5I1QA

Second bromodomain of taf1 bound to a pyrrolopyridone compound
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
135
structure length
135
Chain Sequence
DDDQVAFSFILDNIVTQKMMAVPDSWPFHHPVNKKFVPDYYKVIVNPMDLETIRKNISKHKYQSRESFLDDVNLILANSVKYNGPESQYTKTAQEIVNVCYQTLTEYDEHLTQLEKDICTAKEAALEEAELESLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding/inhibitor
molecule keywords Transcription initiation factor TFIID subunit 1
publication title Diving into the Water: Inducible Binding Conformations for BRD4, TAF1(2), BRD9, and CECR2 Bromodomains.
pubmed doi rcsb
source organism Homo sapiens
total genus 56
structure length 135
sequence length 135
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2016-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5i1qA00
4QYLA 4HXSA 5ENEA 2YDWA 2YQDA 5HENA 3JVLA 5D24A 5FFYA 4TS8A 5LVRA 2D9EA 4TT2A 2F6JA 5CQ6A 4KV1A 5C85A 5I88A 5CQAA 5EK9A 5F60A 5EPBA 5F5ZA 5EA1A 4J3IA 5EI4A 5A5SA 3DWYA 5IG6A 5KHMA 5ACYA 2LSPB 5TCMA 4QY4A 5FFVA 4X2IA 5HFRA 3LXJA 2OO1A 4HXLA 5IGKA 4MR6A 4IORA 5I1QA 5L8TA 4OGJA 4WIVA 4MEPA 5A5NA 4CUPA 5L99A 3MXFA 4UIUA 5I83A 5FG4A 4CLBA 4YK0A 4J0RA 4QSQA 4XUBA 5L97A 5A5PA 2NXBA 4GPJA 4Z1QA 5DKDA 4YH3A 5D3RA 4PKLA 2F6NA 5I7XA 4QSUA 5E9MA 3NXBA 4NQMA 4YC9A 2RNXA 5C7NA 5D0CA 5ENBA 5I29A 2GRCA 3IU5A 4O75A 3P1FA 5LJ0A 4HBXA 4Z1SA 3Q2FA 4HXMA 5IIDA 5DYAA 4UYFB 4TYLA 2DVQA 5EWWA 5D3NA 4TU4A 4LRGA 5LJ1A 5AD2A 2RFJA 5FE2A 5LJ2A 3G0LA 5FE8A 4LZ2A 5F3AA 5CQ4A 4N3WA 4HBVA 4HBYA 4TZ2A 2RO1A 5FDZA 5FE4A 2DATA 4ZW1A 5J0DA 5H1UA 5E9IA 5HELA 4O7CA 5HCLA 4O71A 5D3JA 4QSRA 4Y03A 3P1CA 4LR6A 5CPEA 5JWMA 3I3JA 5F36A 5F61A 4NS5A 2DVSA 3UV4A 4QNSA 4YYDA 5BT4A 5DY7A 5E9YA 3JVJA 5CFWA 4LYSA 1E6IA 4KCXA 5A81A 4QEUA 4QSSA 4LC2A 4UIZA 2YELA 4O74A 3HMFA 5CP5A 3MULA 5II1A 2YW5A 5C87A 5DYCA 5EWVA 4BJXA 4CFLA 5BT3A 4NYWA 5FE1A 5DW2A 3S91A 5LKUA 4QYDA 4TTEA 4NR9A 5ETBA 5COIA 5EWCA 3P1EA 5II2A 5IGMA 4QUTA 5EQ1A 4IR4A 5FH8A 3U5JA 3JVKA 4N4FA 5ENIA 3O34A 3FKMX 4YYHA 4A9MA 2RNYA 4QSVA 3P5OA 4O7EA 4KV4A 2YEMA 4C66A 5G4RA 5CUEA 1JM4B 5D3HA 2E3KA 3MB4A 4HXNA 3SVHA 5E7DA 5DKHA 4AKNA 5CGPA 4E96A 5FBXA 4Z6IA 2E7NA 4OUFA 4N4IA 4N4GA 4YY6A 4YBMA 5DFBA 5FG5A 2I7KA 5HQ5A 5A5OA 5A85A 3U5KA 4BW1A 5C89A 4BHWA 1WUGA 2L84A 4XY8A 3UVDA 4QB3A 5HEMA 2RI7A 4FLPA 4TT4A 5EV9A 5A5RA 1WUMA 3AQAA 4NR7A 5A83A 4NR6A 5EPSA 5EU1A 4CL9A 2YYNA 5F25A 5LUUA 4PTBA 5EP7A 4O70A 5ENJA 5I89A 4Q0NA 5D7XA 5F62A 4A9JA 4A9HA 4TZ8A 5FFWA 5L98A 5CUCA 5DFCA 2N9GA 2DKWA 5AMFA 5HLSA 4HXPA 4XYAA 4YYNA 5ENGA 4J1PA 4O7FA 4NRBA 4Z6HA 3U5NA 5I40A 3HMHA 4IOOA 4QSPA 5HJCA 3JVMA 4YBTA 3UVWA 1F68A 4QBMA 4QEWA 4PCEA 1ZS5A 3U5OA 4RVRA 4UYHA 4QR4A 5EWHA 5FH6A 4NRCA 5IBNA 4N4HA 4LYIA 2OUOA 5FE3A 2D82A 3LQIA 4CUQA 4QR3A 4QR5A 5F63A 4CUUA 5FH7A 4YYJA 4YH4A 5DLXA 5E9LA 5CQTA 4YYGA 4IR6A 5E9VA 4DONA 2I8NA 5CUDA 5FE5A 2R10A 4QSTA 4MEQA 3P1DA 3ONIA 4QSXA 4UIWA 5D3LA 5H1VA 5FB0A 2OSSA 5CRMA 4CUTA 4NYXA 4C67A 4YY4A 5DKCA 4ALHA 5CQ5A 3QZVA 4A9IA 4NR4A 4Q0OA 4O76A 3UV5A 5IGNA 4NXJA 5KU3A 4UITA 2E7OA 5CQ3A 2R0VA 5HM0A 3O37A 4BW3A 3U5LA 4A9NA 4TU6A 5CQ7A 2RNWA 4HXKA 5CTLA 2YEKA 4MENA 4ALGA 5G4SA 5FE0A 5D26A 3UW9A 3MB3A 5CQ8A 5CUAA 4YADA 5EM3A 5L8UA 4YYKA 4LZRA 5AMEA 4J0SA 4O7BA 3D7CA 3S92A 4OGIA 2WP2A 4YAXA 4MR3A 4ZC9A 3IU6A 4IOQA 3O33A 5TB6A 4UIVA 5ENHA 3QZTA 4YBSA 4A9FA 4NUDA 3AADA 4O72A 4BW4A 4PY6A 5F1LA 2R0SA 4O78A 5D3PA 4XY9A 2G4AA 4CUSA 1N72A 2R0YA 5L96A 2KTBB 4CFKA 4NRAA 4IR5A 5F1HA 4A9KA 3LJWA 5KO4A 4MR4A 3MQMA 5FG6A 3U5PA 5HRXA 5DW1A 5CRZA 3ZYUA 4NR5A 3UV2A 5I7YA 2RS9B 4MR5A 4NR8A 5DYUA 3O36A 3QZSA 4HXRA 5FE7A 5DFDA 1EQFA 4CURA 5HQ6A 3HMEA 2FSAA 3UVXA 4O77A 5FE6A 3U5MA 5E73A 2MJVB 5HRWA 5E0RA 4UIYA 3RCWA 5D3SA 2L5EA 2WP1A 5EWDA 4NQNA 4XUAA 5HFQA 5KTXA 4YATA 5BT5A 4PCIA 4UYDA 5D3TA 4A9LA 4A9EA 5LKTA 4MEOA 5H1TA 1JSPB 4F3IA 5A5QA 4BW2A 4HBWA 2DVRA 5DBMA 4LDFA 5LKZA 3DAIA 4LZSA 5EICA 4QZSA 1X0JA 5E3DA 4Z93A 5E3GA 5FB1A 3SVGA 5LVQA 4PS5A 3UVYA 4YYIA 4QEVA 4NUEA 5DX4A 5JI8A 4QC3A 5H85A 2H60A 5HRVA 5ENFA 4LYWA 3SVFA 5E9KA 4HXOA 4QC1A 5I80A 5CZGA 4NUCA 5CU8A 5ETDA 4ZQLA 5CY9A 3LQHA 4NYVA 3MUKA 5AD3A 5C4QA 4TT6A 5C8GA 4YYMA 5IGLA 5ENCA 5F2PA 4UYEA 4A9OA 5EVAA 3K2JA 3LQJA 4IR3A 5EPRA 5KTUA 5HQ7A 5LKXA 4QUUA 3TLPA 4YABA 4UYGA 4O7AA 5CUGA 5EGUA 5E74A 5KTWA 3O35A 5FE9A 4WHUA 5I86A 5CS8A 5DYXA 4TQNA 5DLZA 3Q2EA 5A82A 5CUBA 4UYFA 2DWWA 5D25A 4QSWA 5EISA 5K29A 4WHWA 3GG3A 5A7CA 3G0JA 4UIXA 2L85A 2DVVA
chains in the Genus database with same CATH superfamily
4QYLA 4HXSA 5ENEA 2YDWA 2YQDA 5HENA 3JVLA 5D24A 5FFYA 4TS8A 5LVRA 2D9EA 3VKHA 4TT2A 2F6JA 5CQ6A 4KV1A 5C85A 5I88A 5CQAA 5EK9A 5F60A 5EPBA 5F5ZA 5EA1A 4J3IA 5EI4A 5A5SA 3DWYA 5IG6A 5KHMA 5ACYA 2LSPB 5TCMA 4QY4A 5FFVA 4X2IA 5HFRA 3LXJA 2OO1A 4HXLA 5IGKA 4MR6A 4IORA 2EJNA 5I1QA 5L8TA 4OGJA 4WIVA 4MEPA 5A5NA 4CUPA 5L99A 3MXFA 4UIUA 5I83A 5FG4A 4CLBA 4YK0A 4J0RA 4QSQA 4XUBA 5L97A 5A5PA 2NXBA 4GPJA 4Z1QA 5DKDA 4YH3A 5D3RA 4PKLA 2F6NA 5I7XA 4QSUA 1PUOA 5E9MA 3NXBA 4NQMA 4YC9A 2RNXA 5C7NA 5D0CA 5ENBA 5I29A 2GRCA 3IU5A 4O75A 3P1FA 5LJ0A 4HBXA 4Z1SA 3Q2FA 1ZKRA 4HXMA 5IIDA 5DYAA 4UYFB 4TYLA 2DVQA 5EWWA 5D3NA 4TU4A 4LRGA 5LJ1A 5AD2A 2RFJA 5FE2A 5LJ2A 3G0LA 5FE8A 4LZ2A 5F3AA 5CQ4A 4N3WA 4HBVA 4HBYA 4TZ2A 2RO1A 5FDZA 5FE4A 2DATA 4ZW1A 5J0DA 5H1UA 5E9IA 5HELA 4O7CA 5HCLA 4O71A 5D3JA 4QSRA 4Y03A 3P1CA 4LR6A 5CPEA 5JWMA 3I3JA 5F36A 5F61A 4NS5A 2DVSA 3UV4A 4QNSA 4YYDA 5BT4A 5DY7A 5E9YA 3JVJA 5CFWA 4LYSA 3ERRA 1E6IA 4KCXA 5A81A 4QEUA 4QSSA 4LC2A 4UIZA 4AKIA 2YELA 4O74A 3HMFA 5CP5A 3MULA 5II1A 2YW5A 5C87A 5DYCA 5EWVA 4BJXA 4CFLA 5BT3A 4NYWA 5FE1A 5DW2A 3S91A 5LKUA 4QYDA 4TTEA 4NR9A 5ETBA 5COIA 5EWCA 3P1EA 5II2A 5IGMA 4QUTA 5EQ1A 4IR4A 5FH8A 3U5JA 3JVKA 4N4FA 5ENIA 3O34A 3FKMX 4YYHA 4A9MA 2RNYA 4QSVA 3P5OA 4O7EA 4KV4A 2YEMA 4C66A 5G4RA 5CUEA 1JM4B 5D3HA 2E3KA 3MB4A 4HXNA 3SVHA 5E7DA 5DKHA 4AKNA 5CGPA 4E96A 5FBXA 4Z6IA 2E7NA 4OUFA 4N4IA 4N4GA 4YY6A 4YBMA 5DFBA 5FG5A 2I7KA 5HQ5A 4AKHA 5A5OA 5A85A 3U5KA 4BW1A 5C89A 4BHWA 1WUGA 2L84A 4XY8A 3UVDA 4QB3A 5HEMA 2RI7A 4FLPA 4TT4A 5EV9A 5A5RA 1WUMA 3AQAA 4NR7A 5A83A 4NR6A 5EPSA 5EU1A 3VKGA 4CL9A 2YYNA 5F25A 5LUUA 4PTBA 5EP7A 4O70A 5ENJA 5I89A 4Q0NA 5D7XA 5F62A 4A9JA 4A9HA 4TZ8A 5FFWA 5L98A 5CUCA 5DFCA 2N9GA 2DKWA 5AMFA 5HLSA 4HXPA 4XYAA 4YYNA 5ENGA 4J1PA 4O7FA 4NRBA 4Z6HA 3U5NA 5I40A 3HMHA 4IOOA 4QSPA 5HJCA 3JVMA 4YBTA 3UVWA 1F68A 4QBMA 4QEWA 4PCEA 1ZS5A 3U5OA 4RVRA 4UYHA 4QR4A 5EWHA 5FH6A 4NRCA 5IBNA 4N4HA 4LYIA 2OUOA 5FE3A 2D82A 3LQIA 4CUQA 4QR3A 4QR5A 5F63A 4CUUA 5FH7A 4YYJA 4YH4A 5DLXA 5E9LA 5CQTA 4YYGA 4IR6A 5E9VA 4DONA 2I8NA 5CUDA 5FE5A 2R10A 4QSTA 4MEQA 3P1DA 3ONIA 4QSXA 4UIWA 5D3LA 5H1VA 5FB0A 2OSSA 5CRMA 4CUTA 4NYXA 4C67A 4YY4A 5DKCA 4ALHA 5CQ5A 3QZVA 4A9IA 4NR4A 4Q0OA 4O76A 3UV5A 5IGNA 4NXJA 5KU3A 4UITA 4AI6A 2E7OA 5CQ3A 2R0VA 5HM0A 3O37A 4BW3A 3U5LA 4A9NA 4TU6A 5CQ7A 2RNWA 4HXKA 5CTLA 2YEKA 4MENA 4ALGA 5G4SA 5FE0A 5D26A 3UW9A 3MB3A 5CQ8A 5CUAA 4YADA 5EM3A 5L8UA 4YYKA 4LZRA 5AMEA 4J0SA 4O7BA 3D7CA 3S92A 4OGIA 2WP2A 4YAXA 4MR3A 4ZC9A 3IU6A 4IOQA 3O33A 5TB6A 4UIVA 5ENHA 3QZTA 3D1DA 4YBSA 4A9FA 4NUDA 3AADA 4O72A 4BW4A 4PY6A 5F1LA 2R0SA 4O78A 5D3PA 4XY9A 2G4AA 4CUSA 1N72A 2R0YA 5L96A 2KTBB 4CFKA 4NRAA 4IR5A 5F1HA 4A9KA 3LJWA 5KO4A 4MR4A 3MQMA 5FG6A 3U5PA 5HRXA 5DW1A 5CRZA 3ZYUA 4NR5A 3UV2A 5I7YA 2RS9B 4MR5A 4NR8A 5DYUA 3D1BA 3O36A 3QZSA 4HXRA 5FE7A 1EQFA 5DFDA 4CURA 5HQ6A 3HMEA 2FSAA 3UVXA 4O77A 5FE6A 3U5MA 5E73A 2MJVB 5HRWA 5E0RA 4UIYA 3RCWA 5D3SA 2L5EA 2WP1A 5EWDA 4NQNA 4XUAA 5HFQA 5KTXA 4YATA 5BT5A 4PCIA 4UYDA 5D3TA 4A9LA 4A9EA 5LKTA 4MEOA 5H1TA 1JSPB 4F3IA 5A5QA 4BW2A 4HBWA 2DVRA 5DBMA 4LDFA 5LKZA 3DAIA 4LZSA 5EICA 4QZSA 1X0JA 5E3DA 4Z93A 5E3GA 5FB1A 3SVGA 5LVQA 4PS5A 3UVYA 4YYIA 4QEVA 4NUEA 5DX4A 5JI8A 4QC3A 5H85A 4AKGA 2H60A 5HRVA 5ENFA 4LYWA 3SVFA 5E9KA 4HXOA 4QC1A 5I80A 5CZGA 4NUCA 5CU8A 5ETDA 4ZQLA 5CY9A 3LQHA 4NYVA 3MUKA 5AD3A 5C4QA 4TT6A 5C8GA 4YYMA 5IGLA 5ENCA 5F2PA 4UYEA 4A9OA 5EVAA 3K2JA 3LQJA 4IR3A 5EPRA 5KTUA 5HQ7A 5LKXA 4QUUA 3TLPA 4YABA 4UYGA 4O7AA 5CUGA 5EGUA 5E74A 5KTWA 3O35A 5FE9A 4WHUA 5I86A 5CS8A 5DYXA 4TQNA 5DLZA 3Q2EA 5A82A 5CUBA 4UYFA 2DWWA 5D25A 4QSWA 5EISA 5K29A 4WHWA 3GG3A 5A7CA 3G0JA 4UIXA 2L85A 2DVVA
chains in the Genus database with same CATH topology
4QYLA 4HXSA 5ENEA 2YDWA 2YQDA 5HENA 3JVLA 5D24A 5FFYA 4TS8A 5LVRA 2D9EA 4TT2A 2F6JA 5CQ6A 4KV1A 5C85A 5I88A 5CQAA 5EK9A 5F60A 5EPBA 5F5ZA 5EA1A 4J3IA 5EI4A 5A5SA 3DWYA 5IG6A 5KHMA 5ACYA 2LSPB 5TCMA 4QY4A 5FFVA 4X2IA 5HFRA 3LXJA 2OO1A 4HXLA 5IGKA 4MR6A 4IORA 5I1QA 5L8TA 4OGJA 4WIVA 4MEPA 5A5NA 4CUPA 5L99A 3MXFA 4UIUA 5I83A 5FG4A 4CLBA 4YK0A 4J0RA 4QSQA 4XUBA 5L97A 5A5PA 2NXBA 4GPJA 4Z1QA 5DKDA 4YH3A 5D3RA 4PKLA 2F6NA 5I7XA 4QSUA 5E9MA 3NXBA 4NQMA 4YC9A 2RNXA 5C7NA 5D0CA 5ENBA 5I29A 2GRCA 3IU5A 4O75A 3P1FA 5LJ0A 4HBXA 4Z1SA 3Q2FA 4HXMA 5IIDA 5DYAA 4UYFB 4TYLA 2DVQA 5EWWA 5D3NA 4TU4A 4LRGA 5LJ1A 5AD2A 2RFJA 5FE2A 5LJ2A 3G0LA 5FE8A 4LZ2A 5F3AA 5CQ4A 4N3WA 4HBVA 4HBYA 4TZ2A 2RO1A 5FDZA 5FE4A 2DATA 4ZW1A 5J0DA 5H1UA 5E9IA 5HELA 4O7CA 5HCLA 4O71A 5D3JA 4QSRA 4Y03A 3P1CA 4LR6A 5CPEA 5JWMA 3I3JA 5F36A 5F61A 4NS5A 2DVSA 3UV4A 4QNSA 4YYDA 5BT4A 5DY7A 5E9YA 3JVJA 5CFWA 4LYSA 1E6IA 4KCXA 5A81A 4QEUA 4QSSA 4LC2A 4UIZA 2YELA 4O74A 3HMFA 5CP5A 3MULA 5II1A 2YW5A 5C87A 5DYCA 5EWVA 4BJXA 4CFLA 5BT3A 4NYWA 5FE1A 5DW2A 3S91A 5LKUA 4QYDA 4TTEA 4NR9A 5ETBA 5COIA 5EWCA 3P1EA 5II2A 5IGMA 4QUTA 5EQ1A 4IR4A 5FH8A 3U5JA 3JVKA 4N4FA 5ENIA 3O34A 3FKMX 4YYHA 4A9MA 2RNYA 4QSVA 3P5OA 4O7EA 4KV4A 2YEMA 4C66A 5G4RA 5CUEA 1JM4B 5D3HA 2E3KA 3MB4A 4HXNA 3SVHA 5E7DA 5DKHA 4AKNA 5CGPA 4E96A 5FBXA 4Z6IA 2E7NA 4OUFA 4N4IA 4N4GA 4YY6A 4YBMA 5DFBA 5FG5A 2I7KA 5HQ5A 5A5OA 5A85A 3U5KA 4BW1A 5C89A 4BHWA 1WUGA 2L84A 4XY8A 3UVDA 4QB3A 5HEMA 2RI7A 4FLPA 4TT4A 5EV9A 5A5RA 1WUMA 3AQAA 4NR7A 5A83A 4NR6A 5EPSA 5EU1A 4CL9A 2YYNA 5F25A 5LUUA 4PTBA 5EP7A 4O70A 5ENJA 5I89A 4Q0NA 5D7XA 5F62A 4A9JA 4A9HA 4TZ8A 5FFWA 5L98A 5CUCA 5DFCA 2N9GA 2DKWA 5AMFA 5HLSA 4HXPA 4XYAA 4YYNA 5ENGA 4J1PA 4O7FA 4NRBA 4Z6HA 3U5NA 5I40A 3HMHA 4IOOA 4QSPA 5HJCA 3JVMA 4YBTA 3UVWA 1F68A 4QBMA 4QEWA 4PCEA 1ZS5A 3U5OA 4RVRA 4UYHA 4QR4A 5EWHA 5FH6A 4NRCA 5IBNA 4N4HA 4LYIA 2OUOA 5FE3A 2D82A 3LQIA 4CUQA 4QR3A 4QR5A 5F63A 4CUUA 5FH7A 4YYJA 4YH4A 5DLXA 5E9LA 5CQTA 4YYGA 4IR6A 5E9VA 4DONA 2I8NA 5CUDA 5FE5A 2R10A 4QSTA 4MEQA 3P1DA 3ONIA 4QSXA 4UIWA 5D3LA 5H1VA 5FB0A 2OSSA 5CRMA 4CUTA 4NYXA 4C67A 4YY4A 5DKCA 4ALHA 5CQ5A 3QZVA 4A9IA 4NR4A 4Q0OA 4O76A 3UV5A 5IGNA 4NXJA 5KU3A 4UITA 2E7OA 5CQ3A 2R0VA 5HM0A 3O37A 4BW3A 3U5LA 4A9NA 4TU6A 5CQ7A 2RNWA 4HXKA 5CTLA 2YEKA 4MENA 4ALGA 5G4SA 5FE0A 5D26A 3UW9A 3MB3A 5CQ8A 5CUAA 4YADA 5EM3A 5L8UA 4YYKA 4LZRA 5AMEA 4J0SA 4O7BA 3D7CA 3S92A 4OGIA 2WP2A 4YAXA 4MR3A 4ZC9A 3IU6A 4IOQA 3O33A 5TB6A 4UIVA 5ENHA 3QZTA 4YBSA 4A9FA 4NUDA 3AADA 4O72A 4BW4A 4PY6A 5F1LA 2R0SA 4O78A 5D3PA 4XY9A 2G4AA 4CUSA 1N72A 2R0YA 5L96A 2KTBB 4CFKA 4NRAA 4IR5A 5F1HA 4A9KA 3LJWA 5KO4A 4MR4A 3MQMA 5FG6A 3U5PA 5HRXA 5DW1A 5CRZA 3ZYUA 4NR5A 3UV2A 5I7YA 2RS9B 4MR5A 4NR8A 5DYUA 3O36A 3QZSA 4HXRA 5FE7A 5DFDA 1EQFA 4CURA 5HQ6A 3HMEA 2FSAA 3UVXA 4O77A 5FE6A 3U5MA 5E73A 2MJVB 5HRWA 5E0RA 4UIYA 3RCWA 5D3SA 2L5EA 2WP1A 5EWDA 4NQNA 4XUAA 5HFQA 5KTXA 4YATA 5BT5A 4PCIA 4UYDA 5D3TA 4A9LA 4A9EA 5LKTA 4MEOA 5H1TA 1JSPB 4F3IA 5A5QA 4BW2A 4HBWA 2DVRA 5DBMA 4LDFA 5LKZA 3DAIA 4LZSA 5EICA 4QZSA 1X0JA 5E3DA 4Z93A 5E3GA 5FB1A 3SVGA 5LVQA 4PS5A 3UVYA 4YYIA 4QEVA 4NUEA 5DX4A 5JI8A 4QC3A 5H85A 2H60A 5HRVA 5ENFA 4LYWA 3SVFA 5E9KA 4HXOA 4QC1A 5I80A 5CZGA 4NUCA 5CU8A 5ETDA 4ZQLA 5CY9A 3LQHA 4NYVA 3MUKA 5AD3A 5C4QA 4TT6A 5C8GA 4YYMA 5IGLA 5ENCA 5F2PA 4UYEA 4A9OA 5EVAA 3K2JA 3LQJA 4IR3A 5EPRA 5KTUA 5HQ7A 5LKXA 4QUUA 3TLPA 4YABA 4UYGA 4O7AA 5CUGA 5EGUA 5E74A 5KTWA 3O35A 5FE9A 4WHUA 5I86A 5CS8A 5DYXA 4TQNA 5DLZA 3Q2EA 5A82A 5CUBA 4UYFA 2DWWA 5D25A 4QSWA 5EISA 5K29A 4WHWA 3GG3A 5A7CA 3G0JA 4UIXA 2L85A 2DVVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QYL A;  4HXS A;  5ENE A;  2YDW A;  2YQD A;  5HEN A;  3JVL A;  5D24 A;  5FFY A;  4TS8 A;  5LVR A;  2D9E A;  4TT2 A;  2F6J A;  5CQ6 A;  4KV1 A;  5C85 A;  5I88 A;  5CQA A;  5EK9 A;  5F60 A;  5EPB A;  5F5Z A;  5EA1 A;  4J3I A;  5EI4 A;  5A5S A;  3DWY A;  5IG6 A;  5KHM A;  5ACY A;  2LSP B;  5TCM A;  4QY4 A;  5FFV A;  4X2I A;  5HFR A;  3LXJ A;  2OO1 A;  4HXL A;  5IGK A;  4MR6 A;  4IOR A;  5I1Q A;  5L8T A;  4OGJ A;  4WIV A;  4MEP A;  5A5N A;  4CUP A;  5L99 A;  3MXF A;  4UIU A;  5I83 A;  5FG4 A;  4CLB A;  4YK0 A;  4J0R A;  4QSQ A;  4XUB A;  5L97 A;  5A5P A;  2NXB A;  4GPJ A;  4Z1Q A;  5DKD A;  4YH3 A;  5D3R A;  4PKL A;  2F6N A;  5I7X A;  4QSU A;  5E9M A;  3NXB A;  4NQM A;  4YC9 A;  2RNX A;  5C7N A;  5D0C A;  5ENB A;  5I29 A;  2GRC A;  3IU5 A;  4O75 A;  3P1F A;  5LJ0 A;  4HBX A;  4Z1S A;  3Q2F A;  4HXM A;  5IID A;  5DYA A;  4UYF B;  4TYL A;  2DVQ A;  5EWW A;  5D3N A;  4TU4 A;  4LRG A;  5LJ1 A;  5AD2 A;  2RFJ A;  5FE2 A;  5LJ2 A;  3G0L A;  5FE8 A;  4LZ2 A;  5F3A A;  5CQ4 A;  4N3W A;  4HBV A;  4HBY A;  4TZ2 A;  2RO1 A;  5FDZ A;  5FE4 A;  2DAT A;  4ZW1 A;  5J0D A;  5H1U A;  5E9I A;  5HEL A;  4O7C A;  5HCL A;  4O71 A;  5D3J A;  4QSR A;  4Y03 A;  3P1C A;  4LR6 A;  5CPE A;  5JWM A;  3I3J A;  5F36 A;  5F61 A;  4NS5 A;  2DVS A;  3UV4 A;  4QNS A;  4YYD A;  5BT4 A;  5DY7 A;  5E9Y A;  3JVJ A;  5CFW A;  4LYS A;  1E6I A;  4KCX A;  5A81 A;  4QEU A;  4QSS A;  4LC2 A;  4UIZ A;  2YEL A;  4O74 A;  3HMF A;  5CP5 A;  3MUL A;  5II1 A;  2YW5 A;  5C87 A;  5DYC A;  5EWV A;  4BJX A;  4CFL A;  5BT3 A;  4NYW A;  5FE1 A;  5DW2 A;  3S91 A;  5LKU A;  4QYD A;  4TTE A;  4NR9 A;  5ETB A;  5COI A;  5EWC A;  3P1E A;  5II2 A;  5IGM A;  4QUT A;  5EQ1 A;  4IR4 A;  5FH8 A;  3U5J A;  3JVK A;  4N4F A;  5ENI A;  3O34 A;  3FKM X;  4YYH A;  4A9M A;  2RNY A;  4QSV A;  3P5O A;  4O7E A;  4KV4 A;  2YEM A;  4C66 A;  5G4R A;  5CUE A;  1JM4 B;  5D3H A;  2E3K A;  3MB4 A;  4HXN A;  3SVH A;  5E7D A;  5DKH A;  4AKN A;  5CGP A;  4E96 A;  5FBX A;  4Z6I A;  2E7N A;  4OUF A;  4N4I A;  4N4G A;  4YY6 A;  4YBM A;  5DFB A;  5FG5 A;  2I7K A;  5HQ5 A;  5A5O A;  5A85 A;  3U5K A;  4BW1 A;  5C89 A;  4BHW A;  1WUG A;  2L84 A;  4XY8 A;  3UVD A;  4QB3 A;  5HEM A;  2RI7 A;  4FLP A;  4TT4 A;  5EV9 A;  5A5R A;  1WUM A;  3AQA A;  4NR7 A;  5A83 A;  4NR6 A;  5EPS A;  5EU1 A;  4CL9 A;  2YYN A;  5F25 A;  5LUU A;  4PTB A;  5EP7 A;  4O70 A;  5ENJ A;  5I89 A;  4Q0N A;  5D7X A;  5F62 A;  4A9J A;  4A9H A;  4TZ8 A;  5FFW A;  5L98 A;  5CUC A;  5DFC A;  2N9G A;  2DKW A;  5AMF A;  5HLS A;  4HXP A;  4XYA A;  4YYN A;  5ENG A;  4J1P A;  4O7F A;  4NRB A;  4Z6H A;  3U5N A;  5I40 A;  3HMH A;  4IOO A;  4QSP A;  5HJC A;  3JVM A;  4YBT A;  3UVW A;  1F68 A;  4QBM A;  4QEW A;  4PCE A;  1ZS5 A;  3U5O A;  4RVR A;  4UYH A;  4QR4 A;  5EWH A;  5FH6 A;  4NRC A;  5IBN A;  4N4H A;  4LYI A;  2OUO A;  5FE3 A;  2D82 A;  3LQI A;  4CUQ A;  4QR3 A;  4QR5 A;  5F63 A;  4CUU A;  5FH7 A;  4YYJ A;  4YH4 A;  5DLX A;  5E9L A;  5CQT A;  4YYG A;  4IR6 A;  5E9V A;  4DON A;  2I8N A;  5CUD A;  5FE5 A;  2R10 A;  4QST A;  4MEQ A;  3P1D A;  3ONI A;  4QSX A;  4UIW A;  5D3L A;  5H1V A;  5FB0 A;  2OSS A;  5CRM A;  4CUT A;  4NYX A;  4C67 A;  4YY4 A;  5DKC A;  4ALH A;  5CQ5 A;  3QZV A;  4A9I A;  4NR4 A;  4Q0O A;  4O76 A;  3UV5 A;  5IGN A;  4NXJ A;  5KU3 A;  4UIT A;  2E7O A;  5CQ3 A;  2R0V A;  5HM0 A;  3O37 A;  4BW3 A;  3U5L A;  4A9N A;  4TU6 A;  5CQ7 A;  2RNW A;  4HXK A;  5CTL A;  2YEK A;  4MEN A;  4ALG A;  5G4S A;  5FE0 A;  5D26 A;  3UW9 A;  3MB3 A;  5CQ8 A;  5CUA A;  4YAD A;  5EM3 A;  5L8U A;  4YYK A;  4LZR A;  5AME A;  4J0S A;  4O7B A;  3D7C A;  3S92 A;  4OGI A;  2WP2 A;  4YAX A;  4MR3 A;  4ZC9 A;  3IU6 A;  4IOQ A;  3O33 A;  5TB6 A;  4UIV A;  5ENH A;  3QZT A;  4YBS A;  4A9F A;  4NUD A;  3AAD A;  4O72 A;  4BW4 A;  4PY6 A;  5F1L A;  2R0S A;  4O78 A;  5D3P A;  4XY9 A;  2G4A A;  4CUS A;  1N72 A;  2R0Y A;  5L96 A;  2KTB B;  4CFK A;  4NRA A;  4IR5 A;  5F1H A;  4A9K A;  3LJW A;  5KO4 A;  4MR4 A;  3MQM A;  5FG6 A;  3U5P A;  5HRX A;  5DW1 A;  5CRZ A;  3ZYU A;  4NR5 A;  3UV2 A;  5I7Y A;  2RS9 B;  4MR5 A;  4NR8 A;  5DYU A;  3O36 A;  3QZS A;  4HXR A;  5FE7 A;  5DFD A;  1EQF A;  4CUR A;  5HQ6 A;  3HME A;  2FSA A;  3UVX A;  4O77 A;  5FE6 A;  3U5M A;  5E73 A;  2MJV B;  5HRW A;  5E0R A;  4UIY A;  3RCW A;  5D3S A;  2L5E A;  2WP1 A;  5EWD A;  4NQN A;  4XUA A;  5HFQ A;  5KTX A;  4YAT A;  5BT5 A;  4PCI A;  4UYD A;  5D3T A;  4A9L A;  4A9E A;  5LKT A;  4MEO A;  5H1T A;  1JSP B;  4F3I A;  5A5Q A;  4BW2 A;  4HBW A;  2DVR A;  5DBM A;  4LDF A;  5LKZ A;  3DAI A;  4LZS A;  5EIC A;  4QZS A;  1X0J A;  5E3D A;  4Z93 A;  5E3G A;  5FB1 A;  3SVG A;  5LVQ A;  4PS5 A;  3UVY A;  4YYI A;  4QEV A;  4NUE A;  5DX4 A;  5JI8 A;  4QC3 A;  5H85 A;  2H60 A;  5HRV A;  5ENF A;  4LYW A;  3SVF A;  5E9K A;  4HXO A;  4QC1 A;  5I80 A;  5CZG A;  4NUC A;  5CU8 A;  5ETD A;  4ZQL A;  5CY9 A;  3LQH A;  4NYV A;  3MUK A;  5AD3 A;  5C4Q A;  4TT6 A;  5C8G A;  4YYM A;  5IGL A;  5ENC A;  5F2P A;  4UYE A;  4A9O A;  5EVA A;  3K2J A;  3LQJ A;  4IR3 A;  5EPR A;  5KTU A;  5HQ7 A;  5LKX A;  4QUU A;  3TLP A;  4YAB A;  4UYG A;  4O7A A;  5CUG A;  5EGU A;  5E74 A;  5KTW A;  3O35 A;  5FE9 A;  4WHU A;  5I86 A;  5CS8 A;  5DYX A;  4TQN A;  5DLZ A;  3Q2E A;  5A82 A;  5CUB A;  4UYF A;  2DWW A;  5D25 A;  4QSW A;  5EIS A;  5K29 A;  4WHW A;  3GG3 A;  5A7C A;  3G0J A;  4UIX A;  2L85 A;  2DVV A; 
#chains in the Genus database with same CATH topology
 4QYL A;  4HXS A;  5ENE A;  2YDW A;  2YQD A;  5HEN A;  3JVL A;  5D24 A;  5FFY A;  4TS8 A;  5LVR A;  2D9E A;  3VKH A;  4TT2 A;  2F6J A;  5CQ6 A;  4KV1 A;  5C85 A;  5I88 A;  5CQA A;  5EK9 A;  5F60 A;  5EPB A;  5F5Z A;  5EA1 A;  4J3I A;  5EI4 A;  5A5S A;  3DWY A;  5IG6 A;  5KHM A;  5ACY A;  2LSP B;  5TCM A;  4QY4 A;  5FFV A;  4X2I A;  5HFR A;  3LXJ A;  2OO1 A;  4HXL A;  5IGK A;  4MR6 A;  4IOR A;  2EJN A;  5I1Q A;  5L8T A;  4OGJ A;  4WIV A;  4MEP A;  5A5N A;  4CUP A;  5L99 A;  3MXF A;  4UIU A;  5I83 A;  5FG4 A;  4CLB A;  4YK0 A;  4J0R A;  4QSQ A;  4XUB A;  5L97 A;  5A5P A;  2NXB A;  4GPJ A;  4Z1Q A;  5DKD A;  4YH3 A;  5D3R A;  4PKL A;  2F6N A;  5I7X A;  4QSU A;  1PUO A;  5E9M A;  3NXB A;  4NQM A;  4YC9 A;  2RNX A;  5C7N A;  5D0C A;  5ENB A;  5I29 A;  2GRC A;  3IU5 A;  4O75 A;  3P1F A;  5LJ0 A;  4HBX A;  4Z1S A;  3Q2F A;  1ZKR A;  4HXM A;  5IID A;  5DYA A;  4UYF B;  4TYL A;  2DVQ A;  5EWW A;  5D3N A;  4TU4 A;  4LRG A;  5LJ1 A;  5AD2 A;  2RFJ A;  5FE2 A;  5LJ2 A;  3G0L A;  5FE8 A;  4LZ2 A;  5F3A A;  5CQ4 A;  4N3W A;  4HBV A;  4HBY A;  4TZ2 A;  2RO1 A;  5FDZ A;  5FE4 A;  2DAT A;  4ZW1 A;  5J0D A;  5H1U A;  5E9I A;  5HEL A;  4O7C A;  5HCL A;  4O71 A;  5D3J A;  4QSR A;  4Y03 A;  3P1C A;  4LR6 A;  5CPE A;  5JWM A;  3I3J A;  5F36 A;  5F61 A;  4NS5 A;  2DVS A;  3UV4 A;  4QNS A;  4YYD A;  5BT4 A;  5DY7 A;  5E9Y A;  3JVJ A;  5CFW A;  4LYS A;  3ERR A;  1E6I A;  4KCX A;  5A81 A;  4QEU A;  4QSS A;  4LC2 A;  4UIZ A;  4AKI A;  2YEL A;  4O74 A;  3HMF A;  5CP5 A;  3MUL A;  5II1 A;  2YW5 A;  5C87 A;  5DYC A;  5EWV A;  4BJX A;  4CFL A;  5BT3 A;  4NYW A;  5FE1 A;  5DW2 A;  3S91 A;  5LKU A;  4QYD A;  4TTE A;  4NR9 A;  5ETB A;  5COI A;  5EWC A;  3P1E A;  5II2 A;  5IGM A;  4QUT A;  5EQ1 A;  4IR4 A;  5FH8 A;  3U5J A;  3JVK A;  4N4F A;  5ENI A;  3O34 A;  3FKM X;  4YYH A;  4A9M A;  2RNY A;  4QSV A;  3P5O A;  4O7E A;  4KV4 A;  2YEM A;  4C66 A;  5G4R A;  5CUE A;  1JM4 B;  5D3H A;  2E3K A;  3MB4 A;  4HXN A;  3SVH A;  5E7D A;  5DKH A;  4AKN A;  5CGP A;  4E96 A;  5FBX A;  4Z6I A;  2E7N A;  4OUF A;  4N4I A;  4N4G A;  4YY6 A;  4YBM A;  5DFB A;  5FG5 A;  2I7K A;  5HQ5 A;  4AKH A;  5A5O A;  5A85 A;  3U5K A;  4BW1 A;  5C89 A;  4BHW A;  1WUG A;  2L84 A;  4XY8 A;  3UVD A;  4QB3 A;  5HEM A;  2RI7 A;  4FLP A;  4TT4 A;  5EV9 A;  5A5R A;  1WUM A;  3AQA A;  4NR7 A;  5A83 A;  4NR6 A;  5EPS A;  5EU1 A;  3VKG A;  4CL9 A;  2YYN A;  5F25 A;  5LUU A;  4PTB A;  5EP7 A;  4O70 A;  5ENJ A;  5I89 A;  4Q0N A;  5D7X A;  5F62 A;  4A9J A;  4A9H A;  4TZ8 A;  5FFW A;  5L98 A;  5CUC A;  5DFC A;  2N9G A;  2DKW A;  5AMF A;  5HLS A;  4HXP A;  4XYA A;  4YYN A;  5ENG A;  4J1P A;  4O7F A;  4NRB A;  4Z6H A;  3U5N A;  5I40 A;  3HMH A;  4IOO A;  4QSP A;  5HJC A;  3JVM A;  4YBT A;  3UVW A;  1F68 A;  4QBM A;  4QEW A;  4PCE A;  1ZS5 A;  3U5O A;  4RVR A;  4UYH A;  4QR4 A;  5EWH A;  5FH6 A;  4NRC A;  5IBN A;  4N4H A;  4LYI A;  2OUO A;  5FE3 A;  2D82 A;  3LQI A;  4CUQ A;  4QR3 A;  4QR5 A;  5F63 A;  4CUU A;  5FH7 A;  4YYJ A;  4YH4 A;  5DLX A;  5E9L A;  5CQT A;  4YYG A;  4IR6 A;  5E9V A;  4DON A;  2I8N A;  5CUD A;  5FE5 A;  2R10 A;  4QST A;  4MEQ A;  3P1D A;  3ONI A;  4QSX A;  4UIW A;  5D3L A;  5H1V A;  5FB0 A;  2OSS A;  5CRM A;  4CUT A;  4NYX A;  4C67 A;  4YY4 A;  5DKC A;  4ALH A;  5CQ5 A;  3QZV A;  4A9I A;  4NR4 A;  4Q0O A;  4O76 A;  3UV5 A;  5IGN A;  4NXJ A;  5KU3 A;  4UIT A;  4AI6 A;  2E7O A;  5CQ3 A;  2R0V A;  5HM0 A;  3O37 A;  4BW3 A;  3U5L A;  4A9N A;  4TU6 A;  5CQ7 A;  2RNW A;  4HXK A;  5CTL A;  2YEK A;  4MEN A;  4ALG A;  5G4S A;  5FE0 A;  5D26 A;  3UW9 A;  3MB3 A;  5CQ8 A;  5CUA A;  4YAD A;  5EM3 A;  5L8U A;  4YYK A;  4LZR A;  5AME A;  4J0S A;  4O7B A;  3D7C A;  3S92 A;  4OGI A;  2WP2 A;  4YAX A;  4MR3 A;  4ZC9 A;  3IU6 A;  4IOQ A;  3O33 A;  5TB6 A;  4UIV A;  5ENH A;  3QZT A;  3D1D A;  4YBS A;  4A9F A;  4NUD A;  3AAD A;  4O72 A;  4BW4 A;  4PY6 A;  5F1L A;  2R0S A;  4O78 A;  5D3P A;  4XY9 A;  2G4A A;  4CUS A;  1N72 A;  2R0Y A;  5L96 A;  2KTB B;  4CFK A;  4NRA A;  4IR5 A;  5F1H A;  4A9K A;  3LJW A;  5KO4 A;  4MR4 A;  3MQM A;  5FG6 A;  3U5P A;  5HRX A;  5DW1 A;  5CRZ A;  3ZYU A;  4NR5 A;  3UV2 A;  5I7Y A;  2RS9 B;  4MR5 A;  4NR8 A;  5DYU A;  3D1B A;  3O36 A;  3QZS A;  4HXR A;  5FE7 A;  1EQF A;  5DFD A;  4CUR A;  5HQ6 A;  3HME A;  2FSA A;  3UVX A;  4O77 A;  5FE6 A;  3U5M A;  5E73 A;  2MJV B;  5HRW A;  5E0R A;  4UIY A;  3RCW A;  5D3S A;  2L5E A;  2WP1 A;  5EWD A;  4NQN A;  4XUA A;  5HFQ A;  5KTX A;  4YAT A;  5BT5 A;  4PCI A;  4UYD A;  5D3T A;  4A9L A;  4A9E A;  5LKT A;  4MEO A;  5H1T A;  1JSP B;  4F3I A;  5A5Q A;  4BW2 A;  4HBW A;  2DVR A;  5DBM A;  4LDF A;  5LKZ A;  3DAI A;  4LZS A;  5EIC A;  4QZS A;  1X0J A;  5E3D A;  4Z93 A;  5E3G A;  5FB1 A;  3SVG A;  5LVQ A;  4PS5 A;  3UVY A;  4YYI A;  4QEV A;  4NUE A;  5DX4 A;  5JI8 A;  4QC3 A;  5H85 A;  4AKG A;  2H60 A;  5HRV A;  5ENF A;  4LYW A;  3SVF A;  5E9K A;  4HXO A;  4QC1 A;  5I80 A;  5CZG A;  4NUC A;  5CU8 A;  5ETD A;  4ZQL A;  5CY9 A;  3LQH A;  4NYV A;  3MUK A;  5AD3 A;  5C4Q A;  4TT6 A;  5C8G A;  4YYM A;  5IGL A;  5ENC A;  5F2P A;  4UYE A;  4A9O A;  5EVA A;  3K2J A;  3LQJ A;  4IR3 A;  5EPR A;  5KTU A;  5HQ7 A;  5LKX A;  4QUU A;  3TLP A;  4YAB A;  4UYG A;  4O7A A;  5CUG A;  5EGU A;  5E74 A;  5KTW A;  3O35 A;  5FE9 A;  4WHU A;  5I86 A;  5CS8 A;  5DYX A;  4TQN A;  5DLZ A;  3Q2E A;  5A82 A;  5CUB A;  4UYF A;  2DWW A;  5D25 A;  4QSW A;  5EIS A;  5K29 A;  4WHW A;  3GG3 A;  5A7C A;  3G0J A;  4UIX A;  2L85 A;  2DVV A; 
#chains in the Genus database with same CATH homology
 4QYL A;  4HXS A;  5ENE A;  2YDW A;  2YQD A;  5HEN A;  3JVL A;  5D24 A;  5FFY A;  4TS8 A;  5LVR A;  2D9E A;  4TT2 A;  2F6J A;  5CQ6 A;  4KV1 A;  5C85 A;  5I88 A;  5CQA A;  5EK9 A;  5F60 A;  5EPB A;  5F5Z A;  5EA1 A;  4J3I A;  5EI4 A;  5A5S A;  3DWY A;  5IG6 A;  5KHM A;  5ACY A;  2LSP B;  5TCM A;  4QY4 A;  5FFV A;  4X2I A;  5HFR A;  3LXJ A;  2OO1 A;  4HXL A;  5IGK A;  4MR6 A;  4IOR A;  5I1Q A;  5L8T A;  4OGJ A;  4WIV A;  4MEP A;  5A5N A;  4CUP A;  5L99 A;  3MXF A;  4UIU A;  5I83 A;  5FG4 A;  4CLB A;  4YK0 A;  4J0R A;  4QSQ A;  4XUB A;  5L97 A;  5A5P A;  2NXB A;  4GPJ A;  4Z1Q A;  5DKD A;  4YH3 A;  5D3R A;  4PKL A;  2F6N A;  5I7X A;  4QSU A;  5E9M A;  3NXB A;  4NQM A;  4YC9 A;  2RNX A;  5C7N A;  5D0C A;  5ENB A;  5I29 A;  2GRC A;  3IU5 A;  4O75 A;  3P1F A;  5LJ0 A;  4HBX A;  4Z1S A;  3Q2F A;  4HXM A;  5IID A;  5DYA A;  4UYF B;  4TYL A;  2DVQ A;  5EWW A;  5D3N A;  4TU4 A;  4LRG A;  5LJ1 A;  5AD2 A;  2RFJ A;  5FE2 A;  5LJ2 A;  3G0L A;  5FE8 A;  4LZ2 A;  5F3A A;  5CQ4 A;  4N3W A;  4HBV A;  4HBY A;  4TZ2 A;  2RO1 A;  5FDZ A;  5FE4 A;  2DAT A;  4ZW1 A;  5J0D A;  5H1U A;  5E9I A;  5HEL A;  4O7C A;  5HCL A;  4O71 A;  5D3J A;  4QSR A;  4Y03 A;  3P1C A;  4LR6 A;  5CPE A;  5JWM A;  3I3J A;  5F36 A;  5F61 A;  4NS5 A;  2DVS A;  3UV4 A;  4QNS A;  4YYD A;  5BT4 A;  5DY7 A;  5E9Y A;  3JVJ A;  5CFW A;  4LYS A;  1E6I A;  4KCX A;  5A81 A;  4QEU A;  4QSS A;  4LC2 A;  4UIZ A;  2YEL A;  4O74 A;  3HMF A;  5CP5 A;  3MUL A;  5II1 A;  2YW5 A;  5C87 A;  5DYC A;  5EWV A;  4BJX A;  4CFL A;  5BT3 A;  4NYW A;  5FE1 A;  5DW2 A;  3S91 A;  5LKU A;  4QYD A;  4TTE A;  4NR9 A;  5ETB A;  5COI A;  5EWC A;  3P1E A;  5II2 A;  5IGM A;  4QUT A;  5EQ1 A;  4IR4 A;  5FH8 A;  3U5J A;  3JVK A;  4N4F A;  5ENI A;  3O34 A;  3FKM X;  4YYH A;  4A9M A;  2RNY A;  4QSV A;  3P5O A;  4O7E A;  4KV4 A;  2YEM A;  4C66 A;  5G4R A;  5CUE A;  1JM4 B;  5D3H A;  2E3K A;  3MB4 A;  4HXN A;  3SVH A;  5E7D A;  5DKH A;  4AKN A;  5CGP A;  4E96 A;  5FBX A;  4Z6I A;  2E7N A;  4OUF A;  4N4I A;  4N4G A;  4YY6 A;  4YBM A;  5DFB A;  5FG5 A;  2I7K A;  5HQ5 A;  5A5O A;  5A85 A;  3U5K A;  4BW1 A;  5C89 A;  4BHW A;  1WUG A;  2L84 A;  4XY8 A;  3UVD A;  4QB3 A;  5HEM A;  2RI7 A;  4FLP A;  4TT4 A;  5EV9 A;  5A5R A;  1WUM A;  3AQA A;  4NR7 A;  5A83 A;  4NR6 A;  5EPS A;  5EU1 A;  4CL9 A;  2YYN A;  5F25 A;  5LUU A;  4PTB A;  5EP7 A;  4O70 A;  5ENJ A;  5I89 A;  4Q0N A;  5D7X A;  5F62 A;  4A9J A;  4A9H A;  4TZ8 A;  5FFW A;  5L98 A;  5CUC A;  5DFC A;  2N9G A;  2DKW A;  5AMF A;  5HLS A;  4HXP A;  4XYA A;  4YYN A;  5ENG A;  4J1P A;  4O7F A;  4NRB A;  4Z6H A;  3U5N A;  5I40 A;  3HMH A;  4IOO A;  4QSP A;  5HJC A;  3JVM A;  4YBT A;  3UVW A;  1F68 A;  4QBM A;  4QEW A;  4PCE A;  1ZS5 A;  3U5O A;  4RVR A;  4UYH A;  4QR4 A;  5EWH A;  5FH6 A;  4NRC A;  5IBN A;  4N4H A;  4LYI A;  2OUO A;  5FE3 A;  2D82 A;  3LQI A;  4CUQ A;  4QR3 A;  4QR5 A;  5F63 A;  4CUU A;  5FH7 A;  4YYJ A;  4YH4 A;  5DLX A;  5E9L A;  5CQT A;  4YYG A;  4IR6 A;  5E9V A;  4DON A;  2I8N A;  5CUD A;  5FE5 A;  2R10 A;  4QST A;  4MEQ A;  3P1D A;  3ONI A;  4QSX A;  4UIW A;  5D3L A;  5H1V A;  5FB0 A;  2OSS A;  5CRM A;  4CUT A;  4NYX A;  4C67 A;  4YY4 A;  5DKC A;  4ALH A;  5CQ5 A;  3QZV A;  4A9I A;  4NR4 A;  4Q0O A;  4O76 A;  3UV5 A;  5IGN A;  4NXJ A;  5KU3 A;  4UIT A;  2E7O A;  5CQ3 A;  2R0V A;  5HM0 A;  3O37 A;  4BW3 A;  3U5L A;  4A9N A;  4TU6 A;  5CQ7 A;  2RNW A;  4HXK A;  5CTL A;  2YEK A;  4MEN A;  4ALG A;  5G4S A;  5FE0 A;  5D26 A;  3UW9 A;  3MB3 A;  5CQ8 A;  5CUA A;  4YAD A;  5EM3 A;  5L8U A;  4YYK A;  4LZR A;  5AME A;  4J0S A;  4O7B A;  3D7C A;  3S92 A;  4OGI A;  2WP2 A;  4YAX A;  4MR3 A;  4ZC9 A;  3IU6 A;  4IOQ A;  3O33 A;  5TB6 A;  4UIV A;  5ENH A;  3QZT A;  4YBS A;  4A9F A;  4NUD A;  3AAD A;  4O72 A;  4BW4 A;  4PY6 A;  5F1L A;  2R0S A;  4O78 A;  5D3P A;  4XY9 A;  2G4A A;  4CUS A;  1N72 A;  2R0Y A;  5L96 A;  2KTB B;  4CFK A;  4NRA A;  4IR5 A;  5F1H A;  4A9K A;  3LJW A;  5KO4 A;  4MR4 A;  3MQM A;  5FG6 A;  3U5P A;  5HRX A;  5DW1 A;  5CRZ A;  3ZYU A;  4NR5 A;  3UV2 A;  5I7Y A;  2RS9 B;  4MR5 A;  4NR8 A;  5DYU A;  3O36 A;  3QZS A;  4HXR A;  5FE7 A;  5DFD A;  1EQF A;  4CUR A;  5HQ6 A;  3HME A;  2FSA A;  3UVX A;  4O77 A;  5FE6 A;  3U5M A;  5E73 A;  2MJV B;  5HRW A;  5E0R A;  4UIY A;  3RCW A;  5D3S A;  2L5E A;  2WP1 A;  5EWD A;  4NQN A;  4XUA A;  5HFQ A;  5KTX A;  4YAT A;  5BT5 A;  4PCI A;  4UYD A;  5D3T A;  4A9L A;  4A9E A;  5LKT A;  4MEO A;  5H1T A;  1JSP B;  4F3I A;  5A5Q A;  4BW2 A;  4HBW A;  2DVR A;  5DBM A;  4LDF A;  5LKZ A;  3DAI A;  4LZS A;  5EIC A;  4QZS A;  1X0J A;  5E3D A;  4Z93 A;  5E3G A;  5FB1 A;  3SVG A;  5LVQ A;  4PS5 A;  3UVY A;  4YYI A;  4QEV A;  4NUE A;  5DX4 A;  5JI8 A;  4QC3 A;  5H85 A;  2H60 A;  5HRV A;  5ENF A;  4LYW A;  3SVF A;  5E9K A;  4HXO A;  4QC1 A;  5I80 A;  5CZG A;  4NUC A;  5CU8 A;  5ETD A;  4ZQL A;  5CY9 A;  3LQH A;  4NYV A;  3MUK A;  5AD3 A;  5C4Q A;  4TT6 A;  5C8G A;  4YYM A;  5IGL A;  5ENC A;  5F2P A;  4UYE A;  4A9O A;  5EVA A;  3K2J A;  3LQJ A;  4IR3 A;  5EPR A;  5KTU A;  5HQ7 A;  5LKX A;  4QUU A;  3TLP A;  4YAB A;  4UYG A;  4O7A A;  5CUG A;  5EGU A;  5E74 A;  5KTW A;  3O35 A;  5FE9 A;  4WHU A;  5I86 A;  5CS8 A;  5DYX A;  4TQN A;  5DLZ A;  3Q2E A;  5A82 A;  5CUB A;  4UYF A;  2DWW A;  5D25 A;  4QSW A;  5EIS A;  5K29 A;  4WHW A;  3GG3 A;  5A7C A;  3G0J A;  4UIX A;  2L85 A;  2DVV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...