5I1QA

Second bromodomain of taf1 bound to a pyrrolopyridone compound
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
135
structure length
135
Chain Sequence
DDDQVAFSFILDNIVTQKMMAVPDSWPFHHPVNKKFVPDYYKVIVNPMDLETIRKNISKHKYQSRESFLDDVNLILANSVKYNGPESQYTKTAQEIVNVCYQTLTEYDEHLTQLEKDICTAKEAALEEAELESLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription initiation factor TFIID subunit 1
publication title Diving into the Water: Inducible Binding Conformations for BRD4, TAF1(2), BRD9, and CECR2 Bromodomains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/inhibitor
total genus 56
structure length 135
sequence length 135
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2016-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5i1qA00
4PCIA 5LVQA 5FFYA 2GRCA 4LR6A 3IU6A 4UYFA 4N4IA 1EQFA 4A9EA 2MJVB 5HFRA 5D25A 4LYWA 4A9FA 5I7YA 2RI7A 4UYDA 4UYFB 5HFQA 4IR5A 4QSSA 2FSAA 2RNWA 2DVVA 2NXBA 2YELA 4GPJA 2DVRA 3U5KA 4OGJA 4QSPA 4CUPA 5IGKA 4QB3A 2R0YA 4OGIA 4Z93A 4IOQA 4TZ2A 4UIVA 5CGPA 4IR3A 3DAIA 4PS5A 5HLSA 4TT2A 5ENGA 4NR8A 3UVDA 5H85A 4HXKA 5A81A 4YYHA 5ENIA 4TT4A 3IU5A 2R10A 2YEKA 4QSQA 4O74A 4Q0OA 1WUMA 4NYVA 4XY8A 5E73A 4TS8A 4TQNA 5FG4A 4CUSA 5JI8A 5F5ZA 4HXPA 5CQ7A 4O70A 4TZ8A 3MB4A 5D3LA 5F63A 2DKWA 5FFWA 3S92A 4YAXA 2YQDA 3JVKA 5C7NA 5FE5A 2DVQA 4LC2A 5BT5A 4QEUA 2OUOA 1JSPB 4YK0A 2WP2A 4NR4A 5L8TA 5HQ7A 5A85A 5A5PA 5CQ5A 3JVJA 5A5SA 3DWYA 5EWWA 4OUFA 5DFCA 4KV4A 4NUDA 4HXOA 5CUAA 1WUGA 2DVSA 5HQ5A 4NQNA 4NUCA 3U5MA 4QSXA 5CQ4A 2WP1A 4X2IA 5CUEA 5E9MA 4HBVA 3UVYA 4YATA 2DATA 5EWCA 5LKZA 5CQ6A 4YYMA 5DY7A 4NYWA 2YEMA 5AMEA 5FH6A 5II1A 5HM0A 4NR6A 1JM4B 4NYXA 5F36A 5D3JA 4HBXA 5C85A 3QZVA 5LKXA 4MEQA 5EP7A 3SVHA 5CS8A 4UIWA 4O78A 5CY9A 3U5PA 5DLXA 4YADA 4UYGA 2KTBB 5L99A 5DKHA 3U5NA 5F1LA 2I7KA 4MR5A 4QSVA 4QC3A 3LQIA 5EA1A 5A5QA 5HCLA 5LUUA 5EPRA 4ZW1A 5EICA 5F61A 5C87A 5DW1A 5F60A 4LRGA 5KTWA 4QNSA 5HRWA 5EQ1A 5ENBA 4Z1QA 5I89A 3O35A 4BW2A 5ENFA 3AADA 3ONIA 4UYHA 5EISA 2E3KA 5ACYA 4Q0NA 5I80A 5I86A 4QSUA 4IORA 5E9VA 3SVFA 5I40A 4Y03A 4QY4A 3P1CA 5HJCA 4YYNA 4CL9A 5D3SA 2R0SA 4ZC9A 5L96A 4XUBA 5J0DA 4QBMA 5EI4A 5CQAA 5EWHA 4O7EA 5LJ1A 4UITA 1X0JA 3UV4A 3LXJA 5FH8A 2L84A 3Q2EA 5C89A 2D82A 5EPBA 5I1QA 3UW9A 4CFKA 3LQHA 4IR6A 4FLPA 2DWWA 4C66A 4O71A 4WIVA 3G0LA 5FE3A 4HXRA 2OO1A 3UV2A 5EWDA 1N72A 5FE1A 4A9MA 5A5OA 5FG5A 5E3GA 2E7OA 4QSRA 2RNXA 3MB3A 4XY9A 2R0VA 3LJWA 4O72A 4PTBA 5A5RA 5LKUA 3QZTA 3P1FA 4HBWA 4YH3A 5D26A 5F1HA 5HQ6A 5HRXA 5F3AA 5BT3A 5I88A 3MUKA 4YABA 5FB0A 5EVAA 3O34A 4BW1A 4A9OA 4QR4A 5I29A 4QEVA 5IIDA 4NS5A 4A9IA 4TTEA 5FE6A 4J0SA 4A9LA 5AMFA 5KHMA 2D9EA 4YY6A 5KTUA 4HXMA 5LJ0A 5I7XA 5KU3A 4MR6A 5FBXA 2YW5A 4YYJA 5FB1A 2YYNA 4IOOA 2L5EA 5EWVA 4YC9A 5FE4A 4CURA 5E74A 4N4GA 5CP5A 3G0JA 5CUDA 4N4HA 4O77A 4YYIA 4QUUA 5LVRA 3AQAA 3O36A 5FE8A 5CUGA 4QSTA 4NUEA 4O7AA 4YBSA 5A82A 5E9KA 5IBNA 5E9IA 5CPEA 4QR3A 3P1DA 5ETDA 4PCEA 3O37A 4ALHA 4CUQA 4AKNA 4J3IA 4O7FA 4QZSA 4A9HA 5IGMA 5ENJA 4NR5A 3HMFA 5F62A 5L98A 5FG6A 5E0RA 4HXSA 4WHUA 5FH7A 3P5OA 3U5OA 2YDWA 3LQJA 3UVWA 5CUBA 5I83A 4XUAA 4PY6A 5FE0A 5TCMA 2G4AA 5HENA 5FE7A 5DX4A 3QZSA 2I8NA 5D24A 4J1PA 4RVRA 5ENHA 4QYDA 4E96A 5FE9A 5DYCA 2RO1A 1F68A 5ETBA 4NRCA 4YH4A 5LKTA 5DFBA 4C67A 3HMHA 5D3NA 5C4QA 2N9GA 5HRVA 5IG6A 3K2JA 3UVXA 4TT6A 4CUTA 3U5LA 4A9NA 5BT4A 4BW4A 4O7BA 5D3TA 3JVLA 5CRZA 1ZS5A 5LJ2A 4TYLA 3O33A 3UV5A 5DYXA 5EGUA 4Z1SA 5G4SA 5CUCA 5H1UA 5A83A 5IGNA 4UIUA 3MXFA 5CTLA 5FFVA 4TU4A 3SVGA 4HBYA 4NRBA 5COIA 4WHWA 4N3WA 4BW3A 4YYDA 2F6NA 5A7CA 4NQMA 5E7DA 3RCWA 5EM3A 4CUUA 4ZQLA 5D3PA 5A5NA 4MR3A 3GG3A 5CQTA 5EK9A 2RNYA 5E9LA 4LDFA 5II2A 5D3HA 4QSWA 4O76A 5DW2A 4YY4A 5AD3A 5KTXA 4IR4A 2E7NA 4A9KA 4CFLA 5C8GA 4MEOA 3U5JA 4NR7A 5H1TA 4KV1A 5D0CA 3ZYUA 5CQ3A 4ALGA 4BHWA 2RFJA 5ENEA 5DLZA 2F6JA 5F2PA 5HEMA 4HXLA 4LZ2A 4MR4A 4NRAA 5L97A 4HXNA 5CU8A 4MENA 5EU1A 5EPSA 4O75A 5DKDA 4QEWA 4F3IA 5L8UA 5FDZA 4NR9A 5KO4A 5D3RA 4A9JA 5CZGA 4MEPA 2OSSA 4LYIA 5EV9A 4NXJA 3P1EA 4UIYA 3FKMX 4CLBA 3JVMA 4N4FA 5DYAA 5E9YA 4YYGA 5CFWA 4UIZA 3TLPA 5DYUA 2L85A 4LYSA 2H60A 3MULA 5AD2A 5JWMA 4BJXA 4LZRA 4QUTA 4LZSA 3MQMA 3I3JA 2RS9B 5TB6A 5D7XA 4XYAA 5F25A 4UIXA 5DKCA 4QC1A 1E6IA 4O7CA 3HMEA 5H1VA 3S91A 5E3DA 5IGLA 4QR5A 5DBMA 5K29A 4TU6A 4YBMA 5CQ8A 4YBTA 4QYLA 5ENCA 5G4RA 4Z6HA 5DFDA 5FE2A 4KCXA 5CRMA 3Q2FA 4YYKA 4Z6IA 5HELA 4UYEA 3NXBA 4DONA 4PKLA 3D7CA 4J0RA 2LSPB
chains in the Genus database with same CATH superfamily
4PCIA 5LVQA 5FFYA 2GRCA 4LR6A 3IU6A 4UYFA 4N4IA 1EQFA 4A9EA 2MJVB 5HFRA 5D25A 4LYWA 4A9FA 5I7YA 2RI7A 4UYDA 4UYFB 5HFQA 4IR5A 4QSSA 2FSAA 2RNWA 2DVVA 2NXBA 2YELA 4GPJA 2DVRA 3U5KA 4AI6A 4OGJA 4QSPA 4CUPA 5IGKA 4QB3A 2R0YA 4OGIA 4Z93A 4IOQA 4TZ2A 4UIVA 5CGPA 4IR3A 3DAIA 4PS5A 5HLSA 4TT2A 5ENGA 4NR8A 3UVDA 5H85A 4HXKA 4AKIA 5A81A 4YYHA 5ENIA 4TT4A 3IU5A 2R10A 2YEKA 4QSQA 4O74A 4Q0OA 1WUMA 4NYVA 4XY8A 5E73A 4TS8A 4TQNA 5FG4A 4CUSA 5JI8A 5F5ZA 4HXPA 5CQ7A 4O70A 4TZ8A 1ZKRA 3MB4A 5D3LA 5F63A 2DKWA 5FFWA 3S92A 4YAXA 2YQDA 3JVKA 5C7NA 4AKGA 5FE5A 2DVQA 4LC2A 5BT5A 4QEUA 2OUOA 1JSPB 4YK0A 2WP2A 4NR4A 5L8TA 5HQ7A 5A85A 5A5PA 5CQ5A 3JVJA 5A5SA 3DWYA 5EWWA 4OUFA 5DFCA 4KV4A 4NUDA 4HXOA 5CUAA 1WUGA 2DVSA 5HQ5A 4NQNA 4NUCA 3U5MA 4QSXA 5CQ4A 2WP1A 4X2IA 5CUEA 5E9MA 4HBVA 3UVYA 4YATA 2DATA 5EWCA 5LKZA 5CQ6A 4YYMA 5DY7A 4NYWA 2YEMA 5AMEA 5FH6A 5II1A 5HM0A 4NR6A 1JM4B 4NYXA 5F36A 5D3JA 4HBXA 5C85A 3QZVA 5LKXA 4MEQA 5EP7A 3SVHA 5CS8A 4UIWA 4O78A 5CY9A 3U5PA 5DLXA 4YADA 4UYGA 2KTBB 5L99A 5DKHA 3U5NA 5F1LA 2I7KA 4MR5A 4QSVA 4QC3A 3LQIA 5EA1A 5A5QA 5HCLA 5LUUA 5EPRA 4ZW1A 5EICA 5F61A 5C87A 5DW1A 5F60A 4LRGA 5KTWA 4QNSA 5HRWA 5EQ1A 5ENBA 4Z1QA 5I89A 3O35A 4BW2A 5ENFA 3AADA 3ONIA 4UYHA 5EISA 1PUOA 2E3KA 5ACYA 4Q0NA 5I80A 5I86A 4QSUA 4IORA 5E9VA 3SVFA 5I40A 3VKHA 4Y03A 4QY4A 3P1CA 5HJCA 4YYNA 4CL9A 5D3SA 2R0SA 4ZC9A 5L96A 4XUBA 5J0DA 4QBMA 5EI4A 5CQAA 5EWHA 4O7EA 5LJ1A 4UITA 1X0JA 3UV4A 3LXJA 5FH8A 2L84A 3Q2EA 5C89A 2D82A 5EPBA 5I1QA 3UW9A 4CFKA 3LQHA 4IR6A 4FLPA 2DWWA 4C66A 4O71A 4WIVA 3G0LA 5FE3A 4HXRA 2OO1A 3UV2A 5EWDA 1N72A 5FE1A 4A9MA 5A5OA 5FG5A 5E3GA 2E7OA 4QSRA 2RNXA 3MB3A 4XY9A 2R0VA 3LJWA 4O72A 4PTBA 5A5RA 5LKUA 3QZTA 3P1FA 4HBWA 4YH3A 5D26A 5F1HA 5HQ6A 5HRXA 5F3AA 5BT3A 5I88A 3MUKA 4YABA 5FB0A 5EVAA 3O34A 4BW1A 4A9OA 4QR4A 5I29A 4QEVA 5IIDA 4NS5A 4A9IA 4TTEA 5FE6A 4J0SA 4A9LA 5AMFA 5KHMA 2D9EA 4YY6A 5KTUA 4HXMA 5LJ0A 5I7XA 5KU3A 4MR6A 5FBXA 2YW5A 4YYJA 5FB1A 2YYNA 4IOOA 2L5EA 5EWVA 4YC9A 5FE4A 4CURA 5E74A 4N4GA 5CP5A 3G0JA 5CUDA 4N4HA 4O77A 4YYIA 4QUUA 5LVRA 3AQAA 3O36A 5FE8A 5CUGA 4QSTA 3VKGA 4NUEA 4O7AA 4YBSA 5A82A 5E9KA 5IBNA 5E9IA 5CPEA 4QR3A 3P1DA 5ETDA 4PCEA 3O37A 4ALHA 4CUQA 4AKNA 4J3IA 4O7FA 4QZSA 4A9HA 5IGMA 5ENJA 4NR5A 3HMFA 5F62A 5L98A 5FG6A 5E0RA 4HXSA 4WHUA 5FH7A 3P5OA 3U5OA 2YDWA 3LQJA 3UVWA 5CUBA 5I83A 4XUAA 4PY6A 5FE0A 5TCMA 2G4AA 5HENA 3D1DA 5FE7A 5DX4A 3QZSA 2I8NA 5D24A 4J1PA 4RVRA 5ENHA 4QYDA 4E96A 5FE9A 5DYCA 2RO1A 1F68A 5ETBA 4NRCA 4YH4A 5LKTA 5DFBA 4C67A 3HMHA 5D3NA 5C4QA 2N9GA 5HRVA 5IG6A 3K2JA 3UVXA 4TT6A 4CUTA 3U5LA 4A9NA 5BT4A 4BW4A 4O7BA 5D3TA 3JVLA 5CRZA 1ZS5A 5LJ2A 4TYLA 3O33A 3UV5A 5DYXA 5EGUA 4Z1SA 5G4SA 5CUCA 5H1UA 5A83A 5IGNA 4UIUA 3MXFA 5CTLA 5FFVA 4TU4A 3SVGA 4HBYA 4NRBA 5COIA 4WHWA 4N3WA 4BW3A 4YYDA 2F6NA 5A7CA 4NQMA 5E7DA 3RCWA 3D1BA 5EM3A 4CUUA 4ZQLA 5D3PA 5A5NA 4MR3A 3GG3A 5CQTA 5EK9A 2RNYA 5E9LA 4LDFA 5II2A 5D3HA 4QSWA 4O76A 5DW2A 4YY4A 5AD3A 5KTXA 4IR4A 2E7NA 4A9KA 4CFLA 5C8GA 4MEOA 3U5JA 4NR7A 5H1TA 4KV1A 5D0CA 3ZYUA 5CQ3A 4ALGA 4BHWA 2RFJA 5ENEA 5DLZA 2F6JA 5F2PA 5HEMA 4HXLA 4LZ2A 4MR4A 4NRAA 5L97A 4HXNA 5CU8A 4MENA 5EU1A 5EPSA 4O75A 5DKDA 4QEWA 4F3IA 5L8UA 5FDZA 4NR9A 5KO4A 5D3RA 3ERRA 4A9JA 5CZGA 4MEPA 2OSSA 4LYIA 5EV9A 4NXJA 3P1EA 4UIYA 3FKMX 4CLBA 4AKHA 3JVMA 4N4FA 5DYAA 5E9YA 4YYGA 5CFWA 4UIZA 3TLPA 5DYUA 2L85A 4LYSA 2H60A 3MULA 5AD2A 5JWMA 4BJXA 4LZRA 4QUTA 4LZSA 3MQMA 2EJNA 3I3JA 2RS9B 5TB6A 5D7XA 4XYAA 5F25A 4UIXA 5DKCA 4QC1A 1E6IA 4O7CA 3HMEA 5H1VA 3S91A 5E3DA 5IGLA 4QR5A 5DBMA 5K29A 4TU6A 4YBMA 5CQ8A 4YBTA 4QYLA 5ENCA 5G4RA 4Z6HA 5DFDA 5FE2A 4KCXA 5CRMA 3Q2FA 4YYKA 4Z6IA 5HELA 4UYEA 3NXBA 4DONA 4PKLA 3D7CA 4J0RA 2LSPB
chains in the Genus database with same CATH topology
4PCIA 5LVQA 5FFYA 2GRCA 4LR6A 3IU6A 4UYFA 4N4IA 1EQFA 4A9EA 2MJVB 5HFRA 5D25A 4LYWA 4A9FA 5I7YA 2RI7A 4UYDA 4UYFB 5HFQA 4IR5A 4QSSA 2FSAA 2RNWA 2DVVA 2NXBA 2YELA 4GPJA 2DVRA 3U5KA 4OGJA 4QSPA 4CUPA 5IGKA 4QB3A 2R0YA 4OGIA 4Z93A 4IOQA 4TZ2A 4UIVA 5CGPA 4IR3A 3DAIA 4PS5A 5HLSA 4TT2A 5ENGA 4NR8A 3UVDA 5H85A 4HXKA 5A81A 4YYHA 5ENIA 4TT4A 3IU5A 2R10A 2YEKA 4QSQA 4O74A 4Q0OA 1WUMA 4NYVA 4XY8A 5E73A 4TS8A 4TQNA 5FG4A 4CUSA 5JI8A 5F5ZA 4HXPA 5CQ7A 4O70A 4TZ8A 3MB4A 5D3LA 5F63A 2DKWA 5FFWA 3S92A 4YAXA 2YQDA 3JVKA 5C7NA 5FE5A 2DVQA 4LC2A 5BT5A 4QEUA 2OUOA 1JSPB 4YK0A 2WP2A 4NR4A 5L8TA 5HQ7A 5A85A 5A5PA 5CQ5A 3JVJA 5A5SA 3DWYA 5EWWA 4OUFA 5DFCA 4KV4A 4NUDA 4HXOA 5CUAA 1WUGA 2DVSA 5HQ5A 4NQNA 4NUCA 3U5MA 4QSXA 5CQ4A 2WP1A 4X2IA 5CUEA 5E9MA 4HBVA 3UVYA 4YATA 2DATA 5EWCA 5LKZA 5CQ6A 4YYMA 5DY7A 4NYWA 2YEMA 5AMEA 5FH6A 5II1A 5HM0A 4NR6A 1JM4B 4NYXA 5F36A 5D3JA 4HBXA 5C85A 3QZVA 5LKXA 4MEQA 5EP7A 3SVHA 5CS8A 4UIWA 4O78A 5CY9A 3U5PA 5DLXA 4YADA 4UYGA 2KTBB 5L99A 5DKHA 3U5NA 5F1LA 2I7KA 4MR5A 4QSVA 4QC3A 3LQIA 5EA1A 5A5QA 5HCLA 5LUUA 5EPRA 4ZW1A 5EICA 5F61A 5C87A 5DW1A 5F60A 4LRGA 5KTWA 4QNSA 5HRWA 5EQ1A 5ENBA 4Z1QA 5I89A 3O35A 4BW2A 5ENFA 3AADA 3ONIA 4UYHA 5EISA 2E3KA 5ACYA 4Q0NA 5I80A 5I86A 4QSUA 4IORA 5E9VA 3SVFA 5I40A 4Y03A 4QY4A 3P1CA 5HJCA 4YYNA 4CL9A 5D3SA 2R0SA 4ZC9A 5L96A 4XUBA 5J0DA 4QBMA 5EI4A 5CQAA 5EWHA 4O7EA 5LJ1A 4UITA 1X0JA 3UV4A 3LXJA 5FH8A 2L84A 3Q2EA 5C89A 2D82A 5EPBA 5I1QA 3UW9A 4CFKA 3LQHA 4IR6A 4FLPA 2DWWA 4C66A 4O71A 4WIVA 3G0LA 5FE3A 4HXRA 2OO1A 3UV2A 5EWDA 1N72A 5FE1A 4A9MA 5A5OA 5FG5A 5E3GA 2E7OA 4QSRA 2RNXA 3MB3A 4XY9A 2R0VA 3LJWA 4O72A 4PTBA 5A5RA 5LKUA 3QZTA 3P1FA 4HBWA 4YH3A 5D26A 5F1HA 5HQ6A 5HRXA 5F3AA 5BT3A 5I88A 3MUKA 4YABA 5FB0A 5EVAA 3O34A 4BW1A 4A9OA 4QR4A 5I29A 4QEVA 5IIDA 4NS5A 4A9IA 4TTEA 5FE6A 4J0SA 4A9LA 5AMFA 5KHMA 2D9EA 4YY6A 5KTUA 4HXMA 5LJ0A 5I7XA 5KU3A 4MR6A 5FBXA 2YW5A 4YYJA 5FB1A 2YYNA 4IOOA 2L5EA 5EWVA 4YC9A 5FE4A 4CURA 5E74A 4N4GA 5CP5A 3G0JA 5CUDA 4N4HA 4O77A 4YYIA 4QUUA 5LVRA 3AQAA 3O36A 5FE8A 5CUGA 4QSTA 4NUEA 4O7AA 4YBSA 5A82A 5E9KA 5IBNA 5E9IA 5CPEA 4QR3A 3P1DA 5ETDA 4PCEA 3O37A 4ALHA 4CUQA 4AKNA 4J3IA 4O7FA 4QZSA 4A9HA 5IGMA 5ENJA 4NR5A 3HMFA 5F62A 5L98A 5FG6A 5E0RA 4HXSA 4WHUA 5FH7A 3P5OA 3U5OA 2YDWA 3LQJA 3UVWA 5CUBA 5I83A 4XUAA 4PY6A 5FE0A 5TCMA 2G4AA 5HENA 5FE7A 5DX4A 3QZSA 2I8NA 5D24A 4J1PA 4RVRA 5ENHA 4QYDA 4E96A 5FE9A 5DYCA 2RO1A 1F68A 5ETBA 4NRCA 4YH4A 5LKTA 5DFBA 4C67A 3HMHA 5D3NA 5C4QA 2N9GA 5HRVA 5IG6A 3K2JA 3UVXA 4TT6A 4CUTA 3U5LA 4A9NA 5BT4A 4BW4A 4O7BA 5D3TA 3JVLA 5CRZA 1ZS5A 5LJ2A 4TYLA 3O33A 3UV5A 5DYXA 5EGUA 4Z1SA 5G4SA 5CUCA 5H1UA 5A83A 5IGNA 4UIUA 3MXFA 5CTLA 5FFVA 4TU4A 3SVGA 4HBYA 4NRBA 5COIA 4WHWA 4N3WA 4BW3A 4YYDA 2F6NA 5A7CA 4NQMA 5E7DA 3RCWA 5EM3A 4CUUA 4ZQLA 5D3PA 5A5NA 4MR3A 3GG3A 5CQTA 5EK9A 2RNYA 5E9LA 4LDFA 5II2A 5D3HA 4QSWA 4O76A 5DW2A 4YY4A 5AD3A 5KTXA 4IR4A 2E7NA 4A9KA 4CFLA 5C8GA 4MEOA 3U5JA 4NR7A 5H1TA 4KV1A 5D0CA 3ZYUA 5CQ3A 4ALGA 4BHWA 2RFJA 5ENEA 5DLZA 2F6JA 5F2PA 5HEMA 4HXLA 4LZ2A 4MR4A 4NRAA 5L97A 4HXNA 5CU8A 4MENA 5EU1A 5EPSA 4O75A 5DKDA 4QEWA 4F3IA 5L8UA 5FDZA 4NR9A 5KO4A 5D3RA 4A9JA 5CZGA 4MEPA 2OSSA 4LYIA 5EV9A 4NXJA 3P1EA 4UIYA 3FKMX 4CLBA 3JVMA 4N4FA 5DYAA 5E9YA 4YYGA 5CFWA 4UIZA 3TLPA 5DYUA 2L85A 4LYSA 2H60A 3MULA 5AD2A 5JWMA 4BJXA 4LZRA 4QUTA 4LZSA 3MQMA 3I3JA 2RS9B 5TB6A 5D7XA 4XYAA 5F25A 4UIXA 5DKCA 4QC1A 1E6IA 4O7CA 3HMEA 5H1VA 3S91A 5E3DA 5IGLA 4QR5A 5DBMA 5K29A 4TU6A 4YBMA 5CQ8A 4YBTA 4QYLA 5ENCA 5G4RA 4Z6HA 5DFDA 5FE2A 4KCXA 5CRMA 3Q2FA 4YYKA 4Z6IA 5HELA 4UYEA 3NXBA 4DONA 4PKLA 3D7CA 4J0RA 2LSPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PCI A;  5LVQ A;  5FFY A;  2GRC A;  4LR6 A;  3IU6 A;  4UYF A;  4N4I A;  1EQF A;  4A9E A;  2MJV B;  5HFR A;  5D25 A;  4LYW A;  4A9F A;  5I7Y A;  2RI7 A;  4UYD A;  4UYF B;  5HFQ A;  4IR5 A;  4QSS A;  2FSA A;  2RNW A;  2DVV A;  2NXB A;  2YEL A;  4GPJ A;  2DVR A;  3U5K A;  4OGJ A;  4QSP A;  4CUP A;  5IGK A;  4QB3 A;  2R0Y A;  4OGI A;  4Z93 A;  4IOQ A;  4TZ2 A;  4UIV A;  5CGP A;  4IR3 A;  3DAI A;  4PS5 A;  5HLS A;  4TT2 A;  5ENG A;  4NR8 A;  3UVD A;  5H85 A;  4HXK A;  5A81 A;  4YYH A;  5ENI A;  4TT4 A;  3IU5 A;  2R10 A;  2YEK A;  4QSQ A;  4O74 A;  4Q0O A;  1WUM A;  4NYV A;  4XY8 A;  5E73 A;  4TS8 A;  4TQN A;  5FG4 A;  4CUS A;  5JI8 A;  5F5Z A;  4HXP A;  5CQ7 A;  4O70 A;  4TZ8 A;  3MB4 A;  5D3L A;  5F63 A;  2DKW A;  5FFW A;  3S92 A;  4YAX A;  2YQD A;  3JVK A;  5C7N A;  5FE5 A;  2DVQ A;  4LC2 A;  5BT5 A;  4QEU A;  2OUO A;  1JSP B;  4YK0 A;  2WP2 A;  4NR4 A;  5L8T A;  5HQ7 A;  5A85 A;  5A5P A;  5CQ5 A;  3JVJ A;  5A5S A;  3DWY A;  5EWW A;  4OUF A;  5DFC A;  4KV4 A;  4NUD A;  4HXO A;  5CUA A;  1WUG A;  2DVS A;  5HQ5 A;  4NQN A;  4NUC A;  3U5M A;  4QSX A;  5CQ4 A;  2WP1 A;  4X2I A;  5CUE A;  5E9M A;  4HBV A;  3UVY A;  4YAT A;  2DAT A;  5EWC A;  5LKZ A;  5CQ6 A;  4YYM A;  5DY7 A;  4NYW A;  2YEM A;  5AME A;  5FH6 A;  5II1 A;  5HM0 A;  4NR6 A;  1JM4 B;  4NYX A;  5F36 A;  5D3J A;  4HBX A;  5C85 A;  3QZV A;  5LKX A;  4MEQ A;  5EP7 A;  3SVH A;  5CS8 A;  4UIW A;  4O78 A;  5CY9 A;  3U5P A;  5DLX A;  4YAD A;  4UYG A;  2KTB B;  5L99 A;  5DKH A;  3U5N A;  5F1L A;  2I7K A;  4MR5 A;  4QSV A;  4QC3 A;  3LQI A;  5EA1 A;  5A5Q A;  5HCL A;  5LUU A;  5EPR A;  4ZW1 A;  5EIC A;  5F61 A;  5C87 A;  5DW1 A;  5F60 A;  4LRG A;  5KTW A;  4QNS A;  5HRW A;  5EQ1 A;  5ENB A;  4Z1Q A;  5I89 A;  3O35 A;  4BW2 A;  5ENF A;  3AAD A;  3ONI A;  4UYH A;  5EIS A;  2E3K A;  5ACY A;  4Q0N A;  5I80 A;  5I86 A;  4QSU A;  4IOR A;  5E9V A;  3SVF A;  5I40 A;  4Y03 A;  4QY4 A;  3P1C A;  5HJC A;  4YYN A;  4CL9 A;  5D3S A;  2R0S A;  4ZC9 A;  5L96 A;  4XUB A;  5J0D A;  4QBM A;  5EI4 A;  5CQA A;  5EWH A;  4O7E A;  5LJ1 A;  4UIT A;  1X0J A;  3UV4 A;  3LXJ A;  5FH8 A;  2L84 A;  3Q2E A;  5C89 A;  2D82 A;  5EPB A;  5I1Q A;  3UW9 A;  4CFK A;  3LQH A;  4IR6 A;  4FLP A;  2DWW A;  4C66 A;  4O71 A;  4WIV A;  3G0L A;  5FE3 A;  4HXR A;  2OO1 A;  3UV2 A;  5EWD A;  1N72 A;  5FE1 A;  4A9M A;  5A5O A;  5FG5 A;  5E3G A;  2E7O A;  4QSR A;  2RNX A;  3MB3 A;  4XY9 A;  2R0V A;  3LJW A;  4O72 A;  4PTB A;  5A5R A;  5LKU A;  3QZT A;  3P1F A;  4HBW A;  4YH3 A;  5D26 A;  5F1H A;  5HQ6 A;  5HRX A;  5F3A A;  5BT3 A;  5I88 A;  3MUK A;  4YAB A;  5FB0 A;  5EVA A;  3O34 A;  4BW1 A;  4A9O A;  4QR4 A;  5I29 A;  4QEV A;  5IID A;  4NS5 A;  4A9I A;  4TTE A;  5FE6 A;  4J0S A;  4A9L A;  5AMF A;  5KHM A;  2D9E A;  4YY6 A;  5KTU A;  4HXM A;  5LJ0 A;  5I7X A;  5KU3 A;  4MR6 A;  5FBX A;  2YW5 A;  4YYJ A;  5FB1 A;  2YYN A;  4IOO A;  2L5E A;  5EWV A;  4YC9 A;  5FE4 A;  4CUR A;  5E74 A;  4N4G A;  5CP5 A;  3G0J A;  5CUD A;  4N4H A;  4O77 A;  4YYI A;  4QUU A;  5LVR A;  3AQA A;  3O36 A;  5FE8 A;  5CUG A;  4QST A;  4NUE A;  4O7A A;  4YBS A;  5A82 A;  5E9K A;  5IBN A;  5E9I A;  5CPE A;  4QR3 A;  3P1D A;  5ETD A;  4PCE A;  3O37 A;  4ALH A;  4CUQ A;  4AKN A;  4J3I A;  4O7F A;  4QZS A;  4A9H A;  5IGM A;  5ENJ A;  4NR5 A;  3HMF A;  5F62 A;  5L98 A;  5FG6 A;  5E0R A;  4HXS A;  4WHU A;  5FH7 A;  3P5O A;  3U5O A;  2YDW A;  3LQJ A;  3UVW A;  5CUB A;  5I83 A;  4XUA A;  4PY6 A;  5FE0 A;  5TCM A;  2G4A A;  5HEN A;  5FE7 A;  5DX4 A;  3QZS A;  2I8N A;  5D24 A;  4J1P A;  4RVR A;  5ENH A;  4QYD A;  4E96 A;  5FE9 A;  5DYC A;  2RO1 A;  1F68 A;  5ETB A;  4NRC A;  4YH4 A;  5LKT A;  5DFB A;  4C67 A;  3HMH A;  5D3N A;  5C4Q A;  2N9G A;  5HRV A;  5IG6 A;  3K2J A;  3UVX A;  4TT6 A;  4CUT A;  3U5L A;  4A9N A;  5BT4 A;  4BW4 A;  4O7B A;  5D3T A;  3JVL A;  5CRZ A;  1ZS5 A;  5LJ2 A;  4TYL A;  3O33 A;  3UV5 A;  5DYX A;  5EGU A;  4Z1S A;  5G4S A;  5CUC A;  5H1U A;  5A83 A;  5IGN A;  4UIU A;  3MXF A;  5CTL A;  5FFV A;  4TU4 A;  3SVG A;  4HBY A;  4NRB A;  5COI A;  4WHW A;  4N3W A;  4BW3 A;  4YYD A;  2F6N A;  5A7C A;  4NQM A;  5E7D A;  3RCW A;  5EM3 A;  4CUU A;  4ZQL A;  5D3P A;  5A5N A;  4MR3 A;  3GG3 A;  5CQT A;  5EK9 A;  2RNY A;  5E9L A;  4LDF A;  5II2 A;  5D3H A;  4QSW A;  4O76 A;  5DW2 A;  4YY4 A;  5AD3 A;  5KTX A;  4IR4 A;  2E7N A;  4A9K A;  4CFL A;  5C8G A;  4MEO A;  3U5J A;  4NR7 A;  5H1T A;  4KV1 A;  5D0C A;  3ZYU A;  5CQ3 A;  4ALG A;  4BHW A;  2RFJ A;  5ENE A;  5DLZ A;  2F6J A;  5F2P A;  5HEM A;  4HXL A;  4LZ2 A;  4MR4 A;  4NRA A;  5L97 A;  4HXN A;  5CU8 A;  4MEN A;  5EU1 A;  5EPS A;  4O75 A;  5DKD A;  4QEW A;  4F3I A;  5L8U A;  5FDZ A;  4NR9 A;  5KO4 A;  5D3R A;  4A9J A;  5CZG A;  4MEP A;  2OSS A;  4LYI A;  5EV9 A;  4NXJ A;  3P1E A;  4UIY A;  3FKM X;  4CLB A;  3JVM A;  4N4F A;  5DYA A;  5E9Y A;  4YYG A;  5CFW A;  4UIZ A;  3TLP A;  5DYU A;  2L85 A;  4LYS A;  2H60 A;  3MUL A;  5AD2 A;  5JWM A;  4BJX A;  4LZR A;  4QUT A;  4LZS A;  3MQM A;  3I3J A;  2RS9 B;  5TB6 A;  5D7X A;  4XYA A;  5F25 A;  4UIX A;  5DKC A;  4QC1 A;  1E6I A;  4O7C A;  3HME A;  5H1V A;  3S91 A;  5E3D A;  5IGL A;  4QR5 A;  5DBM A;  5K29 A;  4TU6 A;  4YBM A;  5CQ8 A;  4YBT A;  4QYL A;  5ENC A;  5G4R A;  4Z6H A;  5DFD A;  5FE2 A;  4KCX A;  5CRM A;  3Q2F A;  4YYK A;  4Z6I A;  5HEL A;  4UYE A;  3NXB A;  4DON A;  4PKL A;  3D7C A;  4J0R A;  2LSP B; 
#chains in the Genus database with same CATH topology
 4PCI A;  5LVQ A;  5FFY A;  2GRC A;  4LR6 A;  3IU6 A;  4UYF A;  4N4I A;  1EQF A;  4A9E A;  2MJV B;  5HFR A;  5D25 A;  4LYW A;  4A9F A;  5I7Y A;  2RI7 A;  4UYD A;  4UYF B;  5HFQ A;  4IR5 A;  4QSS A;  2FSA A;  2RNW A;  2DVV A;  2NXB A;  2YEL A;  4GPJ A;  2DVR A;  3U5K A;  4AI6 A;  4OGJ A;  4QSP A;  4CUP A;  5IGK A;  4QB3 A;  2R0Y A;  4OGI A;  4Z93 A;  4IOQ A;  4TZ2 A;  4UIV A;  5CGP A;  4IR3 A;  3DAI A;  4PS5 A;  5HLS A;  4TT2 A;  5ENG A;  4NR8 A;  3UVD A;  5H85 A;  4HXK A;  4AKI A;  5A81 A;  4YYH A;  5ENI A;  4TT4 A;  3IU5 A;  2R10 A;  2YEK A;  4QSQ A;  4O74 A;  4Q0O A;  1WUM A;  4NYV A;  4XY8 A;  5E73 A;  4TS8 A;  4TQN A;  5FG4 A;  4CUS A;  5JI8 A;  5F5Z A;  4HXP A;  5CQ7 A;  4O70 A;  4TZ8 A;  1ZKR A;  3MB4 A;  5D3L A;  5F63 A;  2DKW A;  5FFW A;  3S92 A;  4YAX A;  2YQD A;  3JVK A;  5C7N A;  4AKG A;  5FE5 A;  2DVQ A;  4LC2 A;  5BT5 A;  4QEU A;  2OUO A;  1JSP B;  4YK0 A;  2WP2 A;  4NR4 A;  5L8T A;  5HQ7 A;  5A85 A;  5A5P A;  5CQ5 A;  3JVJ A;  5A5S A;  3DWY A;  5EWW A;  4OUF A;  5DFC A;  4KV4 A;  4NUD A;  4HXO A;  5CUA A;  1WUG A;  2DVS A;  5HQ5 A;  4NQN A;  4NUC A;  3U5M A;  4QSX A;  5CQ4 A;  2WP1 A;  4X2I A;  5CUE A;  5E9M A;  4HBV A;  3UVY A;  4YAT A;  2DAT A;  5EWC A;  5LKZ A;  5CQ6 A;  4YYM A;  5DY7 A;  4NYW A;  2YEM A;  5AME A;  5FH6 A;  5II1 A;  5HM0 A;  4NR6 A;  1JM4 B;  4NYX A;  5F36 A;  5D3J A;  4HBX A;  5C85 A;  3QZV A;  5LKX A;  4MEQ A;  5EP7 A;  3SVH A;  5CS8 A;  4UIW A;  4O78 A;  5CY9 A;  3U5P A;  5DLX A;  4YAD A;  4UYG A;  2KTB B;  5L99 A;  5DKH A;  3U5N A;  5F1L A;  2I7K A;  4MR5 A;  4QSV A;  4QC3 A;  3LQI A;  5EA1 A;  5A5Q A;  5HCL A;  5LUU A;  5EPR A;  4ZW1 A;  5EIC A;  5F61 A;  5C87 A;  5DW1 A;  5F60 A;  4LRG A;  5KTW A;  4QNS A;  5HRW A;  5EQ1 A;  5ENB A;  4Z1Q A;  5I89 A;  3O35 A;  4BW2 A;  5ENF A;  3AAD A;  3ONI A;  4UYH A;  5EIS A;  1PUO A;  2E3K A;  5ACY A;  4Q0N A;  5I80 A;  5I86 A;  4QSU A;  4IOR A;  5E9V A;  3SVF A;  5I40 A;  3VKH A;  4Y03 A;  4QY4 A;  3P1C A;  5HJC A;  4YYN A;  4CL9 A;  5D3S A;  2R0S A;  4ZC9 A;  5L96 A;  4XUB A;  5J0D A;  4QBM A;  5EI4 A;  5CQA A;  5EWH A;  4O7E A;  5LJ1 A;  4UIT A;  1X0J A;  3UV4 A;  3LXJ A;  5FH8 A;  2L84 A;  3Q2E A;  5C89 A;  2D82 A;  5EPB A;  5I1Q A;  3UW9 A;  4CFK A;  3LQH A;  4IR6 A;  4FLP A;  2DWW A;  4C66 A;  4O71 A;  4WIV A;  3G0L A;  5FE3 A;  4HXR A;  2OO1 A;  3UV2 A;  5EWD A;  1N72 A;  5FE1 A;  4A9M A;  5A5O A;  5FG5 A;  5E3G A;  2E7O A;  4QSR A;  2RNX A;  3MB3 A;  4XY9 A;  2R0V A;  3LJW A;  4O72 A;  4PTB A;  5A5R A;  5LKU A;  3QZT A;  3P1F A;  4HBW A;  4YH3 A;  5D26 A;  5F1H A;  5HQ6 A;  5HRX A;  5F3A A;  5BT3 A;  5I88 A;  3MUK A;  4YAB A;  5FB0 A;  5EVA A;  3O34 A;  4BW1 A;  4A9O A;  4QR4 A;  5I29 A;  4QEV A;  5IID A;  4NS5 A;  4A9I A;  4TTE A;  5FE6 A;  4J0S A;  4A9L A;  5AMF A;  5KHM A;  2D9E A;  4YY6 A;  5KTU A;  4HXM A;  5LJ0 A;  5I7X A;  5KU3 A;  4MR6 A;  5FBX A;  2YW5 A;  4YYJ A;  5FB1 A;  2YYN A;  4IOO A;  2L5E A;  5EWV A;  4YC9 A;  5FE4 A;  4CUR A;  5E74 A;  4N4G A;  5CP5 A;  3G0J A;  5CUD A;  4N4H A;  4O77 A;  4YYI A;  4QUU A;  5LVR A;  3AQA A;  3O36 A;  5FE8 A;  5CUG A;  4QST A;  3VKG A;  4NUE A;  4O7A A;  4YBS A;  5A82 A;  5E9K A;  5IBN A;  5E9I A;  5CPE A;  4QR3 A;  3P1D A;  5ETD A;  4PCE A;  3O37 A;  4ALH A;  4CUQ A;  4AKN A;  4J3I A;  4O7F A;  4QZS A;  4A9H A;  5IGM A;  5ENJ A;  4NR5 A;  3HMF A;  5F62 A;  5L98 A;  5FG6 A;  5E0R A;  4HXS A;  4WHU A;  5FH7 A;  3P5O A;  3U5O A;  2YDW A;  3LQJ A;  3UVW A;  5CUB A;  5I83 A;  4XUA A;  4PY6 A;  5FE0 A;  5TCM A;  2G4A A;  5HEN A;  3D1D A;  5FE7 A;  5DX4 A;  3QZS A;  2I8N A;  5D24 A;  4J1P A;  4RVR A;  5ENH A;  4QYD A;  4E96 A;  5FE9 A;  5DYC A;  2RO1 A;  1F68 A;  5ETB A;  4NRC A;  4YH4 A;  5LKT A;  5DFB A;  4C67 A;  3HMH A;  5D3N A;  5C4Q A;  2N9G A;  5HRV A;  5IG6 A;  3K2J A;  3UVX A;  4TT6 A;  4CUT A;  3U5L A;  4A9N A;  5BT4 A;  4BW4 A;  4O7B A;  5D3T A;  3JVL A;  5CRZ A;  1ZS5 A;  5LJ2 A;  4TYL A;  3O33 A;  3UV5 A;  5DYX A;  5EGU A;  4Z1S A;  5G4S A;  5CUC A;  5H1U A;  5A83 A;  5IGN A;  4UIU A;  3MXF A;  5CTL A;  5FFV A;  4TU4 A;  3SVG A;  4HBY A;  4NRB A;  5COI A;  4WHW A;  4N3W A;  4BW3 A;  4YYD A;  2F6N A;  5A7C A;  4NQM A;  5E7D A;  3RCW A;  3D1B A;  5EM3 A;  4CUU A;  4ZQL A;  5D3P A;  5A5N A;  4MR3 A;  3GG3 A;  5CQT A;  5EK9 A;  2RNY A;  5E9L A;  4LDF A;  5II2 A;  5D3H A;  4QSW A;  4O76 A;  5DW2 A;  4YY4 A;  5AD3 A;  5KTX A;  4IR4 A;  2E7N A;  4A9K A;  4CFL A;  5C8G A;  4MEO A;  3U5J A;  4NR7 A;  5H1T A;  4KV1 A;  5D0C A;  3ZYU A;  5CQ3 A;  4ALG A;  4BHW A;  2RFJ A;  5ENE A;  5DLZ A;  2F6J A;  5F2P A;  5HEM A;  4HXL A;  4LZ2 A;  4MR4 A;  4NRA A;  5L97 A;  4HXN A;  5CU8 A;  4MEN A;  5EU1 A;  5EPS A;  4O75 A;  5DKD A;  4QEW A;  4F3I A;  5L8U A;  5FDZ A;  4NR9 A;  5KO4 A;  5D3R A;  3ERR A;  4A9J A;  5CZG A;  4MEP A;  2OSS A;  4LYI A;  5EV9 A;  4NXJ A;  3P1E A;  4UIY A;  3FKM X;  4CLB A;  4AKH A;  3JVM A;  4N4F A;  5DYA A;  5E9Y A;  4YYG A;  5CFW A;  4UIZ A;  3TLP A;  5DYU A;  2L85 A;  4LYS A;  2H60 A;  3MUL A;  5AD2 A;  5JWM A;  4BJX A;  4LZR A;  4QUT A;  4LZS A;  3MQM A;  2EJN A;  3I3J A;  2RS9 B;  5TB6 A;  5D7X A;  4XYA A;  5F25 A;  4UIX A;  5DKC A;  4QC1 A;  1E6I A;  4O7C A;  3HME A;  5H1V A;  3S91 A;  5E3D A;  5IGL A;  4QR5 A;  5DBM A;  5K29 A;  4TU6 A;  4YBM A;  5CQ8 A;  4YBT A;  4QYL A;  5ENC A;  5G4R A;  4Z6H A;  5DFD A;  5FE2 A;  4KCX A;  5CRM A;  3Q2F A;  4YYK A;  4Z6I A;  5HEL A;  4UYE A;  3NXB A;  4DON A;  4PKL A;  3D7C A;  4J0R A;  2LSP B; 
#chains in the Genus database with same CATH homology
 4PCI A;  5LVQ A;  5FFY A;  2GRC A;  4LR6 A;  3IU6 A;  4UYF A;  4N4I A;  1EQF A;  4A9E A;  2MJV B;  5HFR A;  5D25 A;  4LYW A;  4A9F A;  5I7Y A;  2RI7 A;  4UYD A;  4UYF B;  5HFQ A;  4IR5 A;  4QSS A;  2FSA A;  2RNW A;  2DVV A;  2NXB A;  2YEL A;  4GPJ A;  2DVR A;  3U5K A;  4OGJ A;  4QSP A;  4CUP A;  5IGK A;  4QB3 A;  2R0Y A;  4OGI A;  4Z93 A;  4IOQ A;  4TZ2 A;  4UIV A;  5CGP A;  4IR3 A;  3DAI A;  4PS5 A;  5HLS A;  4TT2 A;  5ENG A;  4NR8 A;  3UVD A;  5H85 A;  4HXK A;  5A81 A;  4YYH A;  5ENI A;  4TT4 A;  3IU5 A;  2R10 A;  2YEK A;  4QSQ A;  4O74 A;  4Q0O A;  1WUM A;  4NYV A;  4XY8 A;  5E73 A;  4TS8 A;  4TQN A;  5FG4 A;  4CUS A;  5JI8 A;  5F5Z A;  4HXP A;  5CQ7 A;  4O70 A;  4TZ8 A;  3MB4 A;  5D3L A;  5F63 A;  2DKW A;  5FFW A;  3S92 A;  4YAX A;  2YQD A;  3JVK A;  5C7N A;  5FE5 A;  2DVQ A;  4LC2 A;  5BT5 A;  4QEU A;  2OUO A;  1JSP B;  4YK0 A;  2WP2 A;  4NR4 A;  5L8T A;  5HQ7 A;  5A85 A;  5A5P A;  5CQ5 A;  3JVJ A;  5A5S A;  3DWY A;  5EWW A;  4OUF A;  5DFC A;  4KV4 A;  4NUD A;  4HXO A;  5CUA A;  1WUG A;  2DVS A;  5HQ5 A;  4NQN A;  4NUC A;  3U5M A;  4QSX A;  5CQ4 A;  2WP1 A;  4X2I A;  5CUE A;  5E9M A;  4HBV A;  3UVY A;  4YAT A;  2DAT A;  5EWC A;  5LKZ A;  5CQ6 A;  4YYM A;  5DY7 A;  4NYW A;  2YEM A;  5AME A;  5FH6 A;  5II1 A;  5HM0 A;  4NR6 A;  1JM4 B;  4NYX A;  5F36 A;  5D3J A;  4HBX A;  5C85 A;  3QZV A;  5LKX A;  4MEQ A;  5EP7 A;  3SVH A;  5CS8 A;  4UIW A;  4O78 A;  5CY9 A;  3U5P A;  5DLX A;  4YAD A;  4UYG A;  2KTB B;  5L99 A;  5DKH A;  3U5N A;  5F1L A;  2I7K A;  4MR5 A;  4QSV A;  4QC3 A;  3LQI A;  5EA1 A;  5A5Q A;  5HCL A;  5LUU A;  5EPR A;  4ZW1 A;  5EIC A;  5F61 A;  5C87 A;  5DW1 A;  5F60 A;  4LRG A;  5KTW A;  4QNS A;  5HRW A;  5EQ1 A;  5ENB A;  4Z1Q A;  5I89 A;  3O35 A;  4BW2 A;  5ENF A;  3AAD A;  3ONI A;  4UYH A;  5EIS A;  2E3K A;  5ACY A;  4Q0N A;  5I80 A;  5I86 A;  4QSU A;  4IOR A;  5E9V A;  3SVF A;  5I40 A;  4Y03 A;  4QY4 A;  3P1C A;  5HJC A;  4YYN A;  4CL9 A;  5D3S A;  2R0S A;  4ZC9 A;  5L96 A;  4XUB A;  5J0D A;  4QBM A;  5EI4 A;  5CQA A;  5EWH A;  4O7E A;  5LJ1 A;  4UIT A;  1X0J A;  3UV4 A;  3LXJ A;  5FH8 A;  2L84 A;  3Q2E A;  5C89 A;  2D82 A;  5EPB A;  5I1Q A;  3UW9 A;  4CFK A;  3LQH A;  4IR6 A;  4FLP A;  2DWW A;  4C66 A;  4O71 A;  4WIV A;  3G0L A;  5FE3 A;  4HXR A;  2OO1 A;  3UV2 A;  5EWD A;  1N72 A;  5FE1 A;  4A9M A;  5A5O A;  5FG5 A;  5E3G A;  2E7O A;  4QSR A;  2RNX A;  3MB3 A;  4XY9 A;  2R0V A;  3LJW A;  4O72 A;  4PTB A;  5A5R A;  5LKU A;  3QZT A;  3P1F A;  4HBW A;  4YH3 A;  5D26 A;  5F1H A;  5HQ6 A;  5HRX A;  5F3A A;  5BT3 A;  5I88 A;  3MUK A;  4YAB A;  5FB0 A;  5EVA A;  3O34 A;  4BW1 A;  4A9O A;  4QR4 A;  5I29 A;  4QEV A;  5IID A;  4NS5 A;  4A9I A;  4TTE A;  5FE6 A;  4J0S A;  4A9L A;  5AMF A;  5KHM A;  2D9E A;  4YY6 A;  5KTU A;  4HXM A;  5LJ0 A;  5I7X A;  5KU3 A;  4MR6 A;  5FBX A;  2YW5 A;  4YYJ A;  5FB1 A;  2YYN A;  4IOO A;  2L5E A;  5EWV A;  4YC9 A;  5FE4 A;  4CUR A;  5E74 A;  4N4G A;  5CP5 A;  3G0J A;  5CUD A;  4N4H A;  4O77 A;  4YYI A;  4QUU A;  5LVR A;  3AQA A;  3O36 A;  5FE8 A;  5CUG A;  4QST A;  4NUE A;  4O7A A;  4YBS A;  5A82 A;  5E9K A;  5IBN A;  5E9I A;  5CPE A;  4QR3 A;  3P1D A;  5ETD A;  4PCE A;  3O37 A;  4ALH A;  4CUQ A;  4AKN A;  4J3I A;  4O7F A;  4QZS A;  4A9H A;  5IGM A;  5ENJ A;  4NR5 A;  3HMF A;  5F62 A;  5L98 A;  5FG6 A;  5E0R A;  4HXS A;  4WHU A;  5FH7 A;  3P5O A;  3U5O A;  2YDW A;  3LQJ A;  3UVW A;  5CUB A;  5I83 A;  4XUA A;  4PY6 A;  5FE0 A;  5TCM A;  2G4A A;  5HEN A;  5FE7 A;  5DX4 A;  3QZS A;  2I8N A;  5D24 A;  4J1P A;  4RVR A;  5ENH A;  4QYD A;  4E96 A;  5FE9 A;  5DYC A;  2RO1 A;  1F68 A;  5ETB A;  4NRC A;  4YH4 A;  5LKT A;  5DFB A;  4C67 A;  3HMH A;  5D3N A;  5C4Q A;  2N9G A;  5HRV A;  5IG6 A;  3K2J A;  3UVX A;  4TT6 A;  4CUT A;  3U5L A;  4A9N A;  5BT4 A;  4BW4 A;  4O7B A;  5D3T A;  3JVL A;  5CRZ A;  1ZS5 A;  5LJ2 A;  4TYL A;  3O33 A;  3UV5 A;  5DYX A;  5EGU A;  4Z1S A;  5G4S A;  5CUC A;  5H1U A;  5A83 A;  5IGN A;  4UIU A;  3MXF A;  5CTL A;  5FFV A;  4TU4 A;  3SVG A;  4HBY A;  4NRB A;  5COI A;  4WHW A;  4N3W A;  4BW3 A;  4YYD A;  2F6N A;  5A7C A;  4NQM A;  5E7D A;  3RCW A;  5EM3 A;  4CUU A;  4ZQL A;  5D3P A;  5A5N A;  4MR3 A;  3GG3 A;  5CQT A;  5EK9 A;  2RNY A;  5E9L A;  4LDF A;  5II2 A;  5D3H A;  4QSW A;  4O76 A;  5DW2 A;  4YY4 A;  5AD3 A;  5KTX A;  4IR4 A;  2E7N A;  4A9K A;  4CFL A;  5C8G A;  4MEO A;  3U5J A;  4NR7 A;  5H1T A;  4KV1 A;  5D0C A;  3ZYU A;  5CQ3 A;  4ALG A;  4BHW A;  2RFJ A;  5ENE A;  5DLZ A;  2F6J A;  5F2P A;  5HEM A;  4HXL A;  4LZ2 A;  4MR4 A;  4NRA A;  5L97 A;  4HXN A;  5CU8 A;  4MEN A;  5EU1 A;  5EPS A;  4O75 A;  5DKD A;  4QEW A;  4F3I A;  5L8U A;  5FDZ A;  4NR9 A;  5KO4 A;  5D3R A;  4A9J A;  5CZG A;  4MEP A;  2OSS A;  4LYI A;  5EV9 A;  4NXJ A;  3P1E A;  4UIY A;  3FKM X;  4CLB A;  3JVM A;  4N4F A;  5DYA A;  5E9Y A;  4YYG A;  5CFW A;  4UIZ A;  3TLP A;  5DYU A;  2L85 A;  4LYS A;  2H60 A;  3MUL A;  5AD2 A;  5JWM A;  4BJX A;  4LZR A;  4QUT A;  4LZS A;  3MQM A;  3I3J A;  2RS9 B;  5TB6 A;  5D7X A;  4XYA A;  5F25 A;  4UIX A;  5DKC A;  4QC1 A;  1E6I A;  4O7C A;  3HME A;  5H1V A;  3S91 A;  5E3D A;  5IGL A;  4QR5 A;  5DBM A;  5K29 A;  4TU6 A;  4YBM A;  5CQ8 A;  4YBT A;  4QYL A;  5ENC A;  5G4R A;  4Z6H A;  5DFD A;  5FE2 A;  4KCX A;  5CRM A;  3Q2F A;  4YYK A;  4Z6I A;  5HEL A;  4UYE A;  3NXB A;  4DON A;  4PKL A;  3D7C A;  4J0R A;  2LSP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...