5CP5A

Crystal structure of the first bromodomain of human brd4 in complex with benzo[cd]indol-2(1h)-one ligand
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
127
structure length
127
Chain Sequence
PRGSNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bromodomain-containing protein 4
publication title Discovery of Benzo[cd]indol-2(1H)-ones as Potent and Specific BET Bromodomain Inhibitors: Structure-Based Virtual Screening, Optimization, and Biological Evaluation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/inhibitor
total genus 45
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2015-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5cp5A01
4QNSA 3MUKA 4UIZA 5CTLA 5ENHA 4NUEA 5IIDA 5L8TA 2DVQA 2RNYA 1X0JA 4ALHA 4YAXA 5D3HA 2YDWA 5HRVA 4LRGA 5FE0A 4LYIA 5I40A 3IU5A 3SVFA 5IG6A 3JVLA 5J0DA 4ZW1A 4A9MA 4OUFA 5I80A 4YYHA 4HXMA 4QR3A 4CUQA 5CFWA 2DKWA 4UYHA 5FG5A 4TU6A 5A85A 5CUGA 4CFKA 3S91A 5LKXA 5KO4A 5CQAA 5FE3A 4E96A 5F2PA 4CL9A 5KTXA 2R10A 4UYGA 5E3DA 5I7YA 3RCWA 3D7CA 4BW4A 2WP2A 5BT4A 2F6JA 3MB4A 5DYUA 4O74A 3UV4A 1WUMA 5CQ8A 5L99A 4XY9A 5ACYA 1E6IA 5CQTA 3U5JA 3U5PA 4YK0A 3NXBA 4PCIA 5FE1A 4YY6A 5D0CA 2RS9B 2YW5A 4LR6A 4QC1A 2I7KA 5DBMA 3LQHA 4MR5A 4O70A 5FE2A 5E9VA 5EV9A 5EPRA 5EWHA 5D3TA 5HQ6A 5AD2A 5EPSA 4O71A 4YABA 4O77A 3O34A 3UVWA 5H1UA 2GRCA 5HENA 5FFWA 5A5QA 4UIYA 5AMEA 4UITA 5LJ0A 5LJ1A 4NXJA 5BT5A 5L96A 2YEKA 5CQ3A 5K29A 5KTUA 4CUSA 4YYIA 4UYFA 5HRXA 5AMFA 5ETBA 3DWYA 4A9EA 4UYDA 5LKTA 5E0RA 5COIA 5HLSA 2YEMA 5ENCA 4MEQA 4LDFA 4O75A 4XUAA 5ETDA 5E74A 5A81A 4N4IA 2I8NA 4UYFB 4TQNA 4PTBA 4QUTA 4RVRA 3MB3A 3P1DA 5DX4A 5EK9A 5EWWA 3Q2EA 5FH8A 4NRBA 4QSTA 4C67A 5EQ1A 4IR4A 4IOQA 5FFYA 4LZSA 4MENA 4YYJA 5HELA 4N3WA 2DVRA 5AD3A 4O7CA 5HM0A 5CP5A 2DWWA 5E73A 5F1LA 5FG6A 5CY9A 1F68A 5II2A 4YYMA 4QSQA 5CUDA 5DKCA 5E9IA 4HBVA 4HBXA 5A5PA 4YH3A 5G4SA 5FE7A 5CQ4A 4IR3A 4CLBA 2D9EA 4UYEA 5FG4A 4HXKA 3G0JA 5D3PA 5CS8A 4QSWA 4QR5A 4NUDA 3JVKA 5F60A 3G0LA 5A5RA 3P5OA 4QSVA 4ZC9A 4XYAA 1JM4B 4N4FA 4YY4A 5FB1A 5CGPA 4UIVA 4HXOA 4QEWA 2FSAA 4NR9A 3AADA 4XY8A 5F5ZA 3I3JA 3LQJA 2OUOA 4HXPA 4QSSA 4UIUA 5IGNA 3JVJA 5D3NA 4Z1SA 4QC3A 5KTWA 4UIWA 2L85A 5IGMA 4CUUA 4LYSA 5KHMA 5C87A 4YATA 5EGUA 3UVYA 2OO1A 4UIXA 3SVGA 5D3LA 5DFBA 4BHWA 4A9IA 5FE8A 4A9FA 4C66A 5EP7A 2YQDA 4QB3A 2E7NA 2H60A 4TT6A 5DY7A 4A9JA 4NR7A 4J0RA 1EQFA 5FE4A 5I86A 5I89A 2E7OA 5LVRA 2G4AA 5E9YA 4J3IA 4MEOA 4NR8A 4NR6A 5EM3A 5A82A 4LC2A 4MEPA 4O72A 4CURA 5ENEA 5H1TA 4TTEA 5EPBA 5FB0A 5DYXA 4WIVA 5F1HA 4J0SA 4IR5A 5KU3A 5F63A 5EA1A 4YBMA 1JSPB 3MQMA 5L98A 4LZ2A 3HMFA 4KV1A 5F36A 5FE5A 4NRAA 4QYLA 5D7XA 5HFQA 4QUUA 4QSXA 4YYDA 5IBNA 5HFRA 3UW9A 3LJWA 4DONA 5EISA 3U5MA 4OGJA 4CUTA 4QYDA 2DVVA 3ZYUA 5F3AA 4N4GA 4QY4A 5DFDA 4A9LA 4HBWA 3K2JA 4ALGA 3MXFA 2RNXA 4O7BA 4HXNA 5DLXA 5LKZA 5L97A 2MJVB 2RI7A 3QZVA 5F25A 2R0VA 3U5LA 2E3KA 3P1EA 3GG3A 2L84A 5I7XA 3TLPA 5JWMA 5D24A 4LYWA 5DKHA 3O33A 2OSSA 5DW2A 4WHUA 4KCXA 5LJ2A 3UV2A 4Z93A 5DYCA 5D25A 4Z6IA 4QZSA 4MR6A 2N9GA 4BW1A 4PS5A 4X2IA 4YBSA 5ENJA 5CQ6A 4Z6HA 4NYVA 4PY6A 4TZ8A 5D3JA 5HCLA 5CUBA 5TCMA 5DW1A 4KV4A 4HXLA 5CU8A 4HBYA 4TT2A 5I83A 5FFVA 2YYNA 3O36A 4A9KA 2D82A 3IU6A 4NQNA 3LXJA 5A5OA 5II1A 5LUUA 3SVHA 3MULA 2R0SA 4Q0OA 4TYLA 5FE6A 4OGIA 5H85A 2R0YA 5CUCA 5F61A 4PCEA 3O35A 5CUAA 5E7DA 4F3IA 5HQ5A 4HXRA 5DFCA 3ONIA 4QEUA 5E9KA 4CUPA 4CFLA 4IOOA 4TS8A 5G4RA 5FBXA 5CPEA 5BT3A 5ENGA 1ZS5A 4O76A 4HXSA 5CRMA 5A7CA 1WUGA 2F6NA 3S92A 4O78A 5DKDA 5DLZA 4YYKA 4BW2A 5L8UA 5F62A 4MR4A 5E3GA 5I88A 5CZGA 4IORA 3QZTA 5LVQA 4QSPA 2RO1A 5JI8A 2LSPB 2WP1A 4NR5A 5LKUA 4FLPA 4NYWA 5EWCA 3HMEA 5EI4A 3UVDA 5D26A 5E9LA 4TZ2A 4Z1QA 5A5SA 4NS5A 4TT4A 5CUEA 3HMHA 3UV5A 2DATA 5IGLA 5A83A 4N4HA 4QR4A 4O7AA 5HEMA 4BW3A 5FDZA 3DAIA 3P1CA 4ZQLA 5ENIA 4A9NA 5FH6A 4Y03A 5I1QA 4QSUA 5EVAA 3U5OA 4NYXA 3FKMX 2YELA 3O37A 4NRCA 5E9MA 3LQIA 4YC9A 5EICA 5CQ5A 4A9OA 5C89A 5CQ7A 5A5NA 3UVXA 4MR3A 5FH7A 2RNWA 4YYNA 5D3SA 4QEVA 4GPJA 4WHWA 5ENFA 4BJXA 2RFJA 3U5NA 5HJCA 5D3RA 4YADA 5EWDA 4A9HA 4QBMA 5C4QA 5HRWA 5C7NA 4YH4A 4NQMA 5HQ7A 5C8GA 4YBTA 4TU4A 5TB6A 5I29A 4PKLA 3P1FA 4J1PA 4IR6A 4LZRA 4NR4A 4O7FA 4QSRA 5CRZA 4Q0NA 5IGKA 2L5EA 4XUBA 5EWVA 3U5KA 2KTBB 5H1VA 3QZSA 2NXBA 5EU1A 2DVSA 3Q2FA 5DYAA 5C85A 5FE9A 4YYGA 1N72A 4AKNA 4O7EA 5ENBA 3JVMA 3AQAA 4NUCA
chains in the Genus database with same CATH superfamily
4QNSA 3MUKA 4UIZA 5CTLA 5ENHA 4NUEA 5IIDA 5L8TA 2DVQA 2RNYA 1X0JA 4ALHA 4YAXA 5D3HA 2YDWA 5HRVA 4LRGA 5FE0A 4LYIA 5I40A 3IU5A 3SVFA 5IG6A 3JVLA 5J0DA 4ZW1A 4A9MA 4OUFA 5I80A 4YYHA 4HXMA 4QR3A 4CUQA 5CFWA 2DKWA 4UYHA 1PUOA 5FG5A 4TU6A 3ERRA 5A85A 5CUGA 4CFKA 3S91A 5LKXA 5KO4A 5CQAA 5FE3A 3VKGA 4E96A 5F2PA 4CL9A 5KTXA 2R10A 4UYGA 5E3DA 5I7YA 3RCWA 3D7CA 4BW4A 2WP2A 5BT4A 2F6JA 3MB4A 5DYUA 4O74A 3UV4A 1WUMA 5CQ8A 5L99A 4XY9A 5ACYA 1E6IA 5CQTA 3U5JA 3U5PA 4YK0A 3NXBA 4PCIA 5FE1A 4YY6A 5D0CA 2RS9B 2YW5A 4LR6A 4QC1A 2I7KA 5DBMA 3LQHA 4MR5A 4O70A 5FE2A 5E9VA 4AKGA 5EV9A 5EPRA 5EWHA 5D3TA 5HQ6A 5AD2A 5EPSA 4O71A 4YABA 4O77A 3O34A 3UVWA 5H1UA 2GRCA 5HENA 5FFWA 5A5QA 4UIYA 5AMEA 4UITA 5LJ0A 5LJ1A 4NXJA 5BT5A 5L96A 2YEKA 5CQ3A 5K29A 5KTUA 4CUSA 4YYIA 4UYFA 3VKHA 5HRXA 5AMFA 5ETBA 3DWYA 4A9EA 4UYDA 5LKTA 5E0RA 5COIA 5HLSA 2YEMA 5ENCA 4MEQA 4LDFA 4O75A 4XUAA 5ETDA 5E74A 5A81A 4N4IA 2I8NA 4UYFB 4TQNA 4PTBA 4QUTA 4RVRA 3MB3A 3P1DA 5DX4A 5EK9A 5EWWA 3Q2EA 5FH8A 4NRBA 4QSTA 4C67A 5EQ1A 4IR4A 4IOQA 5FFYA 4LZSA 4MENA 4YYJA 5HELA 4N3WA 2DVRA 5AD3A 2EJNA 4O7CA 5HM0A 5CP5A 2DWWA 5E73A 5F1LA 5FG6A 5CY9A 1F68A 5II2A 4YYMA 4QSQA 5CUDA 5DKCA 5E9IA 4HBVA 4HBXA 5A5PA 4YH3A 5G4SA 5FE7A 5CQ4A 4IR3A 4CLBA 2D9EA 4UYEA 5FG4A 4HXKA 3G0JA 5D3PA 5CS8A 4QSWA 4QR5A 4NUDA 3JVKA 5F60A 3G0LA 5A5RA 3P5OA 4QSVA 4ZC9A 4XYAA 1JM4B 4N4FA 4YY4A 5FB1A 1ZKRA 5CGPA 4UIVA 4HXOA 4QEWA 2FSAA 4NR9A 4AKIA 3AADA 4XY8A 5F5ZA 3I3JA 3LQJA 2OUOA 4HXPA 4QSSA 4UIUA 5IGNA 3JVJA 5D3NA 4Z1SA 4AKHA 4QC3A 5KTWA 4UIWA 2L85A 5IGMA 4CUUA 4LYSA 5KHMA 5C87A 4YATA 5EGUA 3UVYA 2OO1A 4UIXA 3SVGA 5D3LA 5DFBA 4BHWA 4A9IA 5FE8A 4A9FA 4C66A 5EP7A 2YQDA 4QB3A 2E7NA 2H60A 4TT6A 5DY7A 4A9JA 4NR7A 4J0RA 1EQFA 5FE4A 5I86A 5I89A 2E7OA 5LVRA 2G4AA 5E9YA 4J3IA 4MEOA 4NR8A 4NR6A 5EM3A 5A82A 4LC2A 4MEPA 4O72A 4CURA 5ENEA 5H1TA 4TTEA 5EPBA 5FB0A 5DYXA 4WIVA 5F1HA 4J0SA 4IR5A 5KU3A 5F63A 5EA1A 4YBMA 1JSPB 3MQMA 5L98A 4LZ2A 4AI6A 3HMFA 4KV1A 5F36A 5FE5A 4NRAA 4QYLA 5D7XA 5HFQA 4QUUA 4QSXA 4YYDA 5IBNA 5HFRA 3UW9A 3LJWA 4DONA 5EISA 3U5MA 4OGJA 4CUTA 4QYDA 2DVVA 3ZYUA 5F3AA 4N4GA 4QY4A 5DFDA 4A9LA 4HBWA 3K2JA 3D1BA 4ALGA 3MXFA 2RNXA 4O7BA 4HXNA 5DLXA 5LKZA 5L97A 2MJVB 2RI7A 3QZVA 5F25A 2R0VA 3U5LA 2E3KA 3P1EA 3GG3A 2L84A 5I7XA 3TLPA 5JWMA 5D24A 4LYWA 5DKHA 3O33A 2OSSA 5DW2A 4WHUA 4KCXA 5LJ2A 3UV2A 4Z93A 5DYCA 5D25A 4Z6IA 4QZSA 4MR6A 2N9GA 4BW1A 4PS5A 4X2IA 4YBSA 5ENJA 5CQ6A 4Z6HA 4NYVA 4PY6A 4TZ8A 5D3JA 5HCLA 5CUBA 5TCMA 5DW1A 4KV4A 4HXLA 5CU8A 4HBYA 4TT2A 5I83A 5FFVA 2YYNA 3O36A 4A9KA 2D82A 3IU6A 4NQNA 3LXJA 5A5OA 5II1A 5LUUA 3SVHA 3MULA 2R0SA 4Q0OA 4TYLA 5FE6A 4OGIA 5H85A 2R0YA 5CUCA 5F61A 4PCEA 3O35A 5CUAA 5E7DA 4F3IA 5HQ5A 4HXRA 5DFCA 3ONIA 4QEUA 5E9KA 4CUPA 4CFLA 4IOOA 4TS8A 5G4RA 5FBXA 5CPEA 5BT3A 5ENGA 1ZS5A 4O76A 4HXSA 5CRMA 5A7CA 1WUGA 2F6NA 3S92A 4O78A 5DKDA 5DLZA 4YYKA 4BW2A 5L8UA 5F62A 4MR4A 5E3GA 5I88A 5CZGA 3D1DA 4IORA 3QZTA 5LVQA 4QSPA 2RO1A 5JI8A 2LSPB 2WP1A 4NR5A 5LKUA 4FLPA 4NYWA 5EWCA 3HMEA 5EI4A 3UVDA 5D26A 5E9LA 4TZ2A 4Z1QA 5A5SA 4NS5A 4TT4A 5CUEA 3HMHA 3UV5A 2DATA 5IGLA 5A83A 4N4HA 4QR4A 4O7AA 5HEMA 4BW3A 5FDZA 3DAIA 3P1CA 4ZQLA 5ENIA 4A9NA 5FH6A 4Y03A 5I1QA 4QSUA 5EVAA 3U5OA 4NYXA 3FKMX 2YELA 3O37A 4NRCA 5E9MA 3LQIA 4YC9A 5EICA 5CQ5A 4A9OA 5C89A 5CQ7A 5A5NA 3UVXA 4MR3A 5FH7A 2RNWA 4YYNA 5D3SA 4QEVA 4GPJA 4WHWA 5ENFA 4BJXA 2RFJA 3U5NA 5HJCA 5D3RA 4YADA 5EWDA 4A9HA 4QBMA 5C4QA 5HRWA 5C7NA 4YH4A 4NQMA 5HQ7A 5C8GA 4YBTA 4TU4A 5TB6A 5I29A 4PKLA 3P1FA 4J1PA 4IR6A 4LZRA 4NR4A 4O7FA 4QSRA 5CRZA 4Q0NA 5IGKA 2L5EA 4XUBA 5EWVA 3U5KA 2KTBB 5H1VA 3QZSA 2NXBA 5EU1A 2DVSA 3Q2FA 5DYAA 5C85A 5FE9A 4YYGA 1N72A 4AKNA 4O7EA 5ENBA 3JVMA 3AQAA 4NUCA
chains in the Genus database with same CATH topology
4QNSA 3MUKA 4UIZA 5CTLA 5ENHA 4NUEA 5IIDA 5L8TA 2DVQA 2RNYA 1X0JA 4ALHA 4YAXA 5D3HA 2YDWA 5HRVA 4LRGA 5FE0A 4LYIA 5I40A 3IU5A 3SVFA 5IG6A 3JVLA 5J0DA 4ZW1A 4A9MA 4OUFA 5I80A 4YYHA 4HXMA 4QR3A 4CUQA 5CFWA 2DKWA 4UYHA 5FG5A 4TU6A 5A85A 5CUGA 4CFKA 3S91A 5LKXA 5KO4A 5CQAA 5FE3A 4E96A 5F2PA 4CL9A 5KTXA 2R10A 4UYGA 5E3DA 5I7YA 3RCWA 3D7CA 4BW4A 2WP2A 5BT4A 2F6JA 3MB4A 5DYUA 4O74A 3UV4A 1WUMA 5CQ8A 5L99A 4XY9A 5ACYA 1E6IA 5CQTA 3U5JA 3U5PA 4YK0A 3NXBA 4PCIA 5FE1A 4YY6A 5D0CA 2RS9B 2YW5A 4LR6A 4QC1A 2I7KA 5DBMA 3LQHA 4MR5A 4O70A 5FE2A 5E9VA 5EV9A 5EPRA 5EWHA 5D3TA 5HQ6A 5AD2A 5EPSA 4O71A 4YABA 4O77A 3O34A 3UVWA 5H1UA 2GRCA 5HENA 5FFWA 5A5QA 4UIYA 5AMEA 4UITA 5LJ0A 5LJ1A 4NXJA 5BT5A 5L96A 2YEKA 5CQ3A 5K29A 5KTUA 4CUSA 4YYIA 4UYFA 5HRXA 5AMFA 5ETBA 3DWYA 4A9EA 4UYDA 5LKTA 5E0RA 5COIA 5HLSA 2YEMA 5ENCA 4MEQA 4LDFA 4O75A 4XUAA 5ETDA 5E74A 5A81A 4N4IA 2I8NA 4UYFB 4TQNA 4PTBA 4QUTA 4RVRA 3MB3A 3P1DA 5DX4A 5EK9A 5EWWA 3Q2EA 5FH8A 4NRBA 4QSTA 4C67A 5EQ1A 4IR4A 4IOQA 5FFYA 4LZSA 4MENA 4YYJA 5HELA 4N3WA 2DVRA 5AD3A 4O7CA 5HM0A 5CP5A 2DWWA 5E73A 5F1LA 5FG6A 5CY9A 1F68A 5II2A 4YYMA 4QSQA 5CUDA 5DKCA 5E9IA 4HBVA 4HBXA 5A5PA 4YH3A 5G4SA 5FE7A 5CQ4A 4IR3A 4CLBA 2D9EA 4UYEA 5FG4A 4HXKA 3G0JA 5D3PA 5CS8A 4QSWA 4QR5A 4NUDA 3JVKA 5F60A 3G0LA 5A5RA 3P5OA 4QSVA 4ZC9A 4XYAA 1JM4B 4N4FA 4YY4A 5FB1A 5CGPA 4UIVA 4HXOA 4QEWA 2FSAA 4NR9A 3AADA 4XY8A 5F5ZA 3I3JA 3LQJA 2OUOA 4HXPA 4QSSA 4UIUA 5IGNA 3JVJA 5D3NA 4Z1SA 4QC3A 5KTWA 4UIWA 2L85A 5IGMA 4CUUA 4LYSA 5KHMA 5C87A 4YATA 5EGUA 3UVYA 2OO1A 4UIXA 3SVGA 5D3LA 5DFBA 4BHWA 4A9IA 5FE8A 4A9FA 4C66A 5EP7A 2YQDA 4QB3A 2E7NA 2H60A 4TT6A 5DY7A 4A9JA 4NR7A 4J0RA 1EQFA 5FE4A 5I86A 5I89A 2E7OA 5LVRA 2G4AA 5E9YA 4J3IA 4MEOA 4NR8A 4NR6A 5EM3A 5A82A 4LC2A 4MEPA 4O72A 4CURA 5ENEA 5H1TA 4TTEA 5EPBA 5FB0A 5DYXA 4WIVA 5F1HA 4J0SA 4IR5A 5KU3A 5F63A 5EA1A 4YBMA 1JSPB 3MQMA 5L98A 4LZ2A 3HMFA 4KV1A 5F36A 5FE5A 4NRAA 4QYLA 5D7XA 5HFQA 4QUUA 4QSXA 4YYDA 5IBNA 5HFRA 3UW9A 3LJWA 4DONA 5EISA 3U5MA 4OGJA 4CUTA 4QYDA 2DVVA 3ZYUA 5F3AA 4N4GA 4QY4A 5DFDA 4A9LA 4HBWA 3K2JA 4ALGA 3MXFA 2RNXA 4O7BA 4HXNA 5DLXA 5LKZA 5L97A 2MJVB 2RI7A 3QZVA 5F25A 2R0VA 3U5LA 2E3KA 3P1EA 3GG3A 2L84A 5I7XA 3TLPA 5JWMA 5D24A 4LYWA 5DKHA 3O33A 2OSSA 5DW2A 4WHUA 4KCXA 5LJ2A 3UV2A 4Z93A 5DYCA 5D25A 4Z6IA 4QZSA 4MR6A 2N9GA 4BW1A 4PS5A 4X2IA 4YBSA 5ENJA 5CQ6A 4Z6HA 4NYVA 4PY6A 4TZ8A 5D3JA 5HCLA 5CUBA 5TCMA 5DW1A 4KV4A 4HXLA 5CU8A 4HBYA 4TT2A 5I83A 5FFVA 2YYNA 3O36A 4A9KA 2D82A 3IU6A 4NQNA 3LXJA 5A5OA 5II1A 5LUUA 3SVHA 3MULA 2R0SA 4Q0OA 4TYLA 5FE6A 4OGIA 5H85A 2R0YA 5CUCA 5F61A 4PCEA 3O35A 5CUAA 5E7DA 4F3IA 5HQ5A 4HXRA 5DFCA 3ONIA 4QEUA 5E9KA 4CUPA 4CFLA 4IOOA 4TS8A 5G4RA 5FBXA 5CPEA 5BT3A 5ENGA 1ZS5A 4O76A 4HXSA 5CRMA 5A7CA 1WUGA 2F6NA 3S92A 4O78A 5DKDA 5DLZA 4YYKA 4BW2A 5L8UA 5F62A 4MR4A 5E3GA 5I88A 5CZGA 4IORA 3QZTA 5LVQA 4QSPA 2RO1A 5JI8A 2LSPB 2WP1A 4NR5A 5LKUA 4FLPA 4NYWA 5EWCA 3HMEA 5EI4A 3UVDA 5D26A 5E9LA 4TZ2A 4Z1QA 5A5SA 4NS5A 4TT4A 5CUEA 3HMHA 3UV5A 2DATA 5IGLA 5A83A 4N4HA 4QR4A 4O7AA 5HEMA 4BW3A 5FDZA 3DAIA 3P1CA 4ZQLA 5ENIA 4A9NA 5FH6A 4Y03A 5I1QA 4QSUA 5EVAA 3U5OA 4NYXA 3FKMX 2YELA 3O37A 4NRCA 5E9MA 3LQIA 4YC9A 5EICA 5CQ5A 4A9OA 5C89A 5CQ7A 5A5NA 3UVXA 4MR3A 5FH7A 2RNWA 4YYNA 5D3SA 4QEVA 4GPJA 4WHWA 5ENFA 4BJXA 2RFJA 3U5NA 5HJCA 5D3RA 4YADA 5EWDA 4A9HA 4QBMA 5C4QA 5HRWA 5C7NA 4YH4A 4NQMA 5HQ7A 5C8GA 4YBTA 4TU4A 5TB6A 5I29A 4PKLA 3P1FA 4J1PA 4IR6A 4LZRA 4NR4A 4O7FA 4QSRA 5CRZA 4Q0NA 5IGKA 2L5EA 4XUBA 5EWVA 3U5KA 2KTBB 5H1VA 3QZSA 2NXBA 5EU1A 2DVSA 3Q2FA 5DYAA 5C85A 5FE9A 4YYGA 1N72A 4AKNA 4O7EA 5ENBA 3JVMA 3AQAA 4NUCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QNS A;  3MUK A;  4UIZ A;  5CTL A;  5ENH A;  4NUE A;  5IID A;  5L8T A;  2DVQ A;  2RNY A;  1X0J A;  4ALH A;  4YAX A;  5D3H A;  2YDW A;  5HRV A;  4LRG A;  5FE0 A;  4LYI A;  5I40 A;  3IU5 A;  3SVF A;  5IG6 A;  3JVL A;  5J0D A;  4ZW1 A;  4A9M A;  4OUF A;  5I80 A;  4YYH A;  4HXM A;  4QR3 A;  4CUQ A;  5CFW A;  2DKW A;  4UYH A;  5FG5 A;  4TU6 A;  5A85 A;  5CUG A;  4CFK A;  3S91 A;  5LKX A;  5KO4 A;  5CQA A;  5FE3 A;  4E96 A;  5F2P A;  4CL9 A;  5KTX A;  2R10 A;  4UYG A;  5E3D A;  5I7Y A;  3RCW A;  3D7C A;  4BW4 A;  2WP2 A;  5BT4 A;  2F6J A;  3MB4 A;  5DYU A;  4O74 A;  3UV4 A;  1WUM A;  5CQ8 A;  5L99 A;  4XY9 A;  5ACY A;  1E6I A;  5CQT A;  3U5J A;  3U5P A;  4YK0 A;  3NXB A;  4PCI A;  5FE1 A;  4YY6 A;  5D0C A;  2RS9 B;  2YW5 A;  4LR6 A;  4QC1 A;  2I7K A;  5DBM A;  3LQH A;  4MR5 A;  4O70 A;  5FE2 A;  5E9V A;  5EV9 A;  5EPR A;  5EWH A;  5D3T A;  5HQ6 A;  5AD2 A;  5EPS A;  4O71 A;  4YAB A;  4O77 A;  3O34 A;  3UVW A;  5H1U A;  2GRC A;  5HEN A;  5FFW A;  5A5Q A;  4UIY A;  5AME A;  4UIT A;  5LJ0 A;  5LJ1 A;  4NXJ A;  5BT5 A;  5L96 A;  2YEK A;  5CQ3 A;  5K29 A;  5KTU A;  4CUS A;  4YYI A;  4UYF A;  5HRX A;  5AMF A;  5ETB A;  3DWY A;  4A9E A;  4UYD A;  5LKT A;  5E0R A;  5COI A;  5HLS A;  2YEM A;  5ENC A;  4MEQ A;  4LDF A;  4O75 A;  4XUA A;  5ETD A;  5E74 A;  5A81 A;  4N4I A;  2I8N A;  4UYF B;  4TQN A;  4PTB A;  4QUT A;  4RVR A;  3MB3 A;  3P1D A;  5DX4 A;  5EK9 A;  5EWW A;  3Q2E A;  5FH8 A;  4NRB A;  4QST A;  4C67 A;  5EQ1 A;  4IR4 A;  4IOQ A;  5FFY A;  4LZS A;  4MEN A;  4YYJ A;  5HEL A;  4N3W A;  2DVR A;  5AD3 A;  4O7C A;  5HM0 A;  5CP5 A;  2DWW A;  5E73 A;  5F1L A;  5FG6 A;  5CY9 A;  1F68 A;  5II2 A;  4YYM A;  4QSQ A;  5CUD A;  5DKC A;  5E9I A;  4HBV A;  4HBX A;  5A5P A;  4YH3 A;  5G4S A;  5FE7 A;  5CQ4 A;  4IR3 A;  4CLB A;  2D9E A;  4UYE A;  5FG4 A;  4HXK A;  3G0J A;  5D3P A;  5CS8 A;  4QSW A;  4QR5 A;  4NUD A;  3JVK A;  5F60 A;  3G0L A;  5A5R A;  3P5O A;  4QSV A;  4ZC9 A;  4XYA A;  1JM4 B;  4N4F A;  4YY4 A;  5FB1 A;  5CGP A;  4UIV A;  4HXO A;  4QEW A;  2FSA A;  4NR9 A;  3AAD A;  4XY8 A;  5F5Z A;  3I3J A;  3LQJ A;  2OUO A;  4HXP A;  4QSS A;  4UIU A;  5IGN A;  3JVJ A;  5D3N A;  4Z1S A;  4QC3 A;  5KTW A;  4UIW A;  2L85 A;  5IGM A;  4CUU A;  4LYS A;  5KHM A;  5C87 A;  4YAT A;  5EGU A;  3UVY A;  2OO1 A;  4UIX A;  3SVG A;  5D3L A;  5DFB A;  4BHW A;  4A9I A;  5FE8 A;  4A9F A;  4C66 A;  5EP7 A;  2YQD A;  4QB3 A;  2E7N A;  2H60 A;  4TT6 A;  5DY7 A;  4A9J A;  4NR7 A;  4J0R A;  1EQF A;  5FE4 A;  5I86 A;  5I89 A;  2E7O A;  5LVR A;  2G4A A;  5E9Y A;  4J3I A;  4MEO A;  4NR8 A;  4NR6 A;  5EM3 A;  5A82 A;  4LC2 A;  4MEP A;  4O72 A;  4CUR A;  5ENE A;  5H1T A;  4TTE A;  5EPB A;  5FB0 A;  5DYX A;  4WIV A;  5F1H A;  4J0S A;  4IR5 A;  5KU3 A;  5F63 A;  5EA1 A;  4YBM A;  1JSP B;  3MQM A;  5L98 A;  4LZ2 A;  3HMF A;  4KV1 A;  5F36 A;  5FE5 A;  4NRA A;  4QYL A;  5D7X A;  5HFQ A;  4QUU A;  4QSX A;  4YYD A;  5IBN A;  5HFR A;  3UW9 A;  3LJW A;  4DON A;  5EIS A;  3U5M A;  4OGJ A;  4CUT A;  4QYD A;  2DVV A;  3ZYU A;  5F3A A;  4N4G A;  4QY4 A;  5DFD A;  4A9L A;  4HBW A;  3K2J A;  4ALG A;  3MXF A;  2RNX A;  4O7B A;  4HXN A;  5DLX A;  5LKZ A;  5L97 A;  2MJV B;  2RI7 A;  3QZV A;  5F25 A;  2R0V A;  3U5L A;  2E3K A;  3P1E A;  3GG3 A;  2L84 A;  5I7X A;  3TLP A;  5JWM A;  5D24 A;  4LYW A;  5DKH A;  3O33 A;  2OSS A;  5DW2 A;  4WHU A;  4KCX A;  5LJ2 A;  3UV2 A;  4Z93 A;  5DYC A;  5D25 A;  4Z6I A;  4QZS A;  4MR6 A;  2N9G A;  4BW1 A;  4PS5 A;  4X2I A;  4YBS A;  5ENJ A;  5CQ6 A;  4Z6H A;  4NYV A;  4PY6 A;  4TZ8 A;  5D3J A;  5HCL A;  5CUB A;  5TCM A;  5DW1 A;  4KV4 A;  4HXL A;  5CU8 A;  4HBY A;  4TT2 A;  5I83 A;  5FFV A;  2YYN A;  3O36 A;  4A9K A;  2D82 A;  3IU6 A;  4NQN A;  3LXJ A;  5A5O A;  5II1 A;  5LUU A;  3SVH A;  3MUL A;  2R0S A;  4Q0O A;  4TYL A;  5FE6 A;  4OGI A;  5H85 A;  2R0Y A;  5CUC A;  5F61 A;  4PCE A;  3O35 A;  5CUA A;  5E7D A;  4F3I A;  5HQ5 A;  4HXR A;  5DFC A;  3ONI A;  4QEU A;  5E9K A;  4CUP A;  4CFL A;  4IOO A;  4TS8 A;  5G4R A;  5FBX A;  5CPE A;  5BT3 A;  5ENG A;  1ZS5 A;  4O76 A;  4HXS A;  5CRM A;  5A7C A;  1WUG A;  2F6N A;  3S92 A;  4O78 A;  5DKD A;  5DLZ A;  4YYK A;  4BW2 A;  5L8U A;  5F62 A;  4MR4 A;  5E3G A;  5I88 A;  5CZG A;  4IOR A;  3QZT A;  5LVQ A;  4QSP A;  2RO1 A;  5JI8 A;  2LSP B;  2WP1 A;  4NR5 A;  5LKU A;  4FLP A;  4NYW A;  5EWC A;  3HME A;  5EI4 A;  3UVD A;  5D26 A;  5E9L A;  4TZ2 A;  4Z1Q A;  5A5S A;  4NS5 A;  4TT4 A;  5CUE A;  3HMH A;  3UV5 A;  2DAT A;  5IGL A;  5A83 A;  4N4H A;  4QR4 A;  4O7A A;  5HEM A;  4BW3 A;  5FDZ A;  3DAI A;  3P1C A;  4ZQL A;  5ENI A;  4A9N A;  5FH6 A;  4Y03 A;  5I1Q A;  4QSU A;  5EVA A;  3U5O A;  4NYX A;  3FKM X;  2YEL A;  3O37 A;  4NRC A;  5E9M A;  3LQI A;  4YC9 A;  5EIC A;  5CQ5 A;  4A9O A;  5C89 A;  5CQ7 A;  5A5N A;  3UVX A;  4MR3 A;  5FH7 A;  2RNW A;  4YYN A;  5D3S A;  4QEV A;  4GPJ A;  4WHW A;  5ENF A;  4BJX A;  2RFJ A;  3U5N A;  5HJC A;  5D3R A;  4YAD A;  5EWD A;  4A9H A;  4QBM A;  5C4Q A;  5HRW A;  5C7N A;  4YH4 A;  4NQM A;  5HQ7 A;  5C8G A;  4YBT A;  4TU4 A;  5TB6 A;  5I29 A;  4PKL A;  3P1F A;  4J1P A;  4IR6 A;  4LZR A;  4NR4 A;  4O7F A;  4QSR A;  5CRZ A;  4Q0N A;  5IGK A;  2L5E A;  4XUB A;  5EWV A;  3U5K A;  2KTB B;  5H1V A;  3QZS A;  2NXB A;  5EU1 A;  2DVS A;  3Q2F A;  5DYA A;  5C85 A;  5FE9 A;  4YYG A;  1N72 A;  4AKN A;  4O7E A;  5ENB A;  3JVM A;  3AQA A;  4NUC A; 
#chains in the Genus database with same CATH topology
 4QNS A;  3MUK A;  4UIZ A;  5CTL A;  5ENH A;  4NUE A;  5IID A;  5L8T A;  2DVQ A;  2RNY A;  1X0J A;  4ALH A;  4YAX A;  5D3H A;  2YDW A;  5HRV A;  4LRG A;  5FE0 A;  4LYI A;  5I40 A;  3IU5 A;  3SVF A;  5IG6 A;  3JVL A;  5J0D A;  4ZW1 A;  4A9M A;  4OUF A;  5I80 A;  4YYH A;  4HXM A;  4QR3 A;  4CUQ A;  5CFW A;  2DKW A;  4UYH A;  1PUO A;  5FG5 A;  4TU6 A;  3ERR A;  5A85 A;  5CUG A;  4CFK A;  3S91 A;  5LKX A;  5KO4 A;  5CQA A;  5FE3 A;  3VKG A;  4E96 A;  5F2P A;  4CL9 A;  5KTX A;  2R10 A;  4UYG A;  5E3D A;  5I7Y A;  3RCW A;  3D7C A;  4BW4 A;  2WP2 A;  5BT4 A;  2F6J A;  3MB4 A;  5DYU A;  4O74 A;  3UV4 A;  1WUM A;  5CQ8 A;  5L99 A;  4XY9 A;  5ACY A;  1E6I A;  5CQT A;  3U5J A;  3U5P A;  4YK0 A;  3NXB A;  4PCI A;  5FE1 A;  4YY6 A;  5D0C A;  2RS9 B;  2YW5 A;  4LR6 A;  4QC1 A;  2I7K A;  5DBM A;  3LQH A;  4MR5 A;  4O70 A;  5FE2 A;  5E9V A;  4AKG A;  5EV9 A;  5EPR A;  5EWH A;  5D3T A;  5HQ6 A;  5AD2 A;  5EPS A;  4O71 A;  4YAB A;  4O77 A;  3O34 A;  3UVW A;  5H1U A;  2GRC A;  5HEN A;  5FFW A;  5A5Q A;  4UIY A;  5AME A;  4UIT A;  5LJ0 A;  5LJ1 A;  4NXJ A;  5BT5 A;  5L96 A;  2YEK A;  5CQ3 A;  5K29 A;  5KTU A;  4CUS A;  4YYI A;  4UYF A;  3VKH A;  5HRX A;  5AMF A;  5ETB A;  3DWY A;  4A9E A;  4UYD A;  5LKT A;  5E0R A;  5COI A;  5HLS A;  2YEM A;  5ENC A;  4MEQ A;  4LDF A;  4O75 A;  4XUA A;  5ETD A;  5E74 A;  5A81 A;  4N4I A;  2I8N A;  4UYF B;  4TQN A;  4PTB A;  4QUT A;  4RVR A;  3MB3 A;  3P1D A;  5DX4 A;  5EK9 A;  5EWW A;  3Q2E A;  5FH8 A;  4NRB A;  4QST A;  4C67 A;  5EQ1 A;  4IR4 A;  4IOQ A;  5FFY A;  4LZS A;  4MEN A;  4YYJ A;  5HEL A;  4N3W A;  2DVR A;  5AD3 A;  2EJN A;  4O7C A;  5HM0 A;  5CP5 A;  2DWW A;  5E73 A;  5F1L A;  5FG6 A;  5CY9 A;  1F68 A;  5II2 A;  4YYM A;  4QSQ A;  5CUD A;  5DKC A;  5E9I A;  4HBV A;  4HBX A;  5A5P A;  4YH3 A;  5G4S A;  5FE7 A;  5CQ4 A;  4IR3 A;  4CLB A;  2D9E A;  4UYE A;  5FG4 A;  4HXK A;  3G0J A;  5D3P A;  5CS8 A;  4QSW A;  4QR5 A;  4NUD A;  3JVK A;  5F60 A;  3G0L A;  5A5R A;  3P5O A;  4QSV A;  4ZC9 A;  4XYA A;  1JM4 B;  4N4F A;  4YY4 A;  5FB1 A;  1ZKR A;  5CGP A;  4UIV A;  4HXO A;  4QEW A;  2FSA A;  4NR9 A;  4AKI A;  3AAD A;  4XY8 A;  5F5Z A;  3I3J A;  3LQJ A;  2OUO A;  4HXP A;  4QSS A;  4UIU A;  5IGN A;  3JVJ A;  5D3N A;  4Z1S A;  4AKH A;  4QC3 A;  5KTW A;  4UIW A;  2L85 A;  5IGM A;  4CUU A;  4LYS A;  5KHM A;  5C87 A;  4YAT A;  5EGU A;  3UVY A;  2OO1 A;  4UIX A;  3SVG A;  5D3L A;  5DFB A;  4BHW A;  4A9I A;  5FE8 A;  4A9F A;  4C66 A;  5EP7 A;  2YQD A;  4QB3 A;  2E7N A;  2H60 A;  4TT6 A;  5DY7 A;  4A9J A;  4NR7 A;  4J0R A;  1EQF A;  5FE4 A;  5I86 A;  5I89 A;  2E7O A;  5LVR A;  2G4A A;  5E9Y A;  4J3I A;  4MEO A;  4NR8 A;  4NR6 A;  5EM3 A;  5A82 A;  4LC2 A;  4MEP A;  4O72 A;  4CUR A;  5ENE A;  5H1T A;  4TTE A;  5EPB A;  5FB0 A;  5DYX A;  4WIV A;  5F1H A;  4J0S A;  4IR5 A;  5KU3 A;  5F63 A;  5EA1 A;  4YBM A;  1JSP B;  3MQM A;  5L98 A;  4LZ2 A;  4AI6 A;  3HMF A;  4KV1 A;  5F36 A;  5FE5 A;  4NRA A;  4QYL A;  5D7X A;  5HFQ A;  4QUU A;  4QSX A;  4YYD A;  5IBN A;  5HFR A;  3UW9 A;  3LJW A;  4DON A;  5EIS A;  3U5M A;  4OGJ A;  4CUT A;  4QYD A;  2DVV A;  3ZYU A;  5F3A A;  4N4G A;  4QY4 A;  5DFD A;  4A9L A;  4HBW A;  3K2J A;  3D1B A;  4ALG A;  3MXF A;  2RNX A;  4O7B A;  4HXN A;  5DLX A;  5LKZ A;  5L97 A;  2MJV B;  2RI7 A;  3QZV A;  5F25 A;  2R0V A;  3U5L A;  2E3K A;  3P1E A;  3GG3 A;  2L84 A;  5I7X A;  3TLP A;  5JWM A;  5D24 A;  4LYW A;  5DKH A;  3O33 A;  2OSS A;  5DW2 A;  4WHU A;  4KCX A;  5LJ2 A;  3UV2 A;  4Z93 A;  5DYC A;  5D25 A;  4Z6I A;  4QZS A;  4MR6 A;  2N9G A;  4BW1 A;  4PS5 A;  4X2I A;  4YBS A;  5ENJ A;  5CQ6 A;  4Z6H A;  4NYV A;  4PY6 A;  4TZ8 A;  5D3J A;  5HCL A;  5CUB A;  5TCM A;  5DW1 A;  4KV4 A;  4HXL A;  5CU8 A;  4HBY A;  4TT2 A;  5I83 A;  5FFV A;  2YYN A;  3O36 A;  4A9K A;  2D82 A;  3IU6 A;  4NQN A;  3LXJ A;  5A5O A;  5II1 A;  5LUU A;  3SVH A;  3MUL A;  2R0S A;  4Q0O A;  4TYL A;  5FE6 A;  4OGI A;  5H85 A;  2R0Y A;  5CUC A;  5F61 A;  4PCE A;  3O35 A;  5CUA A;  5E7D A;  4F3I A;  5HQ5 A;  4HXR A;  5DFC A;  3ONI A;  4QEU A;  5E9K A;  4CUP A;  4CFL A;  4IOO A;  4TS8 A;  5G4R A;  5FBX A;  5CPE A;  5BT3 A;  5ENG A;  1ZS5 A;  4O76 A;  4HXS A;  5CRM A;  5A7C A;  1WUG A;  2F6N A;  3S92 A;  4O78 A;  5DKD A;  5DLZ A;  4YYK A;  4BW2 A;  5L8U A;  5F62 A;  4MR4 A;  5E3G A;  5I88 A;  5CZG A;  3D1D A;  4IOR A;  3QZT A;  5LVQ A;  4QSP A;  2RO1 A;  5JI8 A;  2LSP B;  2WP1 A;  4NR5 A;  5LKU A;  4FLP A;  4NYW A;  5EWC A;  3HME A;  5EI4 A;  3UVD A;  5D26 A;  5E9L A;  4TZ2 A;  4Z1Q A;  5A5S A;  4NS5 A;  4TT4 A;  5CUE A;  3HMH A;  3UV5 A;  2DAT A;  5IGL A;  5A83 A;  4N4H A;  4QR4 A;  4O7A A;  5HEM A;  4BW3 A;  5FDZ A;  3DAI A;  3P1C A;  4ZQL A;  5ENI A;  4A9N A;  5FH6 A;  4Y03 A;  5I1Q A;  4QSU A;  5EVA A;  3U5O A;  4NYX A;  3FKM X;  2YEL A;  3O37 A;  4NRC A;  5E9M A;  3LQI A;  4YC9 A;  5EIC A;  5CQ5 A;  4A9O A;  5C89 A;  5CQ7 A;  5A5N A;  3UVX A;  4MR3 A;  5FH7 A;  2RNW A;  4YYN A;  5D3S A;  4QEV A;  4GPJ A;  4WHW A;  5ENF A;  4BJX A;  2RFJ A;  3U5N A;  5HJC A;  5D3R A;  4YAD A;  5EWD A;  4A9H A;  4QBM A;  5C4Q A;  5HRW A;  5C7N A;  4YH4 A;  4NQM A;  5HQ7 A;  5C8G A;  4YBT A;  4TU4 A;  5TB6 A;  5I29 A;  4PKL A;  3P1F A;  4J1P A;  4IR6 A;  4LZR A;  4NR4 A;  4O7F A;  4QSR A;  5CRZ A;  4Q0N A;  5IGK A;  2L5E A;  4XUB A;  5EWV A;  3U5K A;  2KTB B;  5H1V A;  3QZS A;  2NXB A;  5EU1 A;  2DVS A;  3Q2F A;  5DYA A;  5C85 A;  5FE9 A;  4YYG A;  1N72 A;  4AKN A;  4O7E A;  5ENB A;  3JVM A;  3AQA A;  4NUC A; 
#chains in the Genus database with same CATH homology
 4QNS A;  3MUK A;  4UIZ A;  5CTL A;  5ENH A;  4NUE A;  5IID A;  5L8T A;  2DVQ A;  2RNY A;  1X0J A;  4ALH A;  4YAX A;  5D3H A;  2YDW A;  5HRV A;  4LRG A;  5FE0 A;  4LYI A;  5I40 A;  3IU5 A;  3SVF A;  5IG6 A;  3JVL A;  5J0D A;  4ZW1 A;  4A9M A;  4OUF A;  5I80 A;  4YYH A;  4HXM A;  4QR3 A;  4CUQ A;  5CFW A;  2DKW A;  4UYH A;  5FG5 A;  4TU6 A;  5A85 A;  5CUG A;  4CFK A;  3S91 A;  5LKX A;  5KO4 A;  5CQA A;  5FE3 A;  4E96 A;  5F2P A;  4CL9 A;  5KTX A;  2R10 A;  4UYG A;  5E3D A;  5I7Y A;  3RCW A;  3D7C A;  4BW4 A;  2WP2 A;  5BT4 A;  2F6J A;  3MB4 A;  5DYU A;  4O74 A;  3UV4 A;  1WUM A;  5CQ8 A;  5L99 A;  4XY9 A;  5ACY A;  1E6I A;  5CQT A;  3U5J A;  3U5P A;  4YK0 A;  3NXB A;  4PCI A;  5FE1 A;  4YY6 A;  5D0C A;  2RS9 B;  2YW5 A;  4LR6 A;  4QC1 A;  2I7K A;  5DBM A;  3LQH A;  4MR5 A;  4O70 A;  5FE2 A;  5E9V A;  5EV9 A;  5EPR A;  5EWH A;  5D3T A;  5HQ6 A;  5AD2 A;  5EPS A;  4O71 A;  4YAB A;  4O77 A;  3O34 A;  3UVW A;  5H1U A;  2GRC A;  5HEN A;  5FFW A;  5A5Q A;  4UIY A;  5AME A;  4UIT A;  5LJ0 A;  5LJ1 A;  4NXJ A;  5BT5 A;  5L96 A;  2YEK A;  5CQ3 A;  5K29 A;  5KTU A;  4CUS A;  4YYI A;  4UYF A;  5HRX A;  5AMF A;  5ETB A;  3DWY A;  4A9E A;  4UYD A;  5LKT A;  5E0R A;  5COI A;  5HLS A;  2YEM A;  5ENC A;  4MEQ A;  4LDF A;  4O75 A;  4XUA A;  5ETD A;  5E74 A;  5A81 A;  4N4I A;  2I8N A;  4UYF B;  4TQN A;  4PTB A;  4QUT A;  4RVR A;  3MB3 A;  3P1D A;  5DX4 A;  5EK9 A;  5EWW A;  3Q2E A;  5FH8 A;  4NRB A;  4QST A;  4C67 A;  5EQ1 A;  4IR4 A;  4IOQ A;  5FFY A;  4LZS A;  4MEN A;  4YYJ A;  5HEL A;  4N3W A;  2DVR A;  5AD3 A;  4O7C A;  5HM0 A;  5CP5 A;  2DWW A;  5E73 A;  5F1L A;  5FG6 A;  5CY9 A;  1F68 A;  5II2 A;  4YYM A;  4QSQ A;  5CUD A;  5DKC A;  5E9I A;  4HBV A;  4HBX A;  5A5P A;  4YH3 A;  5G4S A;  5FE7 A;  5CQ4 A;  4IR3 A;  4CLB A;  2D9E A;  4UYE A;  5FG4 A;  4HXK A;  3G0J A;  5D3P A;  5CS8 A;  4QSW A;  4QR5 A;  4NUD A;  3JVK A;  5F60 A;  3G0L A;  5A5R A;  3P5O A;  4QSV A;  4ZC9 A;  4XYA A;  1JM4 B;  4N4F A;  4YY4 A;  5FB1 A;  5CGP A;  4UIV A;  4HXO A;  4QEW A;  2FSA A;  4NR9 A;  3AAD A;  4XY8 A;  5F5Z A;  3I3J A;  3LQJ A;  2OUO A;  4HXP A;  4QSS A;  4UIU A;  5IGN A;  3JVJ A;  5D3N A;  4Z1S A;  4QC3 A;  5KTW A;  4UIW A;  2L85 A;  5IGM A;  4CUU A;  4LYS A;  5KHM A;  5C87 A;  4YAT A;  5EGU A;  3UVY A;  2OO1 A;  4UIX A;  3SVG A;  5D3L A;  5DFB A;  4BHW A;  4A9I A;  5FE8 A;  4A9F A;  4C66 A;  5EP7 A;  2YQD A;  4QB3 A;  2E7N A;  2H60 A;  4TT6 A;  5DY7 A;  4A9J A;  4NR7 A;  4J0R A;  1EQF A;  5FE4 A;  5I86 A;  5I89 A;  2E7O A;  5LVR A;  2G4A A;  5E9Y A;  4J3I A;  4MEO A;  4NR8 A;  4NR6 A;  5EM3 A;  5A82 A;  4LC2 A;  4MEP A;  4O72 A;  4CUR A;  5ENE A;  5H1T A;  4TTE A;  5EPB A;  5FB0 A;  5DYX A;  4WIV A;  5F1H A;  4J0S A;  4IR5 A;  5KU3 A;  5F63 A;  5EA1 A;  4YBM A;  1JSP B;  3MQM A;  5L98 A;  4LZ2 A;  3HMF A;  4KV1 A;  5F36 A;  5FE5 A;  4NRA A;  4QYL A;  5D7X A;  5HFQ A;  4QUU A;  4QSX A;  4YYD A;  5IBN A;  5HFR A;  3UW9 A;  3LJW A;  4DON A;  5EIS A;  3U5M A;  4OGJ A;  4CUT A;  4QYD A;  2DVV A;  3ZYU A;  5F3A A;  4N4G A;  4QY4 A;  5DFD A;  4A9L A;  4HBW A;  3K2J A;  4ALG A;  3MXF A;  2RNX A;  4O7B A;  4HXN A;  5DLX A;  5LKZ A;  5L97 A;  2MJV B;  2RI7 A;  3QZV A;  5F25 A;  2R0V A;  3U5L A;  2E3K A;  3P1E A;  3GG3 A;  2L84 A;  5I7X A;  3TLP A;  5JWM A;  5D24 A;  4LYW A;  5DKH A;  3O33 A;  2OSS A;  5DW2 A;  4WHU A;  4KCX A;  5LJ2 A;  3UV2 A;  4Z93 A;  5DYC A;  5D25 A;  4Z6I A;  4QZS A;  4MR6 A;  2N9G A;  4BW1 A;  4PS5 A;  4X2I A;  4YBS A;  5ENJ A;  5CQ6 A;  4Z6H A;  4NYV A;  4PY6 A;  4TZ8 A;  5D3J A;  5HCL A;  5CUB A;  5TCM A;  5DW1 A;  4KV4 A;  4HXL A;  5CU8 A;  4HBY A;  4TT2 A;  5I83 A;  5FFV A;  2YYN A;  3O36 A;  4A9K A;  2D82 A;  3IU6 A;  4NQN A;  3LXJ A;  5A5O A;  5II1 A;  5LUU A;  3SVH A;  3MUL A;  2R0S A;  4Q0O A;  4TYL A;  5FE6 A;  4OGI A;  5H85 A;  2R0Y A;  5CUC A;  5F61 A;  4PCE A;  3O35 A;  5CUA A;  5E7D A;  4F3I A;  5HQ5 A;  4HXR A;  5DFC A;  3ONI A;  4QEU A;  5E9K A;  4CUP A;  4CFL A;  4IOO A;  4TS8 A;  5G4R A;  5FBX A;  5CPE A;  5BT3 A;  5ENG A;  1ZS5 A;  4O76 A;  4HXS A;  5CRM A;  5A7C A;  1WUG A;  2F6N A;  3S92 A;  4O78 A;  5DKD A;  5DLZ A;  4YYK A;  4BW2 A;  5L8U A;  5F62 A;  4MR4 A;  5E3G A;  5I88 A;  5CZG A;  4IOR A;  3QZT A;  5LVQ A;  4QSP A;  2RO1 A;  5JI8 A;  2LSP B;  2WP1 A;  4NR5 A;  5LKU A;  4FLP A;  4NYW A;  5EWC A;  3HME A;  5EI4 A;  3UVD A;  5D26 A;  5E9L A;  4TZ2 A;  4Z1Q A;  5A5S A;  4NS5 A;  4TT4 A;  5CUE A;  3HMH A;  3UV5 A;  2DAT A;  5IGL A;  5A83 A;  4N4H A;  4QR4 A;  4O7A A;  5HEM A;  4BW3 A;  5FDZ A;  3DAI A;  3P1C A;  4ZQL A;  5ENI A;  4A9N A;  5FH6 A;  4Y03 A;  5I1Q A;  4QSU A;  5EVA A;  3U5O A;  4NYX A;  3FKM X;  2YEL A;  3O37 A;  4NRC A;  5E9M A;  3LQI A;  4YC9 A;  5EIC A;  5CQ5 A;  4A9O A;  5C89 A;  5CQ7 A;  5A5N A;  3UVX A;  4MR3 A;  5FH7 A;  2RNW A;  4YYN A;  5D3S A;  4QEV A;  4GPJ A;  4WHW A;  5ENF A;  4BJX A;  2RFJ A;  3U5N A;  5HJC A;  5D3R A;  4YAD A;  5EWD A;  4A9H A;  4QBM A;  5C4Q A;  5HRW A;  5C7N A;  4YH4 A;  4NQM A;  5HQ7 A;  5C8G A;  4YBT A;  4TU4 A;  5TB6 A;  5I29 A;  4PKL A;  3P1F A;  4J1P A;  4IR6 A;  4LZR A;  4NR4 A;  4O7F A;  4QSR A;  5CRZ A;  4Q0N A;  5IGK A;  2L5E A;  4XUB A;  5EWV A;  3U5K A;  2KTB B;  5H1V A;  3QZS A;  2NXB A;  5EU1 A;  2DVS A;  3Q2F A;  5DYA A;  5C85 A;  5FE9 A;  4YYG A;  1N72 A;  4AKN A;  4O7E A;  5ENB A;  3JVM A;  3AQA A;  4NUC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...