  4Z6H A;  4YYI A;  4YYJ A;  2RS9 B;  4ZQL A;  4LDF A;  5L96 A;  5F61 A;  5IGL A;  4TZ2 A;  5HFQ A;  4YYK A;  4KCX A;  4A9L A;  1X0J A;  5FDZ A;  4N4F A;  5I83 A;  5BT3 A;  4LZR A;  4TT6 A;  3VKH A;  3MB3 A;  4J1P A;  3UW9 A;  4A9M A;  4A9J A;  4TT2 A;  5ENJ A;  4QUT A;  5I7X A;  4IOQ A;  3K2J A;  5HQ5 A;  5L97 A;  4NRA A;  2RI7 A;  4PKL A;  2DWW A;  5C89 A;  5LJ2 A;  5DW2 A;  4QR3 A;  2RFJ A;  4A9I A;  4HXP A;  5DLZ A;  5EPB A;  4O78 A;  5F60 A;  3MUK A;  4HBV A;  4WIV A;  5DBM A;  4QSP A;  5CUC A;  5CGP A;  4O77 A;  3MB4 A;  5KO4 A;  3LQH A;  5D24 A;  2DKW A;  4MR5 A;  4YAT A;  5G4S A;  4IR5 A;  5A7C A;  5CQ6 A;  3U5P A;  4TU6 A;  5E3D A;  1JSP B;  4PCI A;  4NUC A;  5C8G A;  4O71 A;  4YK0 A;  5LKZ A;  2YW5 A;  2OO1 A;  5EWW A;  3ERR A;  4Z1S A;  2FSA A;  5E0R A;  5EPS A;  5DLX A;  3O37 A;  2L5E A;  3P1F A;  4YAB A;  4LYW A;  5FE5 A;  4WHU A;  4Q0N A;  5CQ4 A;  5FG6 A;  4QUU A;  5E9L A;  4A9E A;  5FFY A;  5EU1 A;  5F63 A;  4AKG A;  4QYL A;  5DW1 A;  5LKX A;  5H1U A;  5FE7 A;  4CUR A;  5EWD A;  2OUO A;  5CS8 A;  4QB3 A;  4LYS A;  2DAT A;  5A81 A;  5A5Q A;  5DFB A;  5LKT A;  5ENC A;  4YYD A;  2NXB A;  4CUQ A;  5FFV A;  4FLP A;  4UYF A;  4NUE A;  2G4A A;  4J0R A;  4NR6 A;  5KHM A;  1F68 A;  4A9N A;  2H60 A;  4YBT A;  4N4I A;  5EWC A;  4QSV A;  5FE0 A;  5KTX A;  5DFC A;  5CY9 A;  1WUG A;  2F6J A;  5E9I A;  4XYA A;  4LC2 A;  4NR7 A;  4QBM A;  5DYU A;  4MEP A;  5ACY A;  5F36 A;  5DKH A;  3I3J A;  4N4G A;  5IGN A;  4ZC9 A;  4UYG A;  4HXO A;  5I1Q A;  5D3R A;  3MQM A;  3U5N A;  4AI6 A;  5FH8 A;  4IOR A;  5KTW A;  4O75 A;  4O7F A;  5J0D A;  5CQ3 A;  5EWV A;  4QR5 A;  4HXN A;  4LZS A;  2DVS A;  4ZW1 A;  3O34 A;  5FG4 A;  4TS8 A;  3RCW A;  5FB1 A;  4O72 A;  2WP2 A;  4QST A;  5F5Z A;  5CQT A;  2YYN A;  5JWM A;  4OGI A;  4XY8 A;  5ENE A;  5FG5 A;  5HJC A;  4PY6 A;  3ZYU A;  3GG3 A;  4UIU A;  3VKG A;  4MR6 A;  5C85 A;  5F62 A;  3U5O A;  4BW2 A;  5C4Q A;  5FE4 A;  3U5J A;  2YDW A;  3TLP A;  3D1D A;  3LQI A;  4C67 A;  5D25 A;  4HXS A;  2GRC A;  5H1V A;  4HBW A;  3S91 A;  5EWH A;  5F1H A;  5HRV A;  4NR8 A;  4NR5 A;  2R0S A;  4NYX A;  1E6I A;  5EQ1 A;  5EPR A;  5ENF A;  4CFK A;  4HBX A;  5FE8 A;  3Q2E A;  5CQ8 A;  4UIT A;  3MUL A;  4GPJ A;  2I7K A;  5E7D A;  4OUF A;  5II2 A;  3P1C A;  5A5R A;  4ALH A;  5HRW A;  2E3K A;  5L99 A;  4UIZ A;  1PUO A;  1EQF A;  1N72 A;  4O7B A;  5CPE A;  5FH7 A;  5G4R A;  3JVK A;  3LXJ A;  4UYF B;  4TU4 A;  4NXJ A;  4PS5 A;  5HM0 A;  5A85 A;  4YYH A;  4CUU A;  3SVG A;  3JVM A;  3D1B A;  4QSS A;  5F2P A;  5H85 A;  2YQD A;  4UYE A;  5AD3 A;  5IID A;  5KU3 A;  4LR6 A;  2E7O A;  5HCL A;  4Z93 A;  5FBX A;  5D7X A;  4IOO A;  4AKI A;  4YYN A;  5E9M A;  5AME A;  4A9F A;  4YH4 A;  2R0Y A;  5EGU A;  3ONI A;  5FE6 A;  5IGM A;  2DVV A;  3HME A;  5BT5 A;  5AMF A;  5A5P A;  5KTU A;  5A5S A;  4QSW A;  2L85 A;  4TZ8 A;  5EA1 A;  5H1T A;  5COI A;  4CUS A;  3QZS A;  5HFR A;  4NYV A;  4UYH A;  4Z6I A;  4F3I A;  5LJ1 A;  5DY7 A;  3G0L A;  4AKH A;  5DKC A;  3Q2F A;  2F6N A;  4MR3 A;  5C7N A;  5E9K A;  2DVQ A;  3JVJ A;  5ETB A;  5CUE A;  4UIW A;  4QZS A;  3P5O A;  5LKU A;  4TYL A;  3DAI A;  4WHW A;  4NR4 A;  4BW4 A;  5BT4 A;  2D9E A;  5D3L A;  4O70 A;  4UIY A;  1WUM A;  5CUG A;  3LJW A;  4X2I A;  4NYW A;  4TT4 A;  4XUB A;  5HLS A;  4BW3 A;  4HXR A;  4YC9 A;  4YBM A;  5FE9 A;  5CZG A;  5DYX A;  3P1D A;  4QC3 A;  4QC1 A;  4YAX A;  5D3J A;  4QEW A;  5CU8 A;  4YH3 A;  4HXK A;  4QSX A;  5JI8 A;  5HEN A;  4QNS A;  4J3I A;  5I88 A;  4OGJ A;  3P1E A;  5IGK A;  3SVH A;  5D3H A;  4O7E A;  5CFW A;  5D3T A;  4TQN A;  4MR4 A;  4MEO A;  5E74 A;  4A9K A;  5EK9 A;  4YAD A;  5CUD A;  4DON A;  5A5N A;  4CUT A;  5EVA A;  5CP5 A;  5FB0 A;  4NQM A;  5HRX A;  5HEL A;  4NRC A;  5EIS A;  5FE3 A;  3AQA A;  4O7A A;  4IR3 A;  4IR6 A;  4A9O A;  4O76 A;  3D7C A;  4Y03 A;  5EI4 A;  5ENG A;  5II1 A;  4O7C A;  5CUB A;  4CUP A;  2EJN A;  5C87 A;  1JM4 B;  3G0J A;  5LJ0 A;  4J0S A;  3UV4 A;  4CLB A;  5CUA A;  5AD2 A;  4BJX A;  3HMH A;  3QZT A;  5EIC A;  4YYM A;  4LZ2 A;  2KTB B;  2RNY A;  5EV9 A;  4YY4 A;  5D26 A;  2E7N A;  5CTL A;  5D3S A;  5DYA A;  4QY4 A;  5I40 A;  5HQ6 A;  4LRG A;  2D82 A;  1ZKR A;  2RO1 A;  2L84 A;  5CQA A;  2R10 A;  4BW1 A;  5CRZ A;  3UVD A;  2YEM A;  4HXM A;  3NXB A;  5DX4 A;  4ALG A;  3UVX A;  4NQN A;  4IR4 A;  4KV4 A;  4A9H A;  4MEQ A;  5F25 A;  5EM3 A;  4QSR A;  4Q0O A;  4KV1 A;  4QYD A;  5L8U A;  5D3N A;  4PCE A;  5HEM A;  4MEN A;  5I80 A;  5DYC A;  5HQ7 A;  4LYI A;  3O33 A;  5ENB A;  3HMF A;  3AAD A;  4UIV A;  3JVL A;  5CQ5 A;  4Z1Q A;  1ZS5 A;  5FE1 A;  5DFD A;  5I89 A;  3IU5 A;  2N9G A;  3U5M A;  5TCM A;  4N4H A;  3U5K A;  4RVR A;  5F3A A;  5FE2 A;  5F1L A;  5I29 A;  3SVF A;  4O74 A;  5E9Y A;  3DWY A;  3O36 A;  5TB6 A;  4E96 A;  2I8N A;  3UV5 A;  2DVR A;  4HBY A;  5K29 A;  5IBN A;  4NRB A;  4XUA A;  5D0C A; 
#chains in the Genus database with same CATH homology
 4PTB A;  4QR4 A;  5L98 A;  4UYD A;  4AKN A;  3UVW A;  4XY9 A;  3U5L A;  5A5O A;  2YEK A;  3O35 A;  5ENI A;  5IG6 A;  3UV2 A;  3QZV A;  5A83 A;  3LQJ A;  5D3P A;  3MXF A;  4NS5 A;  3IU6 A;  5LUU A;  5LVQ A;  5CRM A;  2OSS A;  2RNW A;  2RNX A;  3FKM X;  5ETD A;  5CQ7 A;  4CFL A;  4TTE A;  2LSP B;  5FFW A;  5I7Y A;  5ENH A;  2YEL A;  4QEU A;  4HXL A;  4QSU A;  5LVR A;  4UIX A;  4NR9 A;  5A82 A;  4QSQ A;  5FH6 A;  5E3G A;  2R0V A;  5E9V A;  3S92 A;  5DKD A;  5E73 A;  4YBS A;  4NUD A;  4CL9 A;  3UVY A;  4C66 A;  4N3W A;  5EP7 A;  5I86 A;  4BHW A;  2MJV B;  4QEV A;  4YY6 A;  4YYG A;  2WP1 A;  5L8T A;  4Z6H A;  4YYI A;  4YYJ A;  2RS9 B;  4ZQL A;  4LDF A;  5L96 A;  5F61 A;  5IGL A;  4TZ2 A;  5HFQ A;  4YYK A;  4KCX A;  4A9L A;  1X0J A;  5FDZ A;  4N4F A;  5I83 A;  5BT3 A;  4LZR A;  4TT6 A;  3MB3 A;  4J1P A;  3UW9 A;  4A9M A;  4A9J A;  4TT2 A;  5ENJ A;  4QUT A;  5I7X A;  4IOQ A;  3K2J A;  5HQ5 A;  5L97 A;  4NRA A;  2RI7 A;  4PKL A;  2DWW A;  5C89 A;  5LJ2 A;  5DW2 A;  4QR3 A;  2RFJ A;  4A9I A;  4HXP A;  5DLZ A;  5EPB A;  4O78 A;  5F60 A;  3MUK A;  4HBV A;  4WIV A;  5DBM A;  4QSP A;  5CUC A;  5CGP A;  4O77 A;  3MB4 A;  5KO4 A;  3LQH A;  5D24 A;  2DKW A;  4MR5 A;  4YAT A;  5G4S A;  4IR5 A;  5A7C A;  5CQ6 A;  3U5P A;  4TU6 A;  5E3D A;  1JSP B;  4PCI A;  4NUC A;  5C8G A;  4O71 A;  4YK0 A;  5LKZ A;  2YW5 A;  2OO1 A;  5EWW A;  4Z1S A;  2FSA A;  5E0R A;  5EPS A;  5DLX A;  3O37 A;  2L5E A;  3P1F A;  4YAB A;  4LYW A;  5FE5 A;  4WHU A;  4Q0N A;  5CQ4 A;  5FG6 A;  4QUU A;  5E9L A;  4A9E A;  5FFY A;  5EU1 A;  5F63 A;  4QYL A;  5DW1 A;  5LKX A;  5H1U A;  5FE7 A;  4CUR A;  5EWD A;  2OUO A;  5CS8 A;  4QB3 A;  4LYS A;  2DAT A;  5A81 A;  5A5Q A;  5DFB A;  5LKT A;  5ENC A;  4YYD A;  2NXB A;  4CUQ A;  5FFV A;  4FLP A;  4UYF A;  4NUE A;  2G4A A;  4J0R A;  4NR6 A;  5KHM A;  1F68 A;  4A9N A;  2H60 A;  4YBT A;  4N4I A;  5EWC A;  4QSV A;  5FE0 A;  5KTX A;  5DFC A;  5CY9 A;  1WUG A;  2F6J A;  5E9I A;  4XYA A;  4LC2 A;  4NR7 A;  4QBM A;  5DYU A;  4MEP A;  5ACY A;  5F36 A;  5DKH A;  3I3J A;  4N4G A;  5IGN A;  4ZC9 A;  4UYG A;  4HXO A;  5I1Q A;  5D3R A;  3MQM A;  3U5N A;  5FH8 A;  4IOR A;  5KTW A;  4O75 A;  4O7F A;  5J0D A;  5CQ3 A;  5EWV A;  4QR5 A;  4HXN A;  4LZS A;  2DVS A;  4ZW1 A;  3O34 A;  5FG4 A;  4TS8 A;  3RCW A;  5FB1 A;  4O72 A;  2WP2 A;  4QST A;  5F5Z A;  5CQT A;  2YYN A;  5JWM A;  4OGI A;  4XY8 A;  5ENE A;  5FG5 A;  5HJC A;  4PY6 A;  3ZYU A;  3GG3 A;  4UIU A;  4MR6 A;  5C85 A;  5F62 A;  3U5O A;  4BW2 A;  5C4Q A;  5FE4 A;  3U5J A;  2YDW A;  3TLP A;  3LQI A;  4C67 A;  5D25 A;  4HXS A;  2GRC A;  5H1V A;  4HBW A;  3S91 A;  5EWH A;  5F1H A;  5HRV A;  4NR8 A;  4NR5 A;  2R0S A;  4NYX A;  1E6I A;  5EQ1 A;  5EPR A;  5ENF A;  4CFK A;  4HBX A;  5FE8 A;  3Q2E A;  5CQ8 A;  4UIT A;  3MUL A;  4GPJ A;  2I7K A;  5E7D A;  4OUF A;  5II2 A;  3P1C A;  5A5R A;  4ALH A;  5HRW A;  2E3K A;  5L99 A;  4UIZ A;  1EQF A;  1N72 A;  4O7B A;  5CPE A;  5FH7 A;  5G4R A;  3JVK A;  3LXJ A;  4UYF B;  4TU4 A;  4NXJ A;  4PS5 A;  5HM0 A;  5A85 A;  4YYH A;  4CUU A;  3SVG A;  3JVM A;  5F2P A;  4QSS A;  5H85 A;  2YQD A;  4UYE A;  5AD3 A;  5IID A;  5KU3 A;  4LR6 A;  2E7O A;  5HCL A;  4Z93 A;  5FBX A;  5D7X A;  4IOO A;  4YYN A;  5E9M A;  5AME A;  4A9F A;  4YH4 A;  2R0Y A;  5EGU A;  3ONI A;  5FE6 A;  5IGM A;  2DVV A;  3HME A;  5BT5 A;  5AMF A;  5A5P A;  5KTU A;  5A5S A;  4QSW A;  2L85 A;  4TZ8 A;  5EA1 A;  5H1T A;  5COI A;  4CUS A;  3QZS A;  5HFR A;  4NYV A;  4UYH A;  4Z6I A;  4F3I A;  5LJ1 A;  5DY7 A;  3G0L A;  5DKC A;  3Q2F A;  2F6N A;  4MR3 A;  5C7N A;  5E9K A;  2DVQ A;  3JVJ A;  5ETB A;  5CUE A;  4UIW A;  4QZS A;  3P5O A;  5LKU A;  4TYL A;  3DAI A;  4WHW A;  4NR4 A;  4BW4 A;  5BT4 A;  2D9E A;  5D3L A;  4O70 A;  4UIY A;  1WUM A;  5CUG A;  3LJW A;  4X2I A;  4NYW A;  4TT4 A;  4XUB A;  5HLS A;  4BW3 A;  4HXR A;  4YC9 A;  4YBM A;  5FE9 A;  5CZG A;  5DYX A;  3P1D A;  4QC3 A;  4QC1 A;  4YAX A;  5D3J A;  4QEW A;  5CU8 A;  4YH3 A;  4HXK A;  4QSX A;  5JI8 A;  5HEN A;  4QNS A;  4J3I A;  5I88 A;  4OGJ A;  3P1E A;  5IGK A;  3SVH A;  5D3H A;  4O7E A;  5CFW A;  5D3T A;  4TQN A;  4MR4 A;  4MEO A;  5E74 A;  4A9K A;  5EK9 A;  4YAD A;  5CUD A;  4DON A;  5A5N A;  4CUT A;  5EVA A;  5CP5 A;  5FB0 A;  4NQM A;  5HRX A;  5HEL A;  4NRC A;  5EIS A;  5FE3 A;  3AQA A;  4O7A A;  4IR3 A;  4IR6 A;  4A9O A;  4O76 A;  3D7C A;  4Y03 A;  5EI4 A;  5ENG A;  5II1 A;  4O7C A;  5CUB A;  4CUP A;  5C87 A;  1JM4 B;  3G0J A;  5LJ0 A;  4J0S A;  3UV4 A;  4CLB A;  5CUA A;  5AD2 A;  4BJX A;  3HMH A;  3QZT A;  5EIC A;  4YYM A;  4LZ2 A;  2KTB B;  2RNY A;  5EV9 A;  4YY4 A;  5D26 A;  2E7N A;  5CTL A;  5D3S A;  5DYA A;  4QY4 A;  5I40 A;  5HQ6 A;  4LRG A;  2D82 A;  2RO1 A;  2L84 A;  5CQA A;  2R10 A;  4BW1 A;  5CRZ A;  3UVD A;  2YEM A;  4HXM A;  3NXB A;  5DX4 A;  4ALG A;  3UVX A;  4NQN A;  4IR4 A;  4KV4 A;  4A9H A;  4MEQ A;  5F25 A;  5EM3 A;  4QSR A;  4Q0O A;  4KV1 A;  4QYD A;  5L8U A;  5D3N A;  4PCE A;  5HEM A;  4MEN A;  5I80 A;  5DYC A;  5HQ7 A;  4LYI A;  3O33 A;  5ENB A;  3HMF A;  3AAD A;  4UIV A;  3JVL A;  5CQ5 A;  4Z1Q A;  1ZS5 A;  5FE1 A;  5DFD A;  5I89 A;  3IU5 A;  2N9G A;  3U5M A;  5TCM A;  4N4H A;  3U5K A;  4RVR A;  5F3A A;  5FE2 A;  5F1L A;  5I29 A;  3SVF A;  4O74 A;  5E9Y A;  3DWY A;  3O36 A;  5TB6 A;  4E96 A;  2I8N A;  3UV5 A;  2DVR A;  4HBY A;  5K29 A;  5IBN A;  4NRB A;  4XUA A;  5D0C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...