4UYFB

N-terminal bromodomain of human brd2 with i-bet726 (gsk1324726a)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
108
structure length
108
Chain Sequence
TNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKIFLQKVASMPQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BROMODOMAIN-CONTAINING PROTEIN 2
publication title The Discovery of I-Bet726 (Gsk1324726A), a Potent Tetrahydroquinoline Apoa1 Up-Regulator and Selective Bet Bromodomain Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 38
structure length 108
sequence length 108
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4uyfB00
5H85A 4C66A 3UV2A 4ZQLA 2KTBB 5A5NA 4F3IA 3UVYA 3HMHA 5FDZA 5I88A 5E73A 3LQIA 3G0LA 4UITA 5JI8A 3DAIA 4IR3A 5D24A 5HFRA 5DBMA 4UYDA 5FE0A 5A82A 4YBMA 5EWCA 4UYFB 3S92A 4HXMA 3NXBA 4NUCA 4E96A 2RNXA 4O7CA 2E3KA 3LJWA 2YEMA 3P1DA 4IORA 5CGPA 3SVHA 5CU8A 5DFDA 5EP7A 4YYKA 5A5OA 5DW2A 5II2A 4NR4A 5CQAA 5A5QA 5IG6A 5HELA 4XY9A 4O76A 5II1A 5LVQA 3P1FA 4QY4A 4MEOA 4GPJA 4NR9A 4HBWA 3U5OA 5E74A 5COIA 1F68A 4O72A 4CURA 4MEQA 4NR6A 5DX4A 3JVLA 4Z6IA 4NYVA 1WUGA 5ACYA 4UIXA 4UYFA 4NR5A 5E9IA 4OGJA 4YYDA 4XYAA 5DYAA 4XUBA 5LVRA 5BT4A 3I3JA 5HENA 4HBXA 5CUCA 5EPSA 5L8TA 5D3TA 4Z93A 5CUDA 5FE4A 2YEKA 5TCMA 4A9JA 4N4HA 4NRCA 5I29A 5F3AA 4DONA 5EPRA 5D3PA 4O78A 5F36A 4MENA 5LJ2A 5EPBA 4IR5A 4O77A 4LC2A 4YABA 4UIYA 5FBXA 4NUEA 5AMFA 4RVRA 4OUFA 4NQMA 5D7XA 3U5KA 5H1TA 4HBVA 2LSPB 5E9MA 5EM3A 5DFBA 5ETBA 5HRXA 5LKZA 4BHWA 2G4AA 4O7BA 4CUQA 5LJ1A 4A9IA 3O35A 4NYWA 5C85A 5D3HA 4Q0OA 4QSQA 4Z1SA 4J0SA 4BW1A 4YH3A 3UVWA 5H1UA 5KHMA 5EISA 4UIUA 4KCXA 5D3NA 3MQMA 4TZ8A 3ZYUA 4TTEA 5CFWA 4YYMA 3QZTA 4TQNA 5CPEA 5DY7A 4MR3A 5FG4A 4TT6A 3MXFA 2YELA 4QEVA 3K2JA 4QR4A 4YK0A 3P1EA 4QB3A 5C87A 5DLXA 5I83A 5CTLA 5FB0A 4A9EA 3U5PA 3Q2FA 4YC9A 4A9HA 5I80A 4LRGA 3O34A 4HXSA 5EV9A 4QC3A 1X0JA 4UYEA 3UV5A 4QSVA 3QZVA 4BW2A 4YBSA 3UVXA 5D3JA 5EGUA 4ZC9A 5HQ5A 5DW1A 4YYJA 5FE6A 4HXNA 5D26A 2R0SA 4MEPA 4TT2A 5FH7A 2N9GA 5DKCA 5E7DA 4QYDA 5F1HA 5E9KA 5A5RA 4HXRA 2YYNA 3MB4A 4OGIA 5EWDA 4ALHA 4QSSA 5FH8A 4CUTA 4XY8A 4Z6HA 2R0VA 2OSSA 3S91A 3IU6A 5DLZA 5A85A 5CQ8A 5E9VA 4PTBA 2F6NA 5IGLA 2OO1A 4J0RA 4O71A 2E7OA 3DWYA 5EI4A 4BW3A 5CQ4A 1ZS5A 4KV4A 5ENCA 3LQHA 5I86A 4WHWA 5EVAA 4HXKA 4HBYA 4TU4A 2DKWA 5CUGA 3O33A 4YH4A 4UIVA 4YY6A 5ENHA 2L84A 4MR4A 4IOOA 2E7NA 4A9MA 2F6JA 3MULA 3U5JA 5EU1A 5KU3A 4LYIA 4Q0NA 2RFJA 5IBNA 3JVKA 5FE7A 5C4QA 5I89A 5F2PA 5EWWA 5HQ7A 5F60A 5CQ5A 4CLBA 3P5OA 2RO1A 2RS9B 3MUKA 5I40A 4CUUA 5C89A 5BT3A 4UIWA 4QYLA 5F61A 3P1CA 3GG3A 4QEWA 4QSTA 5EK9A 4PCIA 2DWWA 5CUAA 1N72A 2R0YA 5FFWA 5FE9A 2DVQA 4Y03A 4NRAA 4PY6A 5CQTA 5LJ0A 5CS8A 4AKNA 4HXOA 4LYSA 5D3RA 5KTWA 3LXJA 3UW9A 5EA1A 2MJVB 3U5LA 5L98A 3U5MA 4A9NA 3ONIA 5JWMA 5HFQA 5L96A 4NQNA 4MR6A 4QSXA 5FFVA 5A5PA 4XUAA 5DYUA 3U5NA 5HRVA 4TU6A 3SVGA 4CFLA 4CUPA 4UYHA 3QZSA 5ENIA 5E3DA 5I1QA 4QSWA 5FE5A 5C7NA 4O74A 2DVSA 5D25A 3JVMA 5A81A 5HLSA 4QC1A 4QSUA 4YADA 5AD2A 4KV1A 5CRMA 3RCWA 5DYXA 3TLPA 5I7YA 5DKDA 4ALGA 4NS5A 5ENGA 4TS8A 5TB6A 4X2IA 5KO4A 4J1PA 2D82A 2I8NA 4YYIA 2WP2A 3Q2EA 3AQAA 4N4IA 5FG5A 3UVDA 4TT4A 3IU5A 4YAXA 4LZSA 4YATA 4NUDA 2H60A 5CQ7A 5H1VA 5ETDA 4TYLA 4CL9A 2DVVA 4O75A 2YQDA 2YW5A 3G0JA 4LDFA 5EWVA 5A5SA 5KTXA 4MR5A 5FE2A 3FKMX 5EWHA 4N4FA 4YYGA 4N4GA 2NXBA 4QSRA 5F5ZA 5LKTA 5AMEA 3O36A 2YDWA 4O7EA 5EQ1A 4LYWA 5ENFA 5EICA 5CQ6A 4WIVA 4ZW1A 2RI7A 3AADA 5A7CA 5ENJA 5IIDA 5L8UA 5LKUA 2D9EA 4NXJA 5F63A 3JVJA 4YBTA 4QUTA 2OUOA 5CUEA 5I7XA 5IGKA 4CFKA 4HXPA 2RNYA 4PKLA 5FE3A 4A9FA 5IGMA 5CQ3A 2R10A 2WP1A 5E3GA 1JM4B 5FB1A 4QZSA 3MB3A 4C67A 3HMFA 1WUMA 4QR5A 4PCEA 5ENBA 5HM0A 4NYXA 5AD3A 2L85A 5D3SA 4NRBA 2L5EA 5CUBA 4QSPA 5A83A 5BT5A 4Z1QA 4WHUA 5CRZA 2FSAA 2RNWA 5J0DA 5HCLA 4NR8A 3O37A 4IR4A 5G4RA 4A9LA 4YYNA 4BW4A 4UYGA 3SVFA 4A9KA 5CY9A 5L99A 2DATA 4TZ2A 5CZGA 5F62A 1E6IA 4O7AA 2DVRA 5FE1A 3D7CA 2I7KA 5L97A 3HMEA 5KTUA 5LKXA 5F1LA 5HJCA 5FFYA 5FH6A 4CUSA 1EQFA 5K29A 2GRCA 4IOQA 5DFCA 4YY4A 4YYHA 4QNSA 3UV4A 5D3LA 4O70A 4QBMA 5HQ6A 4LZ2A 5E9LA 4LR6A 5E0RA 5ENEA 4BJXA 5D0CA 3LQJA 4J3IA 4NR7A 5F25A 5G4SA 4HXLA 5CP5A 5DYCA 5IGNA 5FE8A 4IR6A 4QEUA 5HRWA 4UIZA 4A9OA 5LUUA 5DKHA 4PS5A 5E9YA 4QUUA 4N3WA 5C8GA 1JSPB 5FG6A 4LZRA 4O7FA 4QR3A 4FLPA 5HEMA
chains in the Genus database with same CATH superfamily
5H85A 4C66A 3UV2A 4ZQLA 2KTBB 5A5NA 4F3IA 3UVYA 3HMHA 5FDZA 5I88A 5E73A 3LQIA 3G0LA 4UITA 5JI8A 3DAIA 4IR3A 5D24A 5HFRA 5DBMA 4UYDA 4AKIA 5FE0A 5A82A 4YBMA 5EWCA 4UYFB 3S92A 4HXMA 3NXBA 4NUCA 4E96A 2RNXA 4O7CA 2E3KA 3LJWA 2YEMA 3P1DA 4IORA 5CGPA 3SVHA 5CU8A 5DFDA 5EP7A 4YYKA 5A5OA 5DW2A 5II2A 4NR4A 5CQAA 5A5QA 5IG6A 5HELA 4XY9A 4O76A 5II1A 5LVQA 3P1FA 4QY4A 4MEOA 4GPJA 4NR9A 4HBWA 3U5OA 5E74A 5COIA 1F68A 4O72A 4CURA 4MEQA 4NR6A 5DX4A 3JVLA 4Z6IA 4NYVA 1WUGA 5ACYA 4UIXA 4UYFA 4NR5A 5E9IA 4OGJA 4YYDA 4XYAA 5DYAA 4XUBA 5LVRA 5BT4A 3I3JA 5HENA 4HBXA 5CUCA 5EPSA 5L8TA 5D3TA 4Z93A 5CUDA 5FE4A 2YEKA 5TCMA 4A9JA 4N4HA 4NRCA 5I29A 5F3AA 4DONA 5EPRA 5D3PA 4O78A 5F36A 4MENA 5LJ2A 5EPBA 4IR5A 4O77A 4LC2A 4YABA 4UIYA 5FBXA 4NUEA 5AMFA 4RVRA 4OUFA 4NQMA 5D7XA 3U5KA 5H1TA 4HBVA 2LSPB 5E9MA 5EM3A 5DFBA 5ETBA 5HRXA 5LKZA 4BHWA 2G4AA 4O7BA 4CUQA 5LJ1A 4AKHA 4A9IA 3O35A 4NYWA 5C85A 5D3HA 4Q0OA 4QSQA 4Z1SA 4J0SA 4BW1A 4YH3A 3UVWA 5H1UA 5KHMA 5EISA 4UIUA 4KCXA 5D3NA 3MQMA 4TZ8A 3ZYUA 4TTEA 5CFWA 4YYMA 3QZTA 4TQNA 5CPEA 5DY7A 4MR3A 5FG4A 4TT6A 3MXFA 2YELA 4QEVA 3K2JA 4QR4A 4YK0A 3P1EA 4QB3A 5C87A 5DLXA 5I83A 5CTLA 5FB0A 4A9EA 3U5PA 3Q2FA 4YC9A 4A9HA 5I80A 4LRGA 3O34A 4HXSA 5EV9A 4QC3A 1X0JA 4UYEA 3UV5A 4QSVA 3QZVA 4BW2A 4YBSA 4AKGA 3UVXA 5D3JA 5EGUA 4ZC9A 5HQ5A 5DW1A 4YYJA 5FE6A 4HXNA 5D26A 2R0SA 4MEPA 4TT2A 4AI6A 5FH7A 2N9GA 5DKCA 5E7DA 4QYDA 5F1HA 5E9KA 5A5RA 4HXRA 2YYNA 3MB4A 4OGIA 5EWDA 4ALHA 4QSSA 5FH8A 4CUTA 4XY8A 4Z6HA 2R0VA 2OSSA 3S91A 3IU6A 5DLZA 3VKGA 5A85A 5CQ8A 5E9VA 4PTBA 2F6NA 5IGLA 2OO1A 4J0RA 4O71A 2E7OA 2EJNA 3DWYA 5EI4A 4BW3A 5CQ4A 1PUOA 1ZS5A 4KV4A 5ENCA 3LQHA 5I86A 4WHWA 5EVAA 4HXKA 4HBYA 4TU4A 2DKWA 5CUGA 3O33A 4YH4A 4UIVA 4YY6A 5ENHA 2L84A 4MR4A 4IOOA 2E7NA 4A9MA 2F6JA 3MULA 3U5JA 5EU1A 5KU3A 4LYIA 4Q0NA 2RFJA 5IBNA 3JVKA 3D1BA 5FE7A 5C4QA 5I89A 5F2PA 5EWWA 5HQ7A 5F60A 5CQ5A 4CLBA 3P5OA 2RO1A 2RS9B 3MUKA 5I40A 4CUUA 5C89A 5BT3A 4UIWA 4QYLA 5F61A 3P1CA 3GG3A 4QEWA 4QSTA 5EK9A 4PCIA 2DWWA 5CUAA 1N72A 2R0YA 5FFWA 5FE9A 2DVQA 4Y03A 4NRAA 4PY6A 5CQTA 5LJ0A 5CS8A 4AKNA 4HXOA 4LYSA 5D3RA 5KTWA 3LXJA 3UW9A 5EA1A 2MJVB 3U5LA 5L98A 3U5MA 4A9NA 3ONIA 5JWMA 5HFQA 5L96A 4NQNA 4MR6A 4QSXA 5FFVA 5A5PA 4XUAA 5DYUA 3U5NA 5HRVA 4TU6A 3SVGA 4CFLA 4CUPA 4UYHA 3QZSA 5ENIA 5E3DA 5I1QA 4QSWA 5FE5A 5C7NA 4O74A 2DVSA 5D25A 3JVMA 5A81A 5HLSA 4QC1A 4QSUA 4YADA 5AD2A 4KV1A 5CRMA 3RCWA 5DYXA 3TLPA 5I7YA 5DKDA 4ALGA 4NS5A 5ENGA 4TS8A 5TB6A 4X2IA 5KO4A 4J1PA 2D82A 2I8NA 4YYIA 2WP2A 3Q2EA 3AQAA 4N4IA 5FG5A 3UVDA 4TT4A 3IU5A 4YAXA 4LZSA 4YATA 4NUDA 2H60A 5CQ7A 5H1VA 5ETDA 4TYLA 4CL9A 3D1DA 2DVVA 4O75A 2YQDA 2YW5A 3G0JA 4LDFA 5EWVA 5A5SA 5KTXA 4MR5A 5FE2A 1ZKRA 3FKMX 5EWHA 4N4FA 4YYGA 4N4GA 2NXBA 4QSRA 5F5ZA 5LKTA 5AMEA 3O36A 2YDWA 4O7EA 5EQ1A 4LYWA 3VKHA 5ENFA 5EICA 5CQ6A 4WIVA 4ZW1A 2RI7A 3AADA 5A7CA 5ENJA 5IIDA 5L8UA 5LKUA 2D9EA 4NXJA 5F63A 3JVJA 4YBTA 4QUTA 2OUOA 5CUEA 5I7XA 5IGKA 4CFKA 4HXPA 2RNYA 4PKLA 5FE3A 4A9FA 5IGMA 5CQ3A 2R10A 2WP1A 5E3GA 1JM4B 5FB1A 4QZSA 3MB3A 4C67A 3HMFA 1WUMA 4QR5A 4PCEA 5ENBA 5HM0A 4NYXA 5AD3A 2L85A 3ERRA 5D3SA 4NRBA 2L5EA 5CUBA 4QSPA 5A83A 5BT5A 4Z1QA 4WHUA 5CRZA 2FSAA 2RNWA 5J0DA 5HCLA 4NR8A 3O37A 4IR4A 5G4RA 4A9LA 4YYNA 4BW4A 4UYGA 3SVFA 4A9KA 5CY9A 5L99A 2DATA 4TZ2A 5CZGA 5F62A 1E6IA 4O7AA 2DVRA 5FE1A 3D7CA 2I7KA 5L97A 3HMEA 5KTUA 5LKXA 5F1LA 5HJCA 5FFYA 5FH6A 4CUSA 1EQFA 5K29A 2GRCA 4IOQA 5DFCA 4YY4A 4YYHA 4QNSA 3UV4A 5D3LA 4O70A 4QBMA 5HQ6A 4LZ2A 5E9LA 4LR6A 5E0RA 5ENEA 4BJXA 5D0CA 3LQJA 4J3IA 4NR7A 5F25A 5G4SA 4HXLA 5CP5A 5DYCA 5IGNA 5FE8A 4IR6A 4QEUA 5HRWA 4UIZA 4A9OA 5LUUA 5DKHA 4PS5A 5E9YA 4QUUA 4N3WA 5C8GA 1JSPB 5FG6A 4LZRA 4O7FA 4QR3A 4FLPA 5HEMA
chains in the Genus database with same CATH topology
5H85A 4C66A 3UV2A 4ZQLA 2KTBB 5A5NA 4F3IA 3UVYA 3HMHA 5FDZA 5I88A 5E73A 3LQIA 3G0LA 4UITA 5JI8A 3DAIA 4IR3A 5D24A 5HFRA 5DBMA 4UYDA 5FE0A 5A82A 4YBMA 5EWCA 4UYFB 3S92A 4HXMA 3NXBA 4NUCA 4E96A 2RNXA 4O7CA 2E3KA 3LJWA 2YEMA 3P1DA 4IORA 5CGPA 3SVHA 5CU8A 5DFDA 5EP7A 4YYKA 5A5OA 5DW2A 5II2A 4NR4A 5CQAA 5A5QA 5IG6A 5HELA 4XY9A 4O76A 5II1A 5LVQA 3P1FA 4QY4A 4MEOA 4GPJA 4NR9A 4HBWA 3U5OA 5E74A 5COIA 1F68A 4O72A 4CURA 4MEQA 4NR6A 5DX4A 3JVLA 4Z6IA 4NYVA 1WUGA 5ACYA 4UIXA 4UYFA 4NR5A 5E9IA 4OGJA 4YYDA 4XYAA 5DYAA 4XUBA 5LVRA 5BT4A 3I3JA 5HENA 4HBXA 5CUCA 5EPSA 5L8TA 5D3TA 4Z93A 5CUDA 5FE4A 2YEKA 5TCMA 4A9JA 4N4HA 4NRCA 5I29A 5F3AA 4DONA 5EPRA 5D3PA 4O78A 5F36A 4MENA 5LJ2A 5EPBA 4IR5A 4O77A 4LC2A 4YABA 4UIYA 5FBXA 4NUEA 5AMFA 4RVRA 4OUFA 4NQMA 5D7XA 3U5KA 5H1TA 4HBVA 2LSPB 5E9MA 5EM3A 5DFBA 5ETBA 5HRXA 5LKZA 4BHWA 2G4AA 4O7BA 4CUQA 5LJ1A 4A9IA 3O35A 4NYWA 5C85A 5D3HA 4Q0OA 4QSQA 4Z1SA 4J0SA 4BW1A 4YH3A 3UVWA 5H1UA 5KHMA 5EISA 4UIUA 4KCXA 5D3NA 3MQMA 4TZ8A 3ZYUA 4TTEA 5CFWA 4YYMA 3QZTA 4TQNA 5CPEA 5DY7A 4MR3A 5FG4A 4TT6A 3MXFA 2YELA 4QEVA 3K2JA 4QR4A 4YK0A 3P1EA 4QB3A 5C87A 5DLXA 5I83A 5CTLA 5FB0A 4A9EA 3U5PA 3Q2FA 4YC9A 4A9HA 5I80A 4LRGA 3O34A 4HXSA 5EV9A 4QC3A 1X0JA 4UYEA 3UV5A 4QSVA 3QZVA 4BW2A 4YBSA 3UVXA 5D3JA 5EGUA 4ZC9A 5HQ5A 5DW1A 4YYJA 5FE6A 4HXNA 5D26A 2R0SA 4MEPA 4TT2A 5FH7A 2N9GA 5DKCA 5E7DA 4QYDA 5F1HA 5E9KA 5A5RA 4HXRA 2YYNA 3MB4A 4OGIA 5EWDA 4ALHA 4QSSA 5FH8A 4CUTA 4XY8A 4Z6HA 2R0VA 2OSSA 3S91A 3IU6A 5DLZA 5A85A 5CQ8A 5E9VA 4PTBA 2F6NA 5IGLA 2OO1A 4J0RA 4O71A 2E7OA 3DWYA 5EI4A 4BW3A 5CQ4A 1ZS5A 4KV4A 5ENCA 3LQHA 5I86A 4WHWA 5EVAA 4HXKA 4HBYA 4TU4A 2DKWA 5CUGA 3O33A 4YH4A 4UIVA 4YY6A 5ENHA 2L84A 4MR4A 4IOOA 2E7NA 4A9MA 2F6JA 3MULA 3U5JA 5EU1A 5KU3A 4LYIA 4Q0NA 2RFJA 5IBNA 3JVKA 5FE7A 5C4QA 5I89A 5F2PA 5EWWA 5HQ7A 5F60A 5CQ5A 4CLBA 3P5OA 2RO1A 2RS9B 3MUKA 5I40A 4CUUA 5C89A 5BT3A 4UIWA 4QYLA 5F61A 3P1CA 3GG3A 4QEWA 4QSTA 5EK9A 4PCIA 2DWWA 5CUAA 1N72A 2R0YA 5FFWA 5FE9A 2DVQA 4Y03A 4NRAA 4PY6A 5CQTA 5LJ0A 5CS8A 4AKNA 4HXOA 4LYSA 5D3RA 5KTWA 3LXJA 3UW9A 5EA1A 2MJVB 3U5LA 5L98A 3U5MA 4A9NA 3ONIA 5JWMA 5HFQA 5L96A 4NQNA 4MR6A 4QSXA 5FFVA 5A5PA 4XUAA 5DYUA 3U5NA 5HRVA 4TU6A 3SVGA 4CFLA 4CUPA 4UYHA 3QZSA 5ENIA 5E3DA 5I1QA 4QSWA 5FE5A 5C7NA 4O74A 2DVSA 5D25A 3JVMA 5A81A 5HLSA 4QC1A 4QSUA 4YADA 5AD2A 4KV1A 5CRMA 3RCWA 5DYXA 3TLPA 5I7YA 5DKDA 4ALGA 4NS5A 5ENGA 4TS8A 5TB6A 4X2IA 5KO4A 4J1PA 2D82A 2I8NA 4YYIA 2WP2A 3Q2EA 3AQAA 4N4IA 5FG5A 3UVDA 4TT4A 3IU5A 4YAXA 4LZSA 4YATA 4NUDA 2H60A 5CQ7A 5H1VA 5ETDA 4TYLA 4CL9A 2DVVA 4O75A 2YQDA 2YW5A 3G0JA 4LDFA 5EWVA 5A5SA 5KTXA 4MR5A 5FE2A 3FKMX 5EWHA 4N4FA 4YYGA 4N4GA 2NXBA 4QSRA 5F5ZA 5LKTA 5AMEA 3O36A 2YDWA 4O7EA 5EQ1A 4LYWA 5ENFA 5EICA 5CQ6A 4WIVA 4ZW1A 2RI7A 3AADA 5A7CA 5ENJA 5IIDA 5L8UA 5LKUA 2D9EA 4NXJA 5F63A 3JVJA 4YBTA 4QUTA 2OUOA 5CUEA 5I7XA 5IGKA 4CFKA 4HXPA 2RNYA 4PKLA 5FE3A 4A9FA 5IGMA 5CQ3A 2R10A 2WP1A 5E3GA 1JM4B 5FB1A 4QZSA 3MB3A 4C67A 3HMFA 1WUMA 4QR5A 4PCEA 5ENBA 5HM0A 4NYXA 5AD3A 2L85A 5D3SA 4NRBA 2L5EA 5CUBA 4QSPA 5A83A 5BT5A 4Z1QA 4WHUA 5CRZA 2FSAA 2RNWA 5J0DA 5HCLA 4NR8A 3O37A 4IR4A 5G4RA 4A9LA 4YYNA 4BW4A 4UYGA 3SVFA 4A9KA 5CY9A 5L99A 2DATA 4TZ2A 5CZGA 5F62A 1E6IA 4O7AA 2DVRA 5FE1A 3D7CA 2I7KA 5L97A 3HMEA 5KTUA 5LKXA 5F1LA 5HJCA 5FFYA 5FH6A 4CUSA 1EQFA 5K29A 2GRCA 4IOQA 5DFCA 4YY4A 4YYHA 4QNSA 3UV4A 5D3LA 4O70A 4QBMA 5HQ6A 4LZ2A 5E9LA 4LR6A 5E0RA 5ENEA 4BJXA 5D0CA 3LQJA 4J3IA 4NR7A 5F25A 5G4SA 4HXLA 5CP5A 5DYCA 5IGNA 5FE8A 4IR6A 4QEUA 5HRWA 4UIZA 4A9OA 5LUUA 5DKHA 4PS5A 5E9YA 4QUUA 4N3WA 5C8GA 1JSPB 5FG6A 4LZRA 4O7FA 4QR3A 4FLPA 5HEMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5H85 A;  4C66 A;  3UV2 A;  4ZQL A;  2KTB B;  5A5N A;  4F3I A;  3UVY A;  3HMH A;  5FDZ A;  5I88 A;  5E73 A;  3LQI A;  3G0L A;  4UIT A;  5JI8 A;  3DAI A;  4IR3 A;  5D24 A;  5HFR A;  5DBM A;  4UYD A;  5FE0 A;  5A82 A;  4YBM A;  5EWC A;  4UYF B;  3S92 A;  4HXM A;  3NXB A;  4NUC A;  4E96 A;  2RNX A;  4O7C A;  2E3K A;  3LJW A;  2YEM A;  3P1D A;  4IOR A;  5CGP A;  3SVH A;  5CU8 A;  5DFD A;  5EP7 A;  4YYK A;  5A5O A;  5DW2 A;  5II2 A;  4NR4 A;  5CQA A;  5A5Q A;  5IG6 A;  5HEL A;  4XY9 A;  4O76 A;  5II1 A;  5LVQ A;  3P1F A;  4QY4 A;  4MEO A;  4GPJ A;  4NR9 A;  4HBW A;  3U5O A;  5E74 A;  5COI A;  1F68 A;  4O72 A;  4CUR A;  4MEQ A;  4NR6 A;  5DX4 A;  3JVL A;  4Z6I A;  4NYV A;  1WUG A;  5ACY A;  4UIX A;  4UYF A;  4NR5 A;  5E9I A;  4OGJ A;  4YYD A;  4XYA A;  5DYA A;  4XUB A;  5LVR A;  5BT4 A;  3I3J A;  5HEN A;  4HBX A;  5CUC A;  5EPS A;  5L8T A;  5D3T A;  4Z93 A;  5CUD A;  5FE4 A;  2YEK A;  5TCM A;  4A9J A;  4N4H A;  4NRC A;  5I29 A;  5F3A A;  4DON A;  5EPR A;  5D3P A;  4O78 A;  5F36 A;  4MEN A;  5LJ2 A;  5EPB A;  4IR5 A;  4O77 A;  4LC2 A;  4YAB A;  4UIY A;  5FBX A;  4NUE A;  5AMF A;  4RVR A;  4OUF A;  4NQM A;  5D7X A;  3U5K A;  5H1T A;  4HBV A;  2LSP B;  5E9M A;  5EM3 A;  5DFB A;  5ETB A;  5HRX A;  5LKZ A;  4BHW A;  2G4A A;  4O7B A;  4CUQ A;  5LJ1 A;  4A9I A;  3O35 A;  4NYW A;  5C85 A;  5D3H A;  4Q0O A;  4QSQ A;  4Z1S A;  4J0S A;  4BW1 A;  4YH3 A;  3UVW A;  5H1U A;  5KHM A;  5EIS A;  4UIU A;  4KCX A;  5D3N A;  3MQM A;  4TZ8 A;  3ZYU A;  4TTE A;  5CFW A;  4YYM A;  3QZT A;  4TQN A;  5CPE A;  5DY7 A;  4MR3 A;  5FG4 A;  4TT6 A;  3MXF A;  2YEL A;  4QEV A;  3K2J A;  4QR4 A;  4YK0 A;  3P1E A;  4QB3 A;  5C87 A;  5DLX A;  5I83 A;  5CTL A;  5FB0 A;  4A9E A;  3U5P A;  3Q2F A;  4YC9 A;  4A9H A;  5I80 A;  4LRG A;  3O34 A;  4HXS A;  5EV9 A;  4QC3 A;  1X0J A;  4UYE A;  3UV5 A;  4QSV A;  3QZV A;  4BW2 A;  4YBS A;  3UVX A;  5D3J A;  5EGU A;  4ZC9 A;  5HQ5 A;  5DW1 A;  4YYJ A;  5FE6 A;  4HXN A;  5D26 A;  2R0S A;  4MEP A;  4TT2 A;  5FH7 A;  2N9G A;  5DKC A;  5E7D A;  4QYD A;  5F1H A;  5E9K A;  5A5R A;  4HXR A;  2YYN A;  3MB4 A;  4OGI A;  5EWD A;  4ALH A;  4QSS A;  5FH8 A;  4CUT A;  4XY8 A;  4Z6H A;  2R0V A;  2OSS A;  3S91 A;  3IU6 A;  5DLZ A;  5A85 A;  5CQ8 A;  5E9V A;  4PTB A;  2F6N A;  5IGL A;  2OO1 A;  4J0R A;  4O71 A;  2E7O A;  3DWY A;  5EI4 A;  4BW3 A;  5CQ4 A;  1ZS5 A;  4KV4 A;  5ENC A;  3LQH A;  5I86 A;  4WHW A;  5EVA A;  4HXK A;  4HBY A;  4TU4 A;  2DKW A;  5CUG A;  3O33 A;  4YH4 A;  4UIV A;  4YY6 A;  5ENH A;  2L84 A;  4MR4 A;  4IOO A;  2E7N A;  4A9M A;  2F6J A;  3MUL A;  3U5J A;  5EU1 A;  5KU3 A;  4LYI A;  4Q0N A;  2RFJ A;  5IBN A;  3JVK A;  5FE7 A;  5C4Q A;  5I89 A;  5F2P A;  5EWW A;  5HQ7 A;  5F60 A;  5CQ5 A;  4CLB A;  3P5O A;  2RO1 A;  2RS9 B;  3MUK A;  5I40 A;  4CUU A;  5C89 A;  5BT3 A;  4UIW A;  4QYL A;  5F61 A;  3P1C A;  3GG3 A;  4QEW A;  4QST A;  5EK9 A;  4PCI A;  2DWW A;  5CUA A;  1N72 A;  2R0Y A;  5FFW A;  5FE9 A;  2DVQ A;  4Y03 A;  4NRA A;  4PY6 A;  5CQT A;  5LJ0 A;  5CS8 A;  4AKN A;  4HXO A;  4LYS A;  5D3R A;  5KTW A;  3LXJ A;  3UW9 A;  5EA1 A;  2MJV B;  3U5L A;  5L98 A;  3U5M A;  4A9N A;  3ONI A;  5JWM A;  5HFQ A;  5L96 A;  4NQN A;  4MR6 A;  4QSX A;  5FFV A;  5A5P A;  4XUA A;  5DYU A;  3U5N A;  5HRV A;  4TU6 A;  3SVG A;  4CFL A;  4CUP A;  4UYH A;  3QZS A;  5ENI A;  5E3D A;  5I1Q A;  4QSW A;  5FE5 A;  5C7N A;  4O74 A;  2DVS A;  5D25 A;  3JVM A;  5A81 A;  5HLS A;  4QC1 A;  4QSU A;  4YAD A;  5AD2 A;  4KV1 A;  5CRM A;  3RCW A;  5DYX A;  3TLP A;  5I7Y A;  5DKD A;  4ALG A;  4NS5 A;  5ENG A;  4TS8 A;  5TB6 A;  4X2I A;  5KO4 A;  4J1P A;  2D82 A;  2I8N A;  4YYI A;  2WP2 A;  3Q2E A;  3AQA A;  4N4I A;  5FG5 A;  3UVD A;  4TT4 A;  3IU5 A;  4YAX A;  4LZS A;  4YAT A;  4NUD A;  2H60 A;  5CQ7 A;  5H1V A;  5ETD A;  4TYL A;  4CL9 A;  2DVV A;  4O75 A;  2YQD A;  2YW5 A;  3G0J A;  4LDF A;  5EWV A;  5A5S A;  5KTX A;  4MR5 A;  5FE2 A;  3FKM X;  5EWH A;  4N4F A;  4YYG A;  4N4G A;  2NXB A;  4QSR A;  5F5Z A;  5LKT A;  5AME A;  3O36 A;  2YDW A;  4O7E A;  5EQ1 A;  4LYW A;  5ENF A;  5EIC A;  5CQ6 A;  4WIV A;  4ZW1 A;  2RI7 A;  3AAD A;  5A7C A;  5ENJ A;  5IID A;  5L8U A;  5LKU A;  2D9E A;  4NXJ A;  5F63 A;  3JVJ A;  4YBT A;  4QUT A;  2OUO A;  5CUE A;  5I7X A;  5IGK A;  4CFK A;  4HXP A;  2RNY A;  4PKL A;  5FE3 A;  4A9F A;  5IGM A;  5CQ3 A;  2R10 A;  2WP1 A;  5E3G A;  1JM4 B;  5FB1 A;  4QZS A;  3MB3 A;  4C67 A;  3HMF A;  1WUM A;  4QR5 A;  4PCE A;  5ENB A;  5HM0 A;  4NYX A;  5AD3 A;  2L85 A;  5D3S A;  4NRB A;  2L5E A;  5CUB A;  4QSP A;  5A83 A;  5BT5 A;  4Z1Q A;  4WHU A;  5CRZ A;  2FSA A;  2RNW A;  5J0D A;  5HCL A;  4NR8 A;  3O37 A;  4IR4 A;  5G4R A;  4A9L A;  4YYN A;  4BW4 A;  4UYG A;  3SVF A;  4A9K A;  5CY9 A;  5L99 A;  2DAT A;  4TZ2 A;  5CZG A;  5F62 A;  1E6I A;  4O7A A;  2DVR A;  5FE1 A;  3D7C A;  2I7K A;  5L97 A;  3HME A;  5KTU A;  5LKX A;  5F1L A;  5HJC A;  5FFY A;  5FH6 A;  4CUS A;  1EQF A;  5K29 A;  2GRC A;  4IOQ A;  5DFC A;  4YY4 A;  4YYH A;  4QNS A;  3UV4 A;  5D3L A;  4O70 A;  4QBM A;  5HQ6 A;  4LZ2 A;  5E9L A;  4LR6 A;  5E0R A;  5ENE A;  4BJX A;  5D0C A;  3LQJ A;  4J3I A;  4NR7 A;  5F25 A;  5G4S A;  4HXL A;  5CP5 A;  5DYC A;  5IGN A;  5FE8 A;  4IR6 A;  4QEU A;  5HRW A;  4UIZ A;  4A9O A;  5LUU A;  5DKH A;  4PS5 A;  5E9Y A;  4QUU A;  4N3W A;  5C8G A;  1JSP B;  5FG6 A;  4LZR A;  4O7F A;  4QR3 A;  4FLP A;  5HEM A; 
#chains in the Genus database with same CATH topology
 5H85 A;  4C66 A;  3UV2 A;  4ZQL A;  2KTB B;  5A5N A;  4F3I A;  3UVY A;  3HMH A;  5FDZ A;  5I88 A;  5E73 A;  3LQI A;  3G0L A;  4UIT A;  5JI8 A;  3DAI A;  4IR3 A;  5D24 A;  5HFR A;  5DBM A;  4UYD A;  4AKI A;  5FE0 A;  5A82 A;  4YBM A;  5EWC A;  4UYF B;  3S92 A;  4HXM A;  3NXB A;  4NUC A;  4E96 A;  2RNX A;  4O7C A;  2E3K A;  3LJW A;  2YEM A;  3P1D A;  4IOR A;  5CGP A;  3SVH A;  5CU8 A;  5DFD A;  5EP7 A;  4YYK A;  5A5O A;  5DW2 A;  5II2 A;  4NR4 A;  5CQA A;  5A5Q A;  5IG6 A;  5HEL A;  4XY9 A;  4O76 A;  5II1 A;  5LVQ A;  3P1F A;  4QY4 A;  4MEO A;  4GPJ A;  4NR9 A;  4HBW A;  3U5O A;  5E74 A;  5COI A;  1F68 A;  4O72 A;  4CUR A;  4MEQ A;  4NR6 A;  5DX4 A;  3JVL A;  4Z6I A;  4NYV A;  1WUG A;  5ACY A;  4UIX A;  4UYF A;  4NR5 A;  5E9I A;  4OGJ A;  4YYD A;  4XYA A;  5DYA A;  4XUB A;  5LVR A;  5BT4 A;  3I3J A;  5HEN A;  4HBX A;  5CUC A;  5EPS A;  5L8T A;  5D3T A;  4Z93 A;  5CUD A;  5FE4 A;  2YEK A;  5TCM A;  4A9J A;  4N4H A;  4NRC A;  5I29 A;  5F3A A;  4DON A;  5EPR A;  5D3P A;  4O78 A;  5F36 A;  4MEN A;  5LJ2 A;  5EPB A;  4IR5 A;  4O77 A;  4LC2 A;  4YAB A;  4UIY A;  5FBX A;  4NUE A;  5AMF A;  4RVR A;  4OUF A;  4NQM A;  5D7X A;  3U5K A;  5H1T A;  4HBV A;  2LSP B;  5E9M A;  5EM3 A;  5DFB A;  5ETB A;  5HRX A;  5LKZ A;  4BHW A;  2G4A A;  4O7B A;  4CUQ A;  5LJ1 A;  4AKH A;  4A9I A;  3O35 A;  4NYW A;  5C85 A;  5D3H A;  4Q0O A;  4QSQ A;  4Z1S A;  4J0S A;  4BW1 A;  4YH3 A;  3UVW A;  5H1U A;  5KHM A;  5EIS A;  4UIU A;  4KCX A;  5D3N A;  3MQM A;  4TZ8 A;  3ZYU A;  4TTE A;  5CFW A;  4YYM A;  3QZT A;  4TQN A;  5CPE A;  5DY7 A;  4MR3 A;  5FG4 A;  4TT6 A;  3MXF A;  2YEL A;  4QEV A;  3K2J A;  4QR4 A;  4YK0 A;  3P1E A;  4QB3 A;  5C87 A;  5DLX A;  5I83 A;  5CTL A;  5FB0 A;  4A9E A;  3U5P A;  3Q2F A;  4YC9 A;  4A9H A;  5I80 A;  4LRG A;  3O34 A;  4HXS A;  5EV9 A;  4QC3 A;  1X0J A;  4UYE A;  3UV5 A;  4QSV A;  3QZV A;  4BW2 A;  4YBS A;  4AKG A;  3UVX A;  5D3J A;  5EGU A;  4ZC9 A;  5HQ5 A;  5DW1 A;  4YYJ A;  5FE6 A;  4HXN A;  5D26 A;  2R0S A;  4MEP A;  4TT2 A;  4AI6 A;  5FH7 A;  2N9G A;  5DKC A;  5E7D A;  4QYD A;  5F1H A;  5E9K A;  5A5R A;  4HXR A;  2YYN A;  3MB4 A;  4OGI A;  5EWD A;  4ALH A;  4QSS A;  5FH8 A;  4CUT A;  4XY8 A;  4Z6H A;  2R0V A;  2OSS A;  3S91 A;  3IU6 A;  5DLZ A;  3VKG A;  5A85 A;  5CQ8 A;  5E9V A;  4PTB A;  2F6N A;  5IGL A;  2OO1 A;  4J0R A;  4O71 A;  2E7O A;  2EJN A;  3DWY A;  5EI4 A;  4BW3 A;  5CQ4 A;  1PUO A;  1ZS5 A;  4KV4 A;  5ENC A;  3LQH A;  5I86 A;  4WHW A;  5EVA A;  4HXK A;  4HBY A;  4TU4 A;  2DKW A;  5CUG A;  3O33 A;  4YH4 A;  4UIV A;  4YY6 A;  5ENH A;  2L84 A;  4MR4 A;  4IOO A;  2E7N A;  4A9M A;  2F6J A;  3MUL A;  3U5J A;  5EU1 A;  5KU3 A;  4LYI A;  4Q0N A;  2RFJ A;  5IBN A;  3JVK A;  3D1B A;  5FE7 A;  5C4Q A;  5I89 A;  5F2P A;  5EWW A;  5HQ7 A;  5F60 A;  5CQ5 A;  4CLB A;  3P5O A;  2RO1 A;  2RS9 B;  3MUK A;  5I40 A;  4CUU A;  5C89 A;  5BT3 A;  4UIW A;  4QYL A;  5F61 A;  3P1C A;  3GG3 A;  4QEW A;  4QST A;  5EK9 A;  4PCI A;  2DWW A;  5CUA A;  1N72 A;  2R0Y A;  5FFW A;  5FE9 A;  2DVQ A;  4Y03 A;  4NRA A;  4PY6 A;  5CQT A;  5LJ0 A;  5CS8 A;  4AKN A;  4HXO A;  4LYS A;  5D3R A;  5KTW A;  3LXJ A;  3UW9 A;  5EA1 A;  2MJV B;  3U5L A;  5L98 A;  3U5M A;  4A9N A;  3ONI A;  5JWM A;  5HFQ A;  5L96 A;  4NQN A;  4MR6 A;  4QSX A;  5FFV A;  5A5P A;  4XUA A;  5DYU A;  3U5N A;  5HRV A;  4TU6 A;  3SVG A;  4CFL A;  4CUP A;  4UYH A;  3QZS A;  5ENI A;  5E3D A;  5I1Q A;  4QSW A;  5FE5 A;  5C7N A;  4O74 A;  2DVS A;  5D25 A;  3JVM A;  5A81 A;  5HLS A;  4QC1 A;  4QSU A;  4YAD A;  5AD2 A;  4KV1 A;  5CRM A;  3RCW A;  5DYX A;  3TLP A;  5I7Y A;  5DKD A;  4ALG A;  4NS5 A;  5ENG A;  4TS8 A;  5TB6 A;  4X2I A;  5KO4 A;  4J1P A;  2D82 A;  2I8N A;  4YYI A;  2WP2 A;  3Q2E A;  3AQA A;  4N4I A;  5FG5 A;  3UVD A;  4TT4 A;  3IU5 A;  4YAX A;  4LZS A;  4YAT A;  4NUD A;  2H60 A;  5CQ7 A;  5H1V A;  5ETD A;  4TYL A;  4CL9 A;  3D1D A;  2DVV A;  4O75 A;  2YQD A;  2YW5 A;  3G0J A;  4LDF A;  5EWV A;  5A5S A;  5KTX A;  4MR5 A;  5FE2 A;  1ZKR A;  3FKM X;  5EWH A;  4N4F A;  4YYG A;  4N4G A;  2NXB A;  4QSR A;  5F5Z A;  5LKT A;  5AME A;  3O36 A;  2YDW A;  4O7E A;  5EQ1 A;  4LYW A;  3VKH A;  5ENF A;  5EIC A;  5CQ6 A;  4WIV A;  4ZW1 A;  2RI7 A;  3AAD A;  5A7C A;  5ENJ A;  5IID A;  5L8U A;  5LKU A;  2D9E A;  4NXJ A;  5F63 A;  3JVJ A;  4YBT A;  4QUT A;  2OUO A;  5CUE A;  5I7X A;  5IGK A;  4CFK A;  4HXP A;  2RNY A;  4PKL A;  5FE3 A;  4A9F A;  5IGM A;  5CQ3 A;  2R10 A;  2WP1 A;  5E3G A;  1JM4 B;  5FB1 A;  4QZS A;  3MB3 A;  4C67 A;  3HMF A;  1WUM A;  4QR5 A;  4PCE A;  5ENB A;  5HM0 A;  4NYX A;  5AD3 A;  2L85 A;  3ERR A;  5D3S A;  4NRB A;  2L5E A;  5CUB A;  4QSP A;  5A83 A;  5BT5 A;  4Z1Q A;  4WHU A;  5CRZ A;  2FSA A;  2RNW A;  5J0D A;  5HCL A;  4NR8 A;  3O37 A;  4IR4 A;  5G4R A;  4A9L A;  4YYN A;  4BW4 A;  4UYG A;  3SVF A;  4A9K A;  5CY9 A;  5L99 A;  2DAT A;  4TZ2 A;  5CZG A;  5F62 A;  1E6I A;  4O7A A;  2DVR A;  5FE1 A;  3D7C A;  2I7K A;  5L97 A;  3HME A;  5KTU A;  5LKX A;  5F1L A;  5HJC A;  5FFY A;  5FH6 A;  4CUS A;  1EQF A;  5K29 A;  2GRC A;  4IOQ A;  5DFC A;  4YY4 A;  4YYH A;  4QNS A;  3UV4 A;  5D3L A;  4O70 A;  4QBM A;  5HQ6 A;  4LZ2 A;  5E9L A;  4LR6 A;  5E0R A;  5ENE A;  4BJX A;  5D0C A;  3LQJ A;  4J3I A;  4NR7 A;  5F25 A;  5G4S A;  4HXL A;  5CP5 A;  5DYC A;  5IGN A;  5FE8 A;  4IR6 A;  4QEU A;  5HRW A;  4UIZ A;  4A9O A;  5LUU A;  5DKH A;  4PS5 A;  5E9Y A;  4QUU A;  4N3W A;  5C8G A;  1JSP B;  5FG6 A;  4LZR A;  4O7F A;  4QR3 A;  4FLP A;  5HEM A; 
#chains in the Genus database with same CATH homology
 5H85 A;  4C66 A;  3UV2 A;  4ZQL A;  2KTB B;  5A5N A;  4F3I A;  3UVY A;  3HMH A;  5FDZ A;  5I88 A;  5E73 A;  3LQI A;  3G0L A;  4UIT A;  5JI8 A;  3DAI A;  4IR3 A;  5D24 A;  5HFR A;  5DBM A;  4UYD A;  5FE0 A;  5A82 A;  4YBM A;  5EWC A;  4UYF B;  3S92 A;  4HXM A;  3NXB A;  4NUC A;  4E96 A;  2RNX A;  4O7C A;  2E3K A;  3LJW A;  2YEM A;  3P1D A;  4IOR A;  5CGP A;  3SVH A;  5CU8 A;  5DFD A;  5EP7 A;  4YYK A;  5A5O A;  5DW2 A;  5II2 A;  4NR4 A;  5CQA A;  5A5Q A;  5IG6 A;  5HEL A;  4XY9 A;  4O76 A;  5II1 A;  5LVQ A;  3P1F A;  4QY4 A;  4MEO A;  4GPJ A;  4NR9 A;  4HBW A;  3U5O A;  5E74 A;  5COI A;  1F68 A;  4O72 A;  4CUR A;  4MEQ A;  4NR6 A;  5DX4 A;  3JVL A;  4Z6I A;  4NYV A;  1WUG A;  5ACY A;  4UIX A;  4UYF A;  4NR5 A;  5E9I A;  4OGJ A;  4YYD A;  4XYA A;  5DYA A;  4XUB A;  5LVR A;  5BT4 A;  3I3J A;  5HEN A;  4HBX A;  5CUC A;  5EPS A;  5L8T A;  5D3T A;  4Z93 A;  5CUD A;  5FE4 A;  2YEK A;  5TCM A;  4A9J A;  4N4H A;  4NRC A;  5I29 A;  5F3A A;  4DON A;  5EPR A;  5D3P A;  4O78 A;  5F36 A;  4MEN A;  5LJ2 A;  5EPB A;  4IR5 A;  4O77 A;  4LC2 A;  4YAB A;  4UIY A;  5FBX A;  4NUE A;  5AMF A;  4RVR A;  4OUF A;  4NQM A;  5D7X A;  3U5K A;  5H1T A;  4HBV A;  2LSP B;  5E9M A;  5EM3 A;  5DFB A;  5ETB A;  5HRX A;  5LKZ A;  4BHW A;  2G4A A;  4O7B A;  4CUQ A;  5LJ1 A;  4A9I A;  3O35 A;  4NYW A;  5C85 A;  5D3H A;  4Q0O A;  4QSQ A;  4Z1S A;  4J0S A;  4BW1 A;  4YH3 A;  3UVW A;  5H1U A;  5KHM A;  5EIS A;  4UIU A;  4KCX A;  5D3N A;  3MQM A;  4TZ8 A;  3ZYU A;  4TTE A;  5CFW A;  4YYM A;  3QZT A;  4TQN A;  5CPE A;  5DY7 A;  4MR3 A;  5FG4 A;  4TT6 A;  3MXF A;  2YEL A;  4QEV A;  3K2J A;  4QR4 A;  4YK0 A;  3P1E A;  4QB3 A;  5C87 A;  5DLX A;  5I83 A;  5CTL A;  5FB0 A;  4A9E A;  3U5P A;  3Q2F A;  4YC9 A;  4A9H A;  5I80 A;  4LRG A;  3O34 A;  4HXS A;  5EV9 A;  4QC3 A;  1X0J A;  4UYE A;  3UV5 A;  4QSV A;  3QZV A;  4BW2 A;  4YBS A;  3UVX A;  5D3J A;  5EGU A;  4ZC9 A;  5HQ5 A;  5DW1 A;  4YYJ A;  5FE6 A;  4HXN A;  5D26 A;  2R0S A;  4MEP A;  4TT2 A;  5FH7 A;  2N9G A;  5DKC A;  5E7D A;  4QYD A;  5F1H A;  5E9K A;  5A5R A;  4HXR A;  2YYN A;  3MB4 A;  4OGI A;  5EWD A;  4ALH A;  4QSS A;  5FH8 A;  4CUT A;  4XY8 A;  4Z6H A;  2R0V A;  2OSS A;  3S91 A;  3IU6 A;  5DLZ A;  5A85 A;  5CQ8 A;  5E9V A;  4PTB A;  2F6N A;  5IGL A;  2OO1 A;  4J0R A;  4O71 A;  2E7O A;  3DWY A;  5EI4 A;  4BW3 A;  5CQ4 A;  1ZS5 A;  4KV4 A;  5ENC A;  3LQH A;  5I86 A;  4WHW A;  5EVA A;  4HXK A;  4HBY A;  4TU4 A;  2DKW A;  5CUG A;  3O33 A;  4YH4 A;  4UIV A;  4YY6 A;  5ENH A;  2L84 A;  4MR4 A;  4IOO A;  2E7N A;  4A9M A;  2F6J A;  3MUL A;  3U5J A;  5EU1 A;  5KU3 A;  4LYI A;  4Q0N A;  2RFJ A;  5IBN A;  3JVK A;  5FE7 A;  5C4Q A;  5I89 A;  5F2P A;  5EWW A;  5HQ7 A;  5F60 A;  5CQ5 A;  4CLB A;  3P5O A;  2RO1 A;  2RS9 B;  3MUK A;  5I40 A;  4CUU A;  5C89 A;  5BT3 A;  4UIW A;  4QYL A;  5F61 A;  3P1C A;  3GG3 A;  4QEW A;  4QST A;  5EK9 A;  4PCI A;  2DWW A;  5CUA A;  1N72 A;  2R0Y A;  5FFW A;  5FE9 A;  2DVQ A;  4Y03 A;  4NRA A;  4PY6 A;  5CQT A;  5LJ0 A;  5CS8 A;  4AKN A;  4HXO A;  4LYS A;  5D3R A;  5KTW A;  3LXJ A;  3UW9 A;  5EA1 A;  2MJV B;  3U5L A;  5L98 A;  3U5M A;  4A9N A;  3ONI A;  5JWM A;  5HFQ A;  5L96 A;  4NQN A;  4MR6 A;  4QSX A;  5FFV A;  5A5P A;  4XUA A;  5DYU A;  3U5N A;  5HRV A;  4TU6 A;  3SVG A;  4CFL A;  4CUP A;  4UYH A;  3QZS A;  5ENI A;  5E3D A;  5I1Q A;  4QSW A;  5FE5 A;  5C7N A;  4O74 A;  2DVS A;  5D25 A;  3JVM A;  5A81 A;  5HLS A;  4QC1 A;  4QSU A;  4YAD A;  5AD2 A;  4KV1 A;  5CRM A;  3RCW A;  5DYX A;  3TLP A;  5I7Y A;  5DKD A;  4ALG A;  4NS5 A;  5ENG A;  4TS8 A;  5TB6 A;  4X2I A;  5KO4 A;  4J1P A;  2D82 A;  2I8N A;  4YYI A;  2WP2 A;  3Q2E A;  3AQA A;  4N4I A;  5FG5 A;  3UVD A;  4TT4 A;  3IU5 A;  4YAX A;  4LZS A;  4YAT A;  4NUD A;  2H60 A;  5CQ7 A;  5H1V A;  5ETD A;  4TYL A;  4CL9 A;  2DVV A;  4O75 A;  2YQD A;  2YW5 A;  3G0J A;  4LDF A;  5EWV A;  5A5S A;  5KTX A;  4MR5 A;  5FE2 A;  3FKM X;  5EWH A;  4N4F A;  4YYG A;  4N4G A;  2NXB A;  4QSR A;  5F5Z A;  5LKT A;  5AME A;  3O36 A;  2YDW A;  4O7E A;  5EQ1 A;  4LYW A;  5ENF A;  5EIC A;  5CQ6 A;  4WIV A;  4ZW1 A;  2RI7 A;  3AAD A;  5A7C A;  5ENJ A;  5IID A;  5L8U A;  5LKU A;  2D9E A;  4NXJ A;  5F63 A;  3JVJ A;  4YBT A;  4QUT A;  2OUO A;  5CUE A;  5I7X A;  5IGK A;  4CFK A;  4HXP A;  2RNY A;  4PKL A;  5FE3 A;  4A9F A;  5IGM A;  5CQ3 A;  2R10 A;  2WP1 A;  5E3G A;  1JM4 B;  5FB1 A;  4QZS A;  3MB3 A;  4C67 A;  3HMF A;  1WUM A;  4QR5 A;  4PCE A;  5ENB A;  5HM0 A;  4NYX A;  5AD3 A;  2L85 A;  5D3S A;  4NRB A;  2L5E A;  5CUB A;  4QSP A;  5A83 A;  5BT5 A;  4Z1Q A;  4WHU A;  5CRZ A;  2FSA A;  2RNW A;  5J0D A;  5HCL A;  4NR8 A;  3O37 A;  4IR4 A;  5G4R A;  4A9L A;  4YYN A;  4BW4 A;  4UYG A;  3SVF A;  4A9K A;  5CY9 A;  5L99 A;  2DAT A;  4TZ2 A;  5CZG A;  5F62 A;  1E6I A;  4O7A A;  2DVR A;  5FE1 A;  3D7C A;  2I7K A;  5L97 A;  3HME A;  5KTU A;  5LKX A;  5F1L A;  5HJC A;  5FFY A;  5FH6 A;  4CUS A;  1EQF A;  5K29 A;  2GRC A;  4IOQ A;  5DFC A;  4YY4 A;  4YYH A;  4QNS A;  3UV4 A;  5D3L A;  4O70 A;  4QBM A;  5HQ6 A;  4LZ2 A;  5E9L A;  4LR6 A;  5E0R A;  5ENE A;  4BJX A;  5D0C A;  3LQJ A;  4J3I A;  4NR7 A;  5F25 A;  5G4S A;  4HXL A;  5CP5 A;  5DYC A;  5IGN A;  5FE8 A;  4IR6 A;  4QEU A;  5HRW A;  4UIZ A;  4A9O A;  5LUU A;  5DKH A;  4PS5 A;  5E9Y A;  4QUU A;  4N3W A;  5C8G A;  1JSP B;  5FG6 A;  4LZR A;  4O7F A;  4QR3 A;  4FLP A;  5HEM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...