5A5PA

Crystal structure of human atad2 bromodomain in complex with 8-2-(dimethylamino)ethylamino-3-methyl-1,2-dihydroquinolin-2-one
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
130
structure length
130
Chain Sequence
SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICSNALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ATPASE FAMILY AAA DOMAIN-CONTAINING PROTEIN 2
publication title Fragment-Based Discovery of Low-Micromolar Atad2 Bromodomain Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 52
structure length 130
sequence length 130
ec nomenclature ec 3.6.1.3: Adenosinetriphosphatase.
pdb deposition date 2015-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5a5pA00
4ZW1A 4NRBA 4QSUA 4PTBA 4HBXA 5FFYA 2R0YA 4NR9A 5A5PA 4WIVA 2MJVB 5G4SA 4MEOA 5EWWA 5FB1A 4BW3A 5DFBA 3UV2A 4C66A 4NR7A 4QSVA 5HM0A 4BW4A 5FE1A 4Z93A 5D3JA 3U5JA 5CUAA 4QC3A 4A9HA 4IOQA 2L5EA 3UW9A 5FFVA 5DW1A 5AMFA 4Q0OA 5HELA 3G0LA 5C8GA 4TYLA 5DKHA 4ZC9A 3UVDA 2H60A 4O7FA 5ENIA 5L99A 2NXBA 4UYHA 5FE8A 3U5LA 4PY6A 4LZ2A 4QNSA 5I7YA 4MR4A 4NYXA 5CQ3A 4YBSA 4PS5A 5BT3A 5CRZA 5D3TA 4TZ2A 2RFJA 5FE3A 5L8UA 4J0RA 5LJ1A 3QZVA 5HRVA 4A9KA 4LYWA 4TU6A 5CTLA 2OSSA 4N4IA 2DVVA 5CUDA 4HXKA 4IR5A 5EISA 5HQ5A 2E3KA 4O7BA 5KO4A 5F62A 2OO1A 3MQMA 5CQ4A 2RNXA 2D9EA 4YYNA 5D3HA 4NRCA 5HFQA 3JVLA 4UYFB 5F2PA 3TLPA 4Z1QA 4LR6A 5CQ6A 5D26A 5AD2A 5FE0A 5DKDA 5ENJA 5EWHA 4QSPA 5CRMA 5FDZA 4QSTA 2WP1A 5E73A 5EPBA 4NUCA 4YBTA 5EVAA 2E7NA 5KHMA 5HQ7A 4IR3A 3U5MA 4E96A 4NR4A 4NR5A 4X2IA 5F1LA 4NUEA 4HXRA 2GRCA 4O78A 4BW2A 5D3SA 5A83A 5F25A 4BW1A 1JM4B 1ZS5A 4KV1A 4YY6A 4O72A 4Z6IA 5CUCA 5A5SA 5HQ6A 4OUFA 4QSRA 1JSPB 3HMEA 2YQDA 2FSAA 5IBNA 4HXOA 4HXMA 3UV5A 4YATA 4QC1A 5BT4A 4TS8A 3UVYA 3MXFA 4CUQA 3MUKA 4TT6A 5L96A 5F36A 3LQHA 4NYWA 5CQTA 4PCEA 5D7XA 5CGPA 5TB6A 5ENBA 4NR6A 2YELA 5E9VA 4IORA 5A85A 4YYKA 5CQ7A 4O74A 2R10A 5EM3A 4LZSA 5DYAA 4MEPA 5A5RA 5LKZA 3IU6A 3AQAA 4QSQA 5II2A 4CUTA 4YADA 5LKTA 4UIWA 5COIA 4QSSA 5E9IA 3I3JA 5FH8A 5IGMA 4YYMA 5EA1A 3G0JA 4QR3A 1EQFA 3LJWA 4N4FA 5C7NA 5ENEA 5E9LA 4CLBA 5I7XA 4ALGA 4O7AA 4XYAA 5EWCA 5A81A 3D7CA 4AKNA 5HFRA 5JI8A 5I80A 4YBMA 4PKLA 4YAXA 3QZSA 5HENA 3Q2EA 2YEKA 4GPJA 5K29A 4TT4A 4QYLA 5E3DA 4QR4A 4LRGA 5C85A 5E7DA 3JVJA 5EPRA 4NXJA 5F61A 4NYVA 4A9FA 5E0RA 5CQ8A 3U5KA 2LSPB 5I29A 5ETBA 2YYNA 3NXBA 5C87A 4OGJA 2RO1A 4NQNA 5D0CA 5CS8A 3LQJA 4HBYA 5L98A 5ENCA 3P1EA 5CP5A 4CUSA 3LQIA 4IR4A 4A9NA 4XUBA 4QSXA 5I86A 3SVHA 5FE9A 4TT2A 4MR6A 4IR6A 3IU5A 4UYEA 4QEUA 4XY8A 4TU4A 5F1HA 4O7EA 4QEVA 2DVQA 4J3IA 4FLPA 5IGLA 5D25A 2L85A 5L8TA 5D3NA 5HEMA 5KTXA 4Z6HA 5EGUA 2I8NA 5KU3A 4Q0NA 3ZYUA 4YYHA 2YW5A 5DW2A 3P1FA 4UITA 4QEWA 4YABA 4QZSA 5FE7A 5DYXA 4WHUA 5EQ1A 3HMHA 5ETDA 4YYGA 5JWMA 4N4HA 5F3AA 4UIUA 5CQAA 3DWYA 5FBXA 5TCMA 5LKUA 5EP7A 4O70A 3O35A 5ENGA 4HXLA 2RS9B 2N9GA 5D3PA 5A7CA 4UIVA 4QSWA 5LKXA 4QUTA 5FB0A 3JVMA 5DYCA 2DVSA 5E9MA 5FH7A 4O75A 3UVWA 3RCWA 4QYDA 4CFKA 5CUEA 4N3WA 5EPSA 5H1UA 4QY4A 4CURA 3MB3A 4J1PA 5H1TA 2R0SA 4UIZA 5KTUA 5I40A 4QBMA 5CQ5A 4KCXA 4CUPA 5LJ2A 4IOOA 4A9OA 3SVFA 3P5OA 2OUOA 2D82A 4A9IA 5LUUA 2DWWA 3O33A 4XY9A 3HMFA 4NUDA 4F3IA 3FKMX 4UIYA 1X0JA 3S92A 4UYDA 4WHWA 4TQNA 5E74A 5EU1A 4A9EA 5EICA 4CL9A 3SVGA 5F60A 5FG5A 5G4RA 4BHWA 5CFWA 5DX4A 4YK0A 4YC9A 5DFDA 5FFWA 1WUGA 5D24A 2G4AA 5FE2A 1E6IA 5IGKA 4O7CA 2DATA 5EI4A 4O77A 5II1A 4LZRA 4C67A 4PCIA 4UYFA 2RI7A 5EWDA 5HCLA 4MR5A 2L84A 4A9LA 4XUAA 5DFCA 5DYUA 5EK9A 5KTWA 3U5NA 5I89A 2KTBB 3P1DA 3QZTA 5ENHA 4LYIA 3MULA 5I88A 5E9YA 4KV4A 4A9MA 3Q2FA 2WP2A 4J0SA 3P1CA 4ZQLA 5FE6A 3S91A 2YEMA 4QB3A 3ONIA 1N72A 5C4QA 4YY4A 5ACYA 4NQMA 4YH3A 5F5ZA 5AMEA 5HJCA 4NS5A 5DBMA 5H1VA 2F6JA 5HRWA 4YYDA 5FE5A 2R0VA 5HRXA 5CU8A 4OGIA 5J0DA 3LXJA 5E3GA 3AADA 4LDFA 4CFLA 3O36A 4HBWA 4MR3A 3UVXA 4DONA 4UYGA 4MENA 4NR8A 3K2JA 4O71A 4LYSA 5HLSA 4CUUA 2RNYA 4ALHA 4Z1SA 5DLZA 5AD3A 4HXNA 5IG6A 4O76A 5ENFA 3UV4A 2F6NA 1WUMA 2DVRA 4NRAA 2DKWA 5L97A 4UIXA 5I83A 5CPEA 4YYJA 4YH4A 5FG6A 3U5OA 2E7OA 5CY9A 4HXSA 5FH6A 1F68A 2YDWA 5EV9A 5DY7A 5DKCA 5DLXA 5F63A 5FE4A 5FG4A 4MEQA 3MB4A 5CZGA 4Y03A 5EWVA 5BT5A 3DAIA 3GG3A 5H85A 5A5OA 5C89A 5A5NA 5D3RA 4QUUA 5LVRA 2I7KA 4HXPA 3JVKA 2RNWA 4RVRA 3O37A 4YYIA 4A9JA 4BJXA 5IIDA 4QR5A 5A82A 4N4GA 5A5QA 5LVQA 4LC2A 5E9KA 5CUGA 3U5PA 5IGNA 4HBVA 5CUBA 5D3LA 4TTEA 5LJ0A 3O34A 4TZ8A 5I1QA
chains in the Genus database with same CATH superfamily
4ZW1A 4NRBA 4QSUA 4PTBA 4HBXA 5FFYA 2R0YA 4NR9A 5A5PA 4WIVA 2MJVB 5G4SA 4MEOA 5EWWA 5FB1A 4BW3A 5DFBA 3UV2A 4C66A 4NR7A 4QSVA 5HM0A 4BW4A 5FE1A 4Z93A 5D3JA 3U5JA 5CUAA 4QC3A 4A9HA 4IOQA 2L5EA 3UW9A 5FFVA 5DW1A 5AMFA 4Q0OA 5HELA 3G0LA 5C8GA 4TYLA 5DKHA 4ZC9A 3UVDA 2H60A 4O7FA 5ENIA 5L99A 2NXBA 4UYHA 5FE8A 3U5LA 4PY6A 4LZ2A 4QNSA 4AKHA 5I7YA 4MR4A 4NYXA 5CQ3A 4YBSA 4PS5A 5BT3A 5CRZA 5D3TA 4TZ2A 2RFJA 5FE3A 5L8UA 4J0RA 5LJ1A 3QZVA 5HRVA 4A9KA 4LYWA 4TU6A 5CTLA 2OSSA 4N4IA 2DVVA 5CUDA 4HXKA 4IR5A 5EISA 5HQ5A 2E3KA 4O7BA 5KO4A 5F62A 2OO1A 3MQMA 3VKHA 5CQ4A 2RNXA 2D9EA 4YYNA 5D3HA 4NRCA 5HFQA 3JVLA 4UYFB 5F2PA 3TLPA 4Z1QA 4LR6A 5CQ6A 5D26A 5AD2A 5FE0A 5DKDA 5ENJA 5EWHA 4QSPA 5CRMA 5FDZA 4QSTA 2WP1A 5E73A 5EPBA 4NUCA 4YBTA 4AKGA 5EVAA 2E7NA 5KHMA 5HQ7A 4IR3A 3U5MA 4E96A 4NR4A 4NR5A 4X2IA 5F1LA 4NUEA 4HXRA 2GRCA 4O78A 4BW2A 5D3SA 5A83A 5F25A 4BW1A 1JM4B 1ZS5A 4KV1A 4YY6A 4O72A 4Z6IA 5CUCA 5A5SA 5HQ6A 4OUFA 4QSRA 1JSPB 4AKIA 3HMEA 2YQDA 2FSAA 5IBNA 4HXOA 4HXMA 3UV5A 4YATA 4QC1A 5BT4A 4TS8A 3UVYA 3MXFA 4CUQA 3MUKA 4TT6A 5L96A 5F36A 3LQHA 4NYWA 5CQTA 4PCEA 5D7XA 5CGPA 5TB6A 5ENBA 4NR6A 2YELA 5E9VA 4IORA 5A85A 4YYKA 5CQ7A 4O74A 2R10A 5EM3A 4LZSA 5DYAA 4MEPA 5A5RA 5LKZA 3IU6A 3AQAA 4QSQA 5II2A 4CUTA 4YADA 5LKTA 4UIWA 5COIA 4QSSA 5E9IA 3I3JA 5FH8A 5IGMA 4YYMA 5EA1A 3G0JA 4QR3A 1EQFA 3LJWA 4N4FA 5C7NA 5ENEA 5E9LA 4CLBA 5I7XA 4ALGA 4O7AA 4XYAA 5EWCA 5A81A 3D7CA 4AKNA 5HFRA 5JI8A 5I80A 4YBMA 4PKLA 4YAXA 3QZSA 5HENA 3Q2EA 2YEKA 4GPJA 5K29A 4TT4A 4QYLA 1PUOA 4QR4A 5E3DA 4LRGA 5C85A 5E7DA 3JVJA 5EPRA 4NXJA 5F61A 4NYVA 4A9FA 5E0RA 5CQ8A 3U5KA 2LSPB 5I29A 5ETBA 2YYNA 3NXBA 5C87A 4OGJA 2RO1A 3D1DA 4NQNA 5D0CA 5CS8A 3LQJA 4HBYA 5L98A 5ENCA 3P1EA 5CP5A 4CUSA 3LQIA 4IR4A 4A9NA 4XUBA 4QSXA 5I86A 3SVHA 5FE9A 4TT2A 3IU5A 4MR6A 4IR6A 4UYEA 4QEUA 4XY8A 4TU4A 5F1HA 4O7EA 4QEVA 2DVQA 4J3IA 4FLPA 5IGLA 5D25A 2L85A 5L8TA 5D3NA 5HEMA 5KTXA 4Z6HA 5EGUA 2I8NA 5KU3A 4Q0NA 3ZYUA 4YYHA 2YW5A 5DW2A 3P1FA 4UITA 4QEWA 4YABA 4QZSA 5FE7A 5DYXA 4WHUA 5EQ1A 3HMHA 5ETDA 4YYGA 5JWMA 4N4HA 5F3AA 3ERRA 4UIUA 5CQAA 3DWYA 5FBXA 5TCMA 5LKUA 5EP7A 4O70A 3O35A 5ENGA 4HXLA 2RS9B 2N9GA 5D3PA 5A7CA 4UIVA 4QSWA 5LKXA 1ZKRA 4QUTA 5FB0A 3JVMA 5DYCA 2DVSA 5E9MA 5FH7A 4O75A 3UVWA 3RCWA 4QYDA 4CFKA 5CUEA 4N3WA 5EPSA 5H1UA 4QY4A 4CURA 3MB3A 4J1PA 5H1TA 2R0SA 4UIZA 5KTUA 5I40A 4QBMA 5CQ5A 4KCXA 4CUPA 5LJ2A 4IOOA 4A9OA 3SVFA 3P5OA 2OUOA 2D82A 4A9IA 5LUUA 2DWWA 3O33A 4XY9A 3VKGA 3HMFA 4NUDA 3D1BA 4F3IA 3FKMX 4UIYA 1X0JA 3S92A 4UYDA 4WHWA 4TQNA 5E74A 5EU1A 4A9EA 5EICA 4CL9A 4AI6A 3SVGA 5F60A 5FG5A 5G4RA 4BHWA 5CFWA 5DX4A 4YK0A 4YC9A 5DFDA 5FFWA 1WUGA 5D24A 2G4AA 5FE2A 1E6IA 5IGKA 4O7CA 2DATA 5EI4A 4O77A 5II1A 4LZRA 4C67A 4PCIA 4UYFA 2RI7A 5EWDA 5HCLA 4MR5A 2L84A 4A9LA 4XUAA 5DFCA 5DYUA 5EK9A 5KTWA 3U5NA 5I89A 2KTBB 3P1DA 3QZTA 5ENHA 4LYIA 3MULA 5I88A 5E9YA 4KV4A 4A9MA 3Q2FA 2WP2A 4J0SA 3P1CA 4ZQLA 5FE6A 3S91A 2YEMA 4QB3A 3ONIA 1N72A 5C4QA 4YY4A 5ACYA 4NQMA 4YH3A 5F5ZA 5AMEA 5HJCA 4NS5A 5DBMA 5H1VA 2F6JA 5HRWA 4YYDA 5FE5A 2R0VA 5HRXA 5CU8A 4OGIA 5J0DA 3LXJA 5E3GA 3AADA 4LDFA 4CFLA 3O36A 4HBWA 4MR3A 3UVXA 4DONA 4UYGA 4MENA 4NR8A 3K2JA 4O71A 4LYSA 5HLSA 4CUUA 2RNYA 4ALHA 4Z1SA 5DLZA 5AD3A 4HXNA 5IG6A 4O76A 5ENFA 3UV4A 2F6NA 1WUMA 2DVRA 4NRAA 2DKWA 2EJNA 5L97A 4UIXA 5I83A 5CPEA 4YYJA 4YH4A 5FG6A 3U5OA 2E7OA 5CY9A 4HXSA 5FH6A 1F68A 2YDWA 5EV9A 5DY7A 5DKCA 5DLXA 5F63A 5FE4A 5FG4A 4MEQA 3MB4A 5CZGA 4Y03A 5EWVA 5BT5A 3DAIA 3GG3A 5H85A 5A5OA 5C89A 5A5NA 5D3RA 4QUUA 5LVRA 2I7KA 4HXPA 3JVKA 2RNWA 4RVRA 3O37A 4YYIA 4A9JA 4BJXA 5IIDA 4QR5A 5A82A 4N4GA 5A5QA 5LVQA 4LC2A 5E9KA 5CUGA 3U5PA 5IGNA 4HBVA 5CUBA 5D3LA 4TTEA 5LJ0A 3O34A 4TZ8A 5I1QA
chains in the Genus database with same CATH topology
4ZW1A 4NRBA 4QSUA 4PTBA 4HBXA 5FFYA 2R0YA 4NR9A 5A5PA 4WIVA 2MJVB 5G4SA 4MEOA 5EWWA 5FB1A 4BW3A 5DFBA 3UV2A 4C66A 4NR7A 4QSVA 5HM0A 4BW4A 5FE1A 4Z93A 5D3JA 3U5JA 5CUAA 4QC3A 4A9HA 4IOQA 2L5EA 3UW9A 5FFVA 5DW1A 5AMFA 4Q0OA 5HELA 3G0LA 5C8GA 4TYLA 5DKHA 4ZC9A 3UVDA 2H60A 4O7FA 5ENIA 5L99A 2NXBA 4UYHA 5FE8A 3U5LA 4PY6A 4LZ2A 4QNSA 5I7YA 4MR4A 4NYXA 5CQ3A 4YBSA 4PS5A 5BT3A 5CRZA 5D3TA 4TZ2A 2RFJA 5FE3A 5L8UA 4J0RA 5LJ1A 3QZVA 5HRVA 4A9KA 4LYWA 4TU6A 5CTLA 2OSSA 4N4IA 2DVVA 5CUDA 4HXKA 4IR5A 5EISA 5HQ5A 2E3KA 4O7BA 5KO4A 5F62A 2OO1A 3MQMA 5CQ4A 2RNXA 2D9EA 4YYNA 5D3HA 4NRCA 5HFQA 3JVLA 4UYFB 5F2PA 3TLPA 4Z1QA 4LR6A 5CQ6A 5D26A 5AD2A 5FE0A 5DKDA 5ENJA 5EWHA 4QSPA 5CRMA 5FDZA 4QSTA 2WP1A 5E73A 5EPBA 4NUCA 4YBTA 5EVAA 2E7NA 5KHMA 5HQ7A 4IR3A 3U5MA 4E96A 4NR4A 4NR5A 4X2IA 5F1LA 4NUEA 4HXRA 2GRCA 4O78A 4BW2A 5D3SA 5A83A 5F25A 4BW1A 1JM4B 1ZS5A 4KV1A 4YY6A 4O72A 4Z6IA 5CUCA 5A5SA 5HQ6A 4OUFA 4QSRA 1JSPB 3HMEA 2YQDA 2FSAA 5IBNA 4HXOA 4HXMA 3UV5A 4YATA 4QC1A 5BT4A 4TS8A 3UVYA 3MXFA 4CUQA 3MUKA 4TT6A 5L96A 5F36A 3LQHA 4NYWA 5CQTA 4PCEA 5D7XA 5CGPA 5TB6A 5ENBA 4NR6A 2YELA 5E9VA 4IORA 5A85A 4YYKA 5CQ7A 4O74A 2R10A 5EM3A 4LZSA 5DYAA 4MEPA 5A5RA 5LKZA 3IU6A 3AQAA 4QSQA 5II2A 4CUTA 4YADA 5LKTA 4UIWA 5COIA 4QSSA 5E9IA 3I3JA 5FH8A 5IGMA 4YYMA 5EA1A 3G0JA 4QR3A 1EQFA 3LJWA 4N4FA 5C7NA 5ENEA 5E9LA 4CLBA 5I7XA 4ALGA 4O7AA 4XYAA 5EWCA 5A81A 3D7CA 4AKNA 5HFRA 5JI8A 5I80A 4YBMA 4PKLA 4YAXA 3QZSA 5HENA 3Q2EA 2YEKA 4GPJA 5K29A 4TT4A 4QYLA 5E3DA 4QR4A 4LRGA 5C85A 5E7DA 3JVJA 5EPRA 4NXJA 5F61A 4NYVA 4A9FA 5E0RA 5CQ8A 3U5KA 2LSPB 5I29A 5ETBA 2YYNA 3NXBA 5C87A 4OGJA 2RO1A 4NQNA 5D0CA 5CS8A 3LQJA 4HBYA 5L98A 5ENCA 3P1EA 5CP5A 4CUSA 3LQIA 4IR4A 4A9NA 4XUBA 4QSXA 5I86A 3SVHA 5FE9A 4TT2A 4MR6A 4IR6A 3IU5A 4UYEA 4QEUA 4XY8A 4TU4A 5F1HA 4O7EA 4QEVA 2DVQA 4J3IA 4FLPA 5IGLA 5D25A 2L85A 5L8TA 5D3NA 5HEMA 5KTXA 4Z6HA 5EGUA 2I8NA 5KU3A 4Q0NA 3ZYUA 4YYHA 2YW5A 5DW2A 3P1FA 4UITA 4QEWA 4YABA 4QZSA 5FE7A 5DYXA 4WHUA 5EQ1A 3HMHA 5ETDA 4YYGA 5JWMA 4N4HA 5F3AA 4UIUA 5CQAA 3DWYA 5FBXA 5TCMA 5LKUA 5EP7A 4O70A 3O35A 5ENGA 4HXLA 2RS9B 2N9GA 5D3PA 5A7CA 4UIVA 4QSWA 5LKXA 4QUTA 5FB0A 3JVMA 5DYCA 2DVSA 5E9MA 5FH7A 4O75A 3UVWA 3RCWA 4QYDA 4CFKA 5CUEA 4N3WA 5EPSA 5H1UA 4QY4A 4CURA 3MB3A 4J1PA 5H1TA 2R0SA 4UIZA 5KTUA 5I40A 4QBMA 5CQ5A 4KCXA 4CUPA 5LJ2A 4IOOA 4A9OA 3SVFA 3P5OA 2OUOA 2D82A 4A9IA 5LUUA 2DWWA 3O33A 4XY9A 3HMFA 4NUDA 4F3IA 3FKMX 4UIYA 1X0JA 3S92A 4UYDA 4WHWA 4TQNA 5E74A 5EU1A 4A9EA 5EICA 4CL9A 3SVGA 5F60A 5FG5A 5G4RA 4BHWA 5CFWA 5DX4A 4YK0A 4YC9A 5DFDA 5FFWA 1WUGA 5D24A 2G4AA 5FE2A 1E6IA 5IGKA 4O7CA 2DATA 5EI4A 4O77A 5II1A 4LZRA 4C67A 4PCIA 4UYFA 2RI7A 5EWDA 5HCLA 4MR5A 2L84A 4A9LA 4XUAA 5DFCA 5DYUA 5EK9A 5KTWA 3U5NA 5I89A 2KTBB 3P1DA 3QZTA 5ENHA 4LYIA 3MULA 5I88A 5E9YA 4KV4A 4A9MA 3Q2FA 2WP2A 4J0SA 3P1CA 4ZQLA 5FE6A 3S91A 2YEMA 4QB3A 3ONIA 1N72A 5C4QA 4YY4A 5ACYA 4NQMA 4YH3A 5F5ZA 5AMEA 5HJCA 4NS5A 5DBMA 5H1VA 2F6JA 5HRWA 4YYDA 5FE5A 2R0VA 5HRXA 5CU8A 4OGIA 5J0DA 3LXJA 5E3GA 3AADA 4LDFA 4CFLA 3O36A 4HBWA 4MR3A 3UVXA 4DONA 4UYGA 4MENA 4NR8A 3K2JA 4O71A 4LYSA 5HLSA 4CUUA 2RNYA 4ALHA 4Z1SA 5DLZA 5AD3A 4HXNA 5IG6A 4O76A 5ENFA 3UV4A 2F6NA 1WUMA 2DVRA 4NRAA 2DKWA 5L97A 4UIXA 5I83A 5CPEA 4YYJA 4YH4A 5FG6A 3U5OA 2E7OA 5CY9A 4HXSA 5FH6A 1F68A 2YDWA 5EV9A 5DY7A 5DKCA 5DLXA 5F63A 5FE4A 5FG4A 4MEQA 3MB4A 5CZGA 4Y03A 5EWVA 5BT5A 3DAIA 3GG3A 5H85A 5A5OA 5C89A 5A5NA 5D3RA 4QUUA 5LVRA 2I7KA 4HXPA 3JVKA 2RNWA 4RVRA 3O37A 4YYIA 4A9JA 4BJXA 5IIDA 4QR5A 5A82A 4N4GA 5A5QA 5LVQA 4LC2A 5E9KA 5CUGA 3U5PA 5IGNA 4HBVA 5CUBA 5D3LA 4TTEA 5LJ0A 3O34A 4TZ8A 5I1QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZW1 A;  4NRB A;  4QSU A;  4PTB A;  4HBX A;  5FFY A;  2R0Y A;  4NR9 A;  5A5P A;  4WIV A;  2MJV B;  5G4S A;  4MEO A;  5EWW A;  5FB1 A;  4BW3 A;  5DFB A;  3UV2 A;  4C66 A;  4NR7 A;  4QSV A;  5HM0 A;  4BW4 A;  5FE1 A;  4Z93 A;  5D3J A;  3U5J A;  5CUA A;  4QC3 A;  4A9H A;  4IOQ A;  2L5E A;  3UW9 A;  5FFV A;  5DW1 A;  5AMF A;  4Q0O A;  5HEL A;  3G0L A;  5C8G A;  4TYL A;  5DKH A;  4ZC9 A;  3UVD A;  2H60 A;  4O7F A;  5ENI A;  5L99 A;  2NXB A;  4UYH A;  5FE8 A;  3U5L A;  4PY6 A;  4LZ2 A;  4QNS A;  5I7Y A;  4MR4 A;  4NYX A;  5CQ3 A;  4YBS A;  4PS5 A;  5BT3 A;  5CRZ A;  5D3T A;  4TZ2 A;  2RFJ A;  5FE3 A;  5L8U A;  4J0R A;  5LJ1 A;  3QZV A;  5HRV A;  4A9K A;  4LYW A;  4TU6 A;  5CTL A;  2OSS A;  4N4I A;  2DVV A;  5CUD A;  4HXK A;  4IR5 A;  5EIS A;  5HQ5 A;  2E3K A;  4O7B A;  5KO4 A;  5F62 A;  2OO1 A;  3MQM A;  5CQ4 A;  2RNX A;  2D9E A;  4YYN A;  5D3H A;  4NRC A;  5HFQ A;  3JVL A;  4UYF B;  5F2P A;  3TLP A;  4Z1Q A;  4LR6 A;  5CQ6 A;  5D26 A;  5AD2 A;  5FE0 A;  5DKD A;  5ENJ A;  5EWH A;  4QSP A;  5CRM A;  5FDZ A;  4QST A;  2WP1 A;  5E73 A;  5EPB A;  4NUC A;  4YBT A;  5EVA A;  2E7N A;  5KHM A;  5HQ7 A;  4IR3 A;  3U5M A;  4E96 A;  4NR4 A;  4NR5 A;  4X2I A;  5F1L A;  4NUE A;  4HXR A;  2GRC A;  4O78 A;  4BW2 A;  5D3S A;  5A83 A;  5F25 A;  4BW1 A;  1JM4 B;  1ZS5 A;  4KV1 A;  4YY6 A;  4O72 A;  4Z6I A;  5CUC A;  5A5S A;  5HQ6 A;  4OUF A;  4QSR A;  1JSP B;  3HME A;  2YQD A;  2FSA A;  5IBN A;  4HXO A;  4HXM A;  3UV5 A;  4YAT A;  4QC1 A;  5BT4 A;  4TS8 A;  3UVY A;  3MXF A;  4CUQ A;  3MUK A;  4TT6 A;  5L96 A;  5F36 A;  3LQH A;  4NYW A;  5CQT A;  4PCE A;  5D7X A;  5CGP A;  5TB6 A;  5ENB A;  4NR6 A;  2YEL A;  5E9V A;  4IOR A;  5A85 A;  4YYK A;  5CQ7 A;  4O74 A;  2R10 A;  5EM3 A;  4LZS A;  5DYA A;  4MEP A;  5A5R A;  5LKZ A;  3IU6 A;  3AQA A;  4QSQ A;  5II2 A;  4CUT A;  4YAD A;  5LKT A;  4UIW A;  5COI A;  4QSS A;  5E9I A;  3I3J A;  5FH8 A;  5IGM A;  4YYM A;  5EA1 A;  3G0J A;  4QR3 A;  1EQF A;  3LJW A;  4N4F A;  5C7N A;  5ENE A;  5E9L A;  4CLB A;  5I7X A;  4ALG A;  4O7A A;  4XYA A;  5EWC A;  5A81 A;  3D7C A;  4AKN A;  5HFR A;  5JI8 A;  5I80 A;  4YBM A;  4PKL A;  4YAX A;  3QZS A;  5HEN A;  3Q2E A;  2YEK A;  4GPJ A;  5K29 A;  4TT4 A;  4QYL A;  5E3D A;  4QR4 A;  4LRG A;  5C85 A;  5E7D A;  3JVJ A;  5EPR A;  4NXJ A;  5F61 A;  4NYV A;  4A9F A;  5E0R A;  5CQ8 A;  3U5K A;  2LSP B;  5I29 A;  5ETB A;  2YYN A;  3NXB A;  5C87 A;  4OGJ A;  2RO1 A;  4NQN A;  5D0C A;  5CS8 A;  3LQJ A;  4HBY A;  5L98 A;  5ENC A;  3P1E A;  5CP5 A;  4CUS A;  3LQI A;  4IR4 A;  4A9N A;  4XUB A;  4QSX A;  5I86 A;  3SVH A;  5FE9 A;  4TT2 A;  4MR6 A;  4IR6 A;  3IU5 A;  4UYE A;  4QEU A;  4XY8 A;  4TU4 A;  5F1H A;  4O7E A;  4QEV A;  2DVQ A;  4J3I A;  4FLP A;  5IGL A;  5D25 A;  2L85 A;  5L8T A;  5D3N A;  5HEM A;  5KTX A;  4Z6H A;  5EGU A;  2I8N A;  5KU3 A;  4Q0N A;  3ZYU A;  4YYH A;  2YW5 A;  5DW2 A;  3P1F A;  4UIT A;  4QEW A;  4YAB A;  4QZS A;  5FE7 A;  5DYX A;  4WHU A;  5EQ1 A;  3HMH A;  5ETD A;  4YYG A;  5JWM A;  4N4H A;  5F3A A;  4UIU A;  5CQA A;  3DWY A;  5FBX A;  5TCM A;  5LKU A;  5EP7 A;  4O70 A;  3O35 A;  5ENG A;  4HXL A;  2RS9 B;  2N9G A;  5D3P A;  5A7C A;  4UIV A;  4QSW A;  5LKX A;  4QUT A;  5FB0 A;  3JVM A;  5DYC A;  2DVS A;  5E9M A;  5FH7 A;  4O75 A;  3UVW A;  3RCW A;  4QYD A;  4CFK A;  5CUE A;  4N3W A;  5EPS A;  5H1U A;  4QY4 A;  4CUR A;  3MB3 A;  4J1P A;  5H1T A;  2R0S A;  4UIZ A;  5KTU A;  5I40 A;  4QBM A;  5CQ5 A;  4KCX A;  4CUP A;  5LJ2 A;  4IOO A;  4A9O A;  3SVF A;  3P5O A;  2OUO A;  2D82 A;  4A9I A;  5LUU A;  2DWW A;  3O33 A;  4XY9 A;  3HMF A;  4NUD A;  4F3I A;  3FKM X;  4UIY A;  1X0J A;  3S92 A;  4UYD A;  4WHW A;  4TQN A;  5E74 A;  5EU1 A;  4A9E A;  5EIC A;  4CL9 A;  3SVG A;  5F60 A;  5FG5 A;  5G4R A;  4BHW A;  5CFW A;  5DX4 A;  4YK0 A;  4YC9 A;  5DFD A;  5FFW A;  1WUG A;  5D24 A;  2G4A A;  5FE2 A;  1E6I A;  5IGK A;  4O7C A;  2DAT A;  5EI4 A;  4O77 A;  5II1 A;  4LZR A;  4C67 A;  4PCI A;  4UYF A;  2RI7 A;  5EWD A;  5HCL A;  4MR5 A;  2L84 A;  4A9L A;  4XUA A;  5DFC A;  5DYU A;  5EK9 A;  5KTW A;  3U5N A;  5I89 A;  2KTB B;  3P1D A;  3QZT A;  5ENH A;  4LYI A;  3MUL A;  5I88 A;  5E9Y A;  4KV4 A;  4A9M A;  3Q2F A;  2WP2 A;  4J0S A;  3P1C A;  4ZQL A;  5FE6 A;  3S91 A;  2YEM A;  4QB3 A;  3ONI A;  1N72 A;  5C4Q A;  4YY4 A;  5ACY A;  4NQM A;  4YH3 A;  5F5Z A;  5AME A;  5HJC A;  4NS5 A;  5DBM A;  5H1V A;  2F6J A;  5HRW A;  4YYD A;  5FE5 A;  2R0V A;  5HRX A;  5CU8 A;  4OGI A;  5J0D A;  3LXJ A;  5E3G A;  3AAD A;  4LDF A;  4CFL A;  3O36 A;  4HBW A;  4MR3 A;  3UVX A;  4DON A;  4UYG A;  4MEN A;  4NR8 A;  3K2J A;  4O71 A;  4LYS A;  5HLS A;  4CUU A;  2RNY A;  4ALH A;  4Z1S A;  5DLZ A;  5AD3 A;  4HXN A;  5IG6 A;  4O76 A;  5ENF A;  3UV4 A;  2F6N A;  1WUM A;  2DVR A;  4NRA A;  2DKW A;  5L97 A;  4UIX A;  5I83 A;  5CPE A;  4YYJ A;  4YH4 A;  5FG6 A;  3U5O A;  2E7O A;  5CY9 A;  4HXS A;  5FH6 A;  1F68 A;  2YDW A;  5EV9 A;  5DY7 A;  5DKC A;  5DLX A;  5F63 A;  5FE4 A;  5FG4 A;  4MEQ A;  3MB4 A;  5CZG A;  4Y03 A;  5EWV A;  5BT5 A;  3DAI A;  3GG3 A;  5H85 A;  5A5O A;  5C89 A;  5A5N A;  5D3R A;  4QUU A;  5LVR A;  2I7K A;  4HXP A;  3JVK A;  2RNW A;  4RVR A;  3O37 A;  4YYI A;  4A9J A;  4BJX A;  5IID A;  4QR5 A;  5A82 A;  4N4G A;  5A5Q A;  5LVQ A;  4LC2 A;  5E9K A;  5CUG A;  3U5P A;  5IGN A;  4HBV A;  5CUB A;  5D3L A;  4TTE A;  5LJ0 A;  3O34 A;  4TZ8 A;  5I1Q A; 
#chains in the Genus database with same CATH topology
 4ZW1 A;  4NRB A;  4QSU A;  4PTB A;  4HBX A;  5FFY A;  2R0Y A;  4NR9 A;  5A5P A;  4WIV A;  2MJV B;  5G4S A;  4MEO A;  5EWW A;  5FB1 A;  4BW3 A;  5DFB A;  3UV2 A;  4C66 A;  4NR7 A;  4QSV A;  5HM0 A;  4BW4 A;  5FE1 A;  4Z93 A;  5D3J A;  3U5J A;  5CUA A;  4QC3 A;  4A9H A;  4IOQ A;  2L5E A;  3UW9 A;  5FFV A;  5DW1 A;  5AMF A;  4Q0O A;  5HEL A;  3G0L A;  5C8G A;  4TYL A;  5DKH A;  4ZC9 A;  3UVD A;  2H60 A;  4O7F A;  5ENI A;  5L99 A;  2NXB A;  4UYH A;  5FE8 A;  3U5L A;  4PY6 A;  4LZ2 A;  4QNS A;  4AKH A;  5I7Y A;  4MR4 A;  4NYX A;  5CQ3 A;  4YBS A;  4PS5 A;  5BT3 A;  5CRZ A;  5D3T A;  4TZ2 A;  2RFJ A;  5FE3 A;  5L8U A;  4J0R A;  5LJ1 A;  3QZV A;  5HRV A;  4A9K A;  4LYW A;  4TU6 A;  5CTL A;  2OSS A;  4N4I A;  2DVV A;  5CUD A;  4HXK A;  4IR5 A;  5EIS A;  5HQ5 A;  2E3K A;  4O7B A;  5KO4 A;  5F62 A;  2OO1 A;  3MQM A;  3VKH A;  5CQ4 A;  2RNX A;  2D9E A;  4YYN A;  5D3H A;  4NRC A;  5HFQ A;  3JVL A;  4UYF B;  5F2P A;  3TLP A;  4Z1Q A;  4LR6 A;  5CQ6 A;  5D26 A;  5AD2 A;  5FE0 A;  5DKD A;  5ENJ A;  5EWH A;  4QSP A;  5CRM A;  5FDZ A;  4QST A;  2WP1 A;  5E73 A;  5EPB A;  4NUC A;  4YBT A;  4AKG A;  5EVA A;  2E7N A;  5KHM A;  5HQ7 A;  4IR3 A;  3U5M A;  4E96 A;  4NR4 A;  4NR5 A;  4X2I A;  5F1L A;  4NUE A;  4HXR A;  2GRC A;  4O78 A;  4BW2 A;  5D3S A;  5A83 A;  5F25 A;  4BW1 A;  1JM4 B;  1ZS5 A;  4KV1 A;  4YY6 A;  4O72 A;  4Z6I A;  5CUC A;  5A5S A;  5HQ6 A;  4OUF A;  4QSR A;  1JSP B;  4AKI A;  3HME A;  2YQD A;  2FSA A;  5IBN A;  4HXO A;  4HXM A;  3UV5 A;  4YAT A;  4QC1 A;  5BT4 A;  4TS8 A;  3UVY A;  3MXF A;  4CUQ A;  3MUK A;  4TT6 A;  5L96 A;  5F36 A;  3LQH A;  4NYW A;  5CQT A;  4PCE A;  5D7X A;  5CGP A;  5TB6 A;  5ENB A;  4NR6 A;  2YEL A;  5E9V A;  4IOR A;  5A85 A;  4YYK A;  5CQ7 A;  4O74 A;  2R10 A;  5EM3 A;  4LZS A;  5DYA A;  4MEP A;  5A5R A;  5LKZ A;  3IU6 A;  3AQA A;  4QSQ A;  5II2 A;  4CUT A;  4YAD A;  5LKT A;  4UIW A;  5COI A;  4QSS A;  5E9I A;  3I3J A;  5FH8 A;  5IGM A;  4YYM A;  5EA1 A;  3G0J A;  4QR3 A;  1EQF A;  3LJW A;  4N4F A;  5C7N A;  5ENE A;  5E9L A;  4CLB A;  5I7X A;  4ALG A;  4O7A A;  4XYA A;  5EWC A;  5A81 A;  3D7C A;  4AKN A;  5HFR A;  5JI8 A;  5I80 A;  4YBM A;  4PKL A;  4YAX A;  3QZS A;  5HEN A;  3Q2E A;  2YEK A;  4GPJ A;  5K29 A;  4TT4 A;  4QYL A;  1PUO A;  4QR4 A;  5E3D A;  4LRG A;  5C85 A;  5E7D A;  3JVJ A;  5EPR A;  4NXJ A;  5F61 A;  4NYV A;  4A9F A;  5E0R A;  5CQ8 A;  3U5K A;  2LSP B;  5I29 A;  5ETB A;  2YYN A;  3NXB A;  5C87 A;  4OGJ A;  2RO1 A;  3D1D A;  4NQN A;  5D0C A;  5CS8 A;  3LQJ A;  4HBY A;  5L98 A;  5ENC A;  3P1E A;  5CP5 A;  4CUS A;  3LQI A;  4IR4 A;  4A9N A;  4XUB A;  4QSX A;  5I86 A;  3SVH A;  5FE9 A;  4TT2 A;  3IU5 A;  4MR6 A;  4IR6 A;  4UYE A;  4QEU A;  4XY8 A;  4TU4 A;  5F1H A;  4O7E A;  4QEV A;  2DVQ A;  4J3I A;  4FLP A;  5IGL A;  5D25 A;  2L85 A;  5L8T A;  5D3N A;  5HEM A;  5KTX A;  4Z6H A;  5EGU A;  2I8N A;  5KU3 A;  4Q0N A;  3ZYU A;  4YYH A;  2YW5 A;  5DW2 A;  3P1F A;  4UIT A;  4QEW A;  4YAB A;  4QZS A;  5FE7 A;  5DYX A;  4WHU A;  5EQ1 A;  3HMH A;  5ETD A;  4YYG A;  5JWM A;  4N4H A;  5F3A A;  3ERR A;  4UIU A;  5CQA A;  3DWY A;  5FBX A;  5TCM A;  5LKU A;  5EP7 A;  4O70 A;  3O35 A;  5ENG A;  4HXL A;  2RS9 B;  2N9G A;  5D3P A;  5A7C A;  4UIV A;  4QSW A;  5LKX A;  1ZKR A;  4QUT A;  5FB0 A;  3JVM A;  5DYC A;  2DVS A;  5E9M A;  5FH7 A;  4O75 A;  3UVW A;  3RCW A;  4QYD A;  4CFK A;  5CUE A;  4N3W A;  5EPS A;  5H1U A;  4QY4 A;  4CUR A;  3MB3 A;  4J1P A;  5H1T A;  2R0S A;  4UIZ A;  5KTU A;  5I40 A;  4QBM A;  5CQ5 A;  4KCX A;  4CUP A;  5LJ2 A;  4IOO A;  4A9O A;  3SVF A;  3P5O A;  2OUO A;  2D82 A;  4A9I A;  5LUU A;  2DWW A;  3O33 A;  4XY9 A;  3VKG A;  3HMF A;  4NUD A;  3D1B A;  4F3I A;  3FKM X;  4UIY A;  1X0J A;  3S92 A;  4UYD A;  4WHW A;  4TQN A;  5E74 A;  5EU1 A;  4A9E A;  5EIC A;  4CL9 A;  4AI6 A;  3SVG A;  5F60 A;  5FG5 A;  5G4R A;  4BHW A;  5CFW A;  5DX4 A;  4YK0 A;  4YC9 A;  5DFD A;  5FFW A;  1WUG A;  5D24 A;  2G4A A;  5FE2 A;  1E6I A;  5IGK A;  4O7C A;  2DAT A;  5EI4 A;  4O77 A;  5II1 A;  4LZR A;  4C67 A;  4PCI A;  4UYF A;  2RI7 A;  5EWD A;  5HCL A;  4MR5 A;  2L84 A;  4A9L A;  4XUA A;  5DFC A;  5DYU A;  5EK9 A;  5KTW A;  3U5N A;  5I89 A;  2KTB B;  3P1D A;  3QZT A;  5ENH A;  4LYI A;  3MUL A;  5I88 A;  5E9Y A;  4KV4 A;  4A9M A;  3Q2F A;  2WP2 A;  4J0S A;  3P1C A;  4ZQL A;  5FE6 A;  3S91 A;  2YEM A;  4QB3 A;  3ONI A;  1N72 A;  5C4Q A;  4YY4 A;  5ACY A;  4NQM A;  4YH3 A;  5F5Z A;  5AME A;  5HJC A;  4NS5 A;  5DBM A;  5H1V A;  2F6J A;  5HRW A;  4YYD A;  5FE5 A;  2R0V A;  5HRX A;  5CU8 A;  4OGI A;  5J0D A;  3LXJ A;  5E3G A;  3AAD A;  4LDF A;  4CFL A;  3O36 A;  4HBW A;  4MR3 A;  3UVX A;  4DON A;  4UYG A;  4MEN A;  4NR8 A;  3K2J A;  4O71 A;  4LYS A;  5HLS A;  4CUU A;  2RNY A;  4ALH A;  4Z1S A;  5DLZ A;  5AD3 A;  4HXN A;  5IG6 A;  4O76 A;  5ENF A;  3UV4 A;  2F6N A;  1WUM A;  2DVR A;  4NRA A;  2DKW A;  2EJN A;  5L97 A;  4UIX A;  5I83 A;  5CPE A;  4YYJ A;  4YH4 A;  5FG6 A;  3U5O A;  2E7O A;  5CY9 A;  4HXS A;  5FH6 A;  1F68 A;  2YDW A;  5EV9 A;  5DY7 A;  5DKC A;  5DLX A;  5F63 A;  5FE4 A;  5FG4 A;  4MEQ A;  3MB4 A;  5CZG A;  4Y03 A;  5EWV A;  5BT5 A;  3DAI A;  3GG3 A;  5H85 A;  5A5O A;  5C89 A;  5A5N A;  5D3R A;  4QUU A;  5LVR A;  2I7K A;  4HXP A;  3JVK A;  2RNW A;  4RVR A;  3O37 A;  4YYI A;  4A9J A;  4BJX A;  5IID A;  4QR5 A;  5A82 A;  4N4G A;  5A5Q A;  5LVQ A;  4LC2 A;  5E9K A;  5CUG A;  3U5P A;  5IGN A;  4HBV A;  5CUB A;  5D3L A;  4TTE A;  5LJ0 A;  3O34 A;  4TZ8 A;  5I1Q A; 
#chains in the Genus database with same CATH homology
 4ZW1 A;  4NRB A;  4QSU A;  4PTB A;  4HBX A;  5FFY A;  2R0Y A;  4NR9 A;  5A5P A;  4WIV A;  2MJV B;  5G4S A;  4MEO A;  5EWW A;  5FB1 A;  4BW3 A;  5DFB A;  3UV2 A;  4C66 A;  4NR7 A;  4QSV A;  5HM0 A;  4BW4 A;  5FE1 A;  4Z93 A;  5D3J A;  3U5J A;  5CUA A;  4QC3 A;  4A9H A;  4IOQ A;  2L5E A;  3UW9 A;  5FFV A;  5DW1 A;  5AMF A;  4Q0O A;  5HEL A;  3G0L A;  5C8G A;  4TYL A;  5DKH A;  4ZC9 A;  3UVD A;  2H60 A;  4O7F A;  5ENI A;  5L99 A;  2NXB A;  4UYH A;  5FE8 A;  3U5L A;  4PY6 A;  4LZ2 A;  4QNS A;  5I7Y A;  4MR4 A;  4NYX A;  5CQ3 A;  4YBS A;  4PS5 A;  5BT3 A;  5CRZ A;  5D3T A;  4TZ2 A;  2RFJ A;  5FE3 A;  5L8U A;  4J0R A;  5LJ1 A;  3QZV A;  5HRV A;  4A9K A;  4LYW A;  4TU6 A;  5CTL A;  2OSS A;  4N4I A;  2DVV A;  5CUD A;  4HXK A;  4IR5 A;  5EIS A;  5HQ5 A;  2E3K A;  4O7B A;  5KO4 A;  5F62 A;  2OO1 A;  3MQM A;  5CQ4 A;  2RNX A;  2D9E A;  4YYN A;  5D3H A;  4NRC A;  5HFQ A;  3JVL A;  4UYF B;  5F2P A;  3TLP A;  4Z1Q A;  4LR6 A;  5CQ6 A;  5D26 A;  5AD2 A;  5FE0 A;  5DKD A;  5ENJ A;  5EWH A;  4QSP A;  5CRM A;  5FDZ A;  4QST A;  2WP1 A;  5E73 A;  5EPB A;  4NUC A;  4YBT A;  5EVA A;  2E7N A;  5KHM A;  5HQ7 A;  4IR3 A;  3U5M A;  4E96 A;  4NR4 A;  4NR5 A;  4X2I A;  5F1L A;  4NUE A;  4HXR A;  2GRC A;  4O78 A;  4BW2 A;  5D3S A;  5A83 A;  5F25 A;  4BW1 A;  1JM4 B;  1ZS5 A;  4KV1 A;  4YY6 A;  4O72 A;  4Z6I A;  5CUC A;  5A5S A;  5HQ6 A;  4OUF A;  4QSR A;  1JSP B;  3HME A;  2YQD A;  2FSA A;  5IBN A;  4HXO A;  4HXM A;  3UV5 A;  4YAT A;  4QC1 A;  5BT4 A;  4TS8 A;  3UVY A;  3MXF A;  4CUQ A;  3MUK A;  4TT6 A;  5L96 A;  5F36 A;  3LQH A;  4NYW A;  5CQT A;  4PCE A;  5D7X A;  5CGP A;  5TB6 A;  5ENB A;  4NR6 A;  2YEL A;  5E9V A;  4IOR A;  5A85 A;  4YYK A;  5CQ7 A;  4O74 A;  2R10 A;  5EM3 A;  4LZS A;  5DYA A;  4MEP A;  5A5R A;  5LKZ A;  3IU6 A;  3AQA A;  4QSQ A;  5II2 A;  4CUT A;  4YAD A;  5LKT A;  4UIW A;  5COI A;  4QSS A;  5E9I A;  3I3J A;  5FH8 A;  5IGM A;  4YYM A;  5EA1 A;  3G0J A;  4QR3 A;  1EQF A;  3LJW A;  4N4F A;  5C7N A;  5ENE A;  5E9L A;  4CLB A;  5I7X A;  4ALG A;  4O7A A;  4XYA A;  5EWC A;  5A81 A;  3D7C A;  4AKN A;  5HFR A;  5JI8 A;  5I80 A;  4YBM A;  4PKL A;  4YAX A;  3QZS A;  5HEN A;  3Q2E A;  2YEK A;  4GPJ A;  5K29 A;  4TT4 A;  4QYL A;  5E3D A;  4QR4 A;  4LRG A;  5C85 A;  5E7D A;  3JVJ A;  5EPR A;  4NXJ A;  5F61 A;  4NYV A;  4A9F A;  5E0R A;  5CQ8 A;  3U5K A;  2LSP B;  5I29 A;  5ETB A;  2YYN A;  3NXB A;  5C87 A;  4OGJ A;  2RO1 A;  4NQN A;  5D0C A;  5CS8 A;  3LQJ A;  4HBY A;  5L98 A;  5ENC A;  3P1E A;  5CP5 A;  4CUS A;  3LQI A;  4IR4 A;  4A9N A;  4XUB A;  4QSX A;  5I86 A;  3SVH A;  5FE9 A;  4TT2 A;  4MR6 A;  4IR6 A;  3IU5 A;  4UYE A;  4QEU A;  4XY8 A;  4TU4 A;  5F1H A;  4O7E A;  4QEV A;  2DVQ A;  4J3I A;  4FLP A;  5IGL A;  5D25 A;  2L85 A;  5L8T A;  5D3N A;  5HEM A;  5KTX A;  4Z6H A;  5EGU A;  2I8N A;  5KU3 A;  4Q0N A;  3ZYU A;  4YYH A;  2YW5 A;  5DW2 A;  3P1F A;  4UIT A;  4QEW A;  4YAB A;  4QZS A;  5FE7 A;  5DYX A;  4WHU A;  5EQ1 A;  3HMH A;  5ETD A;  4YYG A;  5JWM A;  4N4H A;  5F3A A;  4UIU A;  5CQA A;  3DWY A;  5FBX A;  5TCM A;  5LKU A;  5EP7 A;  4O70 A;  3O35 A;  5ENG A;  4HXL A;  2RS9 B;  2N9G A;  5D3P A;  5A7C A;  4UIV A;  4QSW A;  5LKX A;  4QUT A;  5FB0 A;  3JVM A;  5DYC A;  2DVS A;  5E9M A;  5FH7 A;  4O75 A;  3UVW A;  3RCW A;  4QYD A;  4CFK A;  5CUE A;  4N3W A;  5EPS A;  5H1U A;  4QY4 A;  4CUR A;  3MB3 A;  4J1P A;  5H1T A;  2R0S A;  4UIZ A;  5KTU A;  5I40 A;  4QBM A;  5CQ5 A;  4KCX A;  4CUP A;  5LJ2 A;  4IOO A;  4A9O A;  3SVF A;  3P5O A;  2OUO A;  2D82 A;  4A9I A;  5LUU A;  2DWW A;  3O33 A;  4XY9 A;  3HMF A;  4NUD A;  4F3I A;  3FKM X;  4UIY A;  1X0J A;  3S92 A;  4UYD A;  4WHW A;  4TQN A;  5E74 A;  5EU1 A;  4A9E A;  5EIC A;  4CL9 A;  3SVG A;  5F60 A;  5FG5 A;  5G4R A;  4BHW A;  5CFW A;  5DX4 A;  4YK0 A;  4YC9 A;  5DFD A;  5FFW A;  1WUG A;  5D24 A;  2G4A A;  5FE2 A;  1E6I A;  5IGK A;  4O7C A;  2DAT A;  5EI4 A;  4O77 A;  5II1 A;  4LZR A;  4C67 A;  4PCI A;  4UYF A;  2RI7 A;  5EWD A;  5HCL A;  4MR5 A;  2L84 A;  4A9L A;  4XUA A;  5DFC A;  5DYU A;  5EK9 A;  5KTW A;  3U5N A;  5I89 A;  2KTB B;  3P1D A;  3QZT A;  5ENH A;  4LYI A;  3MUL A;  5I88 A;  5E9Y A;  4KV4 A;  4A9M A;  3Q2F A;  2WP2 A;  4J0S A;  3P1C A;  4ZQL A;  5FE6 A;  3S91 A;  2YEM A;  4QB3 A;  3ONI A;  1N72 A;  5C4Q A;  4YY4 A;  5ACY A;  4NQM A;  4YH3 A;  5F5Z A;  5AME A;  5HJC A;  4NS5 A;  5DBM A;  5H1V A;  2F6J A;  5HRW A;  4YYD A;  5FE5 A;  2R0V A;  5HRX A;  5CU8 A;  4OGI A;  5J0D A;  3LXJ A;  5E3G A;  3AAD A;  4LDF A;  4CFL A;  3O36 A;  4HBW A;  4MR3 A;  3UVX A;  4DON A;  4UYG A;  4MEN A;  4NR8 A;  3K2J A;  4O71 A;  4LYS A;  5HLS A;  4CUU A;  2RNY A;  4ALH A;  4Z1S A;  5DLZ A;  5AD3 A;  4HXN A;  5IG6 A;  4O76 A;  5ENF A;  3UV4 A;  2F6N A;  1WUM A;  2DVR A;  4NRA A;  2DKW A;  5L97 A;  4UIX A;  5I83 A;  5CPE A;  4YYJ A;  4YH4 A;  5FG6 A;  3U5O A;  2E7O A;  5CY9 A;  4HXS A;  5FH6 A;  1F68 A;  2YDW A;  5EV9 A;  5DY7 A;  5DKC A;  5DLX A;  5F63 A;  5FE4 A;  5FG4 A;  4MEQ A;  3MB4 A;  5CZG A;  4Y03 A;  5EWV A;  5BT5 A;  3DAI A;  3GG3 A;  5H85 A;  5A5O A;  5C89 A;  5A5N A;  5D3R A;  4QUU A;  5LVR A;  2I7K A;  4HXP A;  3JVK A;  2RNW A;  4RVR A;  3O37 A;  4YYI A;  4A9J A;  4BJX A;  5IID A;  4QR5 A;  5A82 A;  4N4G A;  5A5Q A;  5LVQ A;  4LC2 A;  5E9K A;  5CUG A;  3U5P A;  5IGN A;  4HBV A;  5CUB A;  5D3L A;  4TTE A;  5LJ0 A;  3O34 A;  4TZ8 A;  5I1Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...