5HM0A

Crystal structure of the first bromodomain of human brd4 bound to benzoisoxazoloazepine 3
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
125
structure length
125
Chain Sequence
STNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Bromodomain-containing protein 4
publication title Identification of a Benzoisoxazoloazepine Inhibitor (CPI-0610) of the Bromodomain and Extra-Terminal (BET) Family as a Candidate for Human Clinical Trials.
pubmed doi rcsb
source organism Homo sapiens
total genus 44
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2016-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5hm0A01
4ZC9A 4HXSA 4HXRA 5A5RA 3U5KA 4QC3A 2R0VA 3HMFA 4QSRA 4TZ2A 5CQ8A 2R0YA 4TT4A 5DLXA 4NRCA 4QZSA 4YBMA 4LR6A 3UVYA 5FE5A 4TS8A 5JI8A 5CTLA 4OGJA 5A7CA 5LUUA 2GRCA 5A5PA 2RNWA 5HENA 5CFWA 5BT4A 4PTBA 3IU6A 5AD2A 4O7FA 4C66A 5F62A 4QBMA 4TU4A 5II1A 5DYAA 4NRAA 4QR3A 4HXNA 4CL9A 4O76A 5CY9A 4CLBA 2L5EA 2DVQA 2F6JA 3JVJA 5L8UA 4A9FA 5IGMA 4UYDA 5ENEA 4MR5A 4BW3A 4LDFA 2L85A 4TYLA 3MUKA 4MENA 4IR6A 5KTWA 5LVRA 5FG5A 5CUAA 5CS8A 5CUBA 4HBYA 5HRWA 4Z93A 5EGUA 3S91A 2RNXA 4TU6A 5E7DA 3AADA 4LZ2A 3Q2FA 5F1HA 4A9KA 2DKWA 5HFRA 4PS5A 4LZSA 5L97A 4YH3A 4Z6IA 4QSPA 4HXPA 5FDZA 5CZGA 3UVWA 4ALGA 5LKTA 4WHWA 4BJXA 5DFBA 3K2JA 5EWDA 5HQ6A 5CQAA 5D3HA 1JSPB 5FFVA 4DONA 5EWHA 4BW2A 5DYXA 2YEKA 3DWYA 4QY4A 5HELA 4A9HA 2I7KA 4QSQA 5KTUA 3O36A 4MEQA 5D3PA 4Z1QA 4LYIA 5LKXA 4YBSA 5FB1A 5KTXA 1F68A 3MQMA 5EK9A 5C4QA 3U5LA 4YYGA 5HLSA 5FH8A 5LKUA 2N9GA 5JWMA 5J0DA 4HBVA 2DWWA 5E0RA 1EQFA 3S92A 2MJVB 5ENJA 5H1VA 4YYHA 5I88A 4FLPA 4O78A 4O74A 4YABA 4BHWA 4UIWA 2R10A 5I80A 5A82A 4HBXA 4QEVA 4UYGA 5FE3A 3MULA 5E9VA 5DKCA 2RI7A 4YAXA 3NXBA 3O35A 3P1DA 5IG6A 2YQDA 5CUEA 2DVSA 4QEUA 5ETBA 4LYSA 3MB4A 5FH6A 5DFDA 5H85A 3QZVA 2RO1A 5II2A 3U5JA 4J3IA 2D9EA 5F2PA 5CQTA 5AMEA 5FE1A 5LJ0A 3FKMX 4QEWA 1ZS5A 4QSVA 4N4GA 3UW9A 4N4HA 2H60A 5F5ZA 1WUMA 5D26A 3P1EA 4QUTA 4LZRA 4O7AA 4YH4A 5FFYA 2YELA 4J0SA 4UYHA 4J0RA 5FFWA 5F63A 4TT6A 5HQ5A 4OGIA 5D0CA 5IGLA 3JVMA 4NR7A 5D3SA 5DW1A 5EQ1A 5IBNA 5DBMA 4MEOA 3LQIA 5I29A 3ONIA 5I7XA 4Y03A 3TLPA 4LC2A 4PY6A 4PKLA 5FE8A 5CRMA 5C7NA 4YADA 4LRGA 5FE6A 5EM3A 5HJCA 5F60A 5IIDA 4N4IA 4MR3A 4X2IA 5FG6A 5CQ3A 4CURA 4KV1A 5COIA 5FE4A 4NQMA 4HXMA 5HRXA 5FB0A 4HXLA 5F3AA 3G0LA 4XUBA 5D3TA 5D24A 4Q0OA 5D3RA 5D25A 4A9JA 3U5NA 4NYVA 5BT5A 4J1PA 4TT2A 4IR3A 4UIVA 3SVHA 2YEMA 2D82A 5DX4A 5CU8A 4YBTA 4UYFB 5EWVA 5DLZA 4YYDA 2E3KA 3O34A 4ALHA 4QUUA 3UVDA 5FE0A 4O7EA 4YC9A 4ZQLA 4XUAA 5F61A 5TB6A 5ENHA 5D3JA 1E6IA 2WP1A 2LSPB 5HCLA 5D3LA 4IOOA 5EI4A 4OUFA 3GG3A 5EA1A 5EWCA 5E9MA 5ENCA 5ETDA 5LVQA 5HFQA 5A81A 4NQNA 4IORA 4QB3A 2E7NA 5DFCA 3U5OA 4TQNA 2KTBB 5EPSA 4YK0A 4ZW1A 3P5OA 5DY7A 5I40A 5FE9A 5ENIA 5EICA 4CFKA 5K29A 5E9LA 4A9LA 4CUSA 4UITA 5FE2A 4MR6A 2FSAA 5DW2A 5EP7A 2DATA 5C87A 4A9MA 5EV9A 5CGPA 1WUGA 3SVFA 5IGNA 4O71A 4CUPA 2E7OA 2OUOA 3O37A 5CQ4A 5LJ1A 4NUDA 4UIYA 5A5NA 3LQJA 2OO1A 4E96A 4QSXA 2OSSA 5FBXA 5A83A 4O72A 5HQ7A 5E3DA 4YY6A 5A5QA 5CUCA 5L96A 2NXBA 3LXJA 4QNSA 4A9OA 4NR9A 4WIVA 4CUQA 4HBWA 5G4RA 4O70A 5LKZA 3I3JA 3P1FA 4LYWA 4QR5A 5H1TA 2YYNA 5D3NA 5I86A 1X0JA 4QSSA 5CRZA 4O77A 5ENGA 4RVRA 5E9KA 4YYJA 5EU1A 3G0JA 4QYLA 3O33A 4IOQA 5CQ7A 5L8TA 5F1LA 3UVXA 4A9IA 3HMEA 5KO4A 1N72A 4A9NA 5CP5A 5CUGA 5FE7A 5AD3A 4PCEA 5E74A 5FH7A 5E9YA 5EVAA 5E9IA 4QYDA 5KU3A 3MB3A 4NYWA 4CUTA 4YY4A 3UV4A 3Q2EA 4N3WA 3RCWA 2DVVA 5D7XA 3HMHA 4IR5A 4KV4A 2F6NA 4BW1A 3UV2A 5F25A 5EWWA 4WHUA 5C89A 3P1CA 3DAIA 2G4AA 4QSTA 5IGKA 5I83A 4UYFA 4UYEA 4Q0NA 5FG4A 5DYUA 3SVGA 4NR8A 5E3GA 3JVLA 4F3IA 3ZYUA 4IR4A 3LQHA 5CUDA 4NS5A 5A5OA 5EPRA 5L99A 5F36A 5ENBA 5LJ2A 5TCMA 4NUEA 4Z6HA 4O75A 2YDWA 4BW4A 4YYIA 3QZTA 5E73A 4QC1A 3UV5A 4QR4A 4NXJA 4UIUA 4NYXA 2RNYA 5ENFA 3AQAA 4YYNA 2YW5A 2R0SA 5EISA 5DKDA 5HEMA 3U5MA 5A5SA 5BT3A 3IU5A 5HM0A 4CUUA 4KCXA 4NR4A 4HXOA 4O7CA 5C85A 4MR4A 4UIXA 4QSWA 4N4FA 5DKHA 3U5PA 5I1QA 5I89A 2DVRA 2RS9B 5G4SA 5A85A 2L84A 4NRBA 4UIZA 5H1UA 1JM4B 4AKNA 3QZSA 4XY8A 4TTEA 3D7CA 5C8GA 3JVKA 3MXFA 4GPJA 4Z1SA 4TZ8A 4C67A 2WP2A 4XYAA 3LJWA 5CPEA 4NR5A 5CQ6A 2RFJA 4CFLA 2I8NA 5EPBA 5I7YA 5CQ5A 4QSUA 5KHMA 4A9EA 4HXKA 4MEPA 4YYMA 4PCIA 5DYCA 4XY9A 5ACYA 4NR6A 5HRVA 5L98A 5AMFA 4NUCA 4YATA 4O7BA 4YYKA
chains in the Genus database with same CATH superfamily
4ZC9A 4HXSA 4HXRA 5A5RA 3U5KA 4QC3A 2R0VA 3HMFA 4QSRA 4TZ2A 5CQ8A 2R0YA 4TT4A 5DLXA 4NRCA 4QZSA 4YBMA 4LR6A 3UVYA 5FE5A 4TS8A 5JI8A 5CTLA 4OGJA 5A7CA 5LUUA 2GRCA 5A5PA 2RNWA 5HENA 5CFWA 5BT4A 4PTBA 3IU6A 5AD2A 4O7FA 4C66A 5F62A 4QBMA 4TU4A 5II1A 5DYAA 4NRAA 4QR3A 4HXNA 4CL9A 4O76A 5CY9A 4CLBA 2L5EA 2DVQA 2F6JA 3JVJA 5L8UA 4A9FA 5IGMA 4UYDA 5ENEA 4MR5A 4BW3A 4LDFA 2L85A 4TYLA 3MUKA 4MENA 4IR6A 5KTWA 5LVRA 5FG5A 5CUAA 5CS8A 5CUBA 4HBYA 5HRWA 4Z93A 5EGUA 3S91A 2RNXA 4TU6A 5E7DA 3AADA 4LZ2A 3Q2FA 5F1HA 4A9KA 2DKWA 5HFRA 4PS5A 4LZSA 5L97A 4YH3A 4Z6IA 3D1BA 4QSPA 4HXPA 5FDZA 5CZGA 3UVWA 4ALGA 5LKTA 4WHWA 4BJXA 5DFBA 3K2JA 5EWDA 5HQ6A 5CQAA 5D3HA 1JSPB 5FFVA 4DONA 5EWHA 4BW2A 5DYXA 2YEKA 3DWYA 4QY4A 5HELA 4A9HA 2I7KA 4QSQA 5KTUA 3O36A 4MEQA 5D3PA 4Z1QA 4LYIA 5LKXA 4YBSA 5FB1A 5KTXA 1F68A 3MQMA 5EK9A 5C4QA 3U5LA 4YYGA 5HLSA 5FH8A 5LKUA 2N9GA 5JWMA 5J0DA 4HBVA 2DWWA 5E0RA 1EQFA 3S92A 2MJVB 5ENJA 5H1VA 4YYHA 5I88A 4FLPA 4O78A 4O74A 4YABA 4BHWA 4UIWA 2R10A 5I80A 5A82A 4HBXA 4QEVA 4UYGA 5FE3A 3MULA 5E9VA 5DKCA 2RI7A 4YAXA 3NXBA 3O35A 3P1DA 5IG6A 2YQDA 5CUEA 2DVSA 4QEUA 5ETBA 4LYSA 3MB4A 5FH6A 5DFDA 5H85A 3QZVA 2RO1A 5II2A 3U5JA 4J3IA 2D9EA 5F2PA 5CQTA 5AMEA 5FE1A 5LJ0A 3FKMX 4QEWA 1ZS5A 4QSVA 4N4GA 3UW9A 4N4HA 2H60A 5F5ZA 1WUMA 5D26A 3P1EA 4QUTA 4LZRA 4O7AA 4YH4A 5FFYA 2YELA 4J0SA 4UYHA 4J0RA 5FFWA 5F63A 4TT6A 5HQ5A 4OGIA 5D0CA 5IGLA 3JVMA 4NR7A 5D3SA 5DW1A 5EQ1A 5IBNA 5DBMA 4MEOA 3LQIA 5I29A 3ONIA 5I7XA 4Y03A 3TLPA 4LC2A 4PY6A 4PKLA 5FE8A 5CRMA 5C7NA 4YADA 4LRGA 1PUOA 5FE6A 5EM3A 5HJCA 5F60A 5IIDA 4AKIA 4N4IA 4MR3A 4X2IA 5FG6A 5CQ3A 4CURA 4KV1A 5COIA 5FE4A 4NQMA 4HXMA 5HRXA 5FB0A 4HXLA 5F3AA 3G0LA 4XUBA 5D3TA 5D24A 4Q0OA 5D3RA 5D25A 4A9JA 3U5NA 4NYVA 5BT5A 4J1PA 4TT2A 4IR3A 4UIVA 3SVHA 2YEMA 2D82A 5DX4A 5CU8A 4YBTA 4UYFB 5EWVA 5DLZA 4YYDA 2E3KA 3O34A 4ALHA 4QUUA 3VKHA 3UVDA 5FE0A 4O7EA 4YC9A 4ZQLA 4XUAA 5F61A 5TB6A 5ENHA 5D3JA 1E6IA 2WP1A 2LSPB 5HCLA 5D3LA 4IOOA 5EI4A 4OUFA 3GG3A 5EA1A 5EWCA 5E9MA 5ENCA 5ETDA 5LVQA 5HFQA 5A81A 4NQNA 4IORA 4QB3A 2E7NA 5DFCA 3U5OA 4TQNA 2KTBB 5EPSA 4YK0A 4ZW1A 3P5OA 5DY7A 5I40A 5FE9A 5ENIA 5EICA 4CFKA 5K29A 5E9LA 4A9LA 4CUSA 4UITA 5FE2A 4MR6A 4AKGA 2FSAA 5DW2A 5EP7A 2DATA 5C87A 4A9MA 5EV9A 5CGPA 1WUGA 3SVFA 5IGNA 4O71A 4CUPA 2E7OA 2OUOA 3O37A 5CQ4A 5LJ1A 4NUDA 4UIYA 5A5NA 3LQJA 2OO1A 4E96A 4QSXA 2OSSA 5FBXA 5A83A 4O72A 5HQ7A 5E3DA 4YY6A 5A5QA 5CUCA 5L96A 2NXBA 3LXJA 4QNSA 4A9OA 4NR9A 4WIVA 4CUQA 4HBWA 5G4RA 4O70A 5LKZA 3I3JA 3P1FA 4LYWA 4QR5A 5H1TA 4AKHA 2YYNA 5D3NA 5I86A 1X0JA 4QSSA 5CRZA 3D1DA 4O77A 5ENGA 4RVRA 5E9KA 4YYJA 5EU1A 3G0JA 4QYLA 3O33A 4IOQA 5CQ7A 5L8TA 5F1LA 3UVXA 4A9IA 3HMEA 5KO4A 1N72A 4A9NA 5CP5A 5CUGA 5FE7A 5AD3A 4PCEA 5E74A 5FH7A 5E9YA 5EVAA 5E9IA 4QYDA 3ERRA 5KU3A 3MB3A 4NYWA 4CUTA 4YY4A 3UV4A 3Q2EA 4N3WA 3RCWA 2DVVA 5D7XA 3HMHA 4IR5A 4KV4A 2F6NA 3VKGA 4BW1A 3UV2A 5F25A 1ZKRA 5EWWA 4WHUA 5C89A 3P1CA 3DAIA 2G4AA 4QSTA 5IGKA 5I83A 4UYFA 4UYEA 4Q0NA 5FG4A 5DYUA 3SVGA 4NR8A 5E3GA 3JVLA 4F3IA 3ZYUA 4IR4A 3LQHA 5CUDA 4NS5A 5A5OA 5EPRA 5L99A 5F36A 5ENBA 5LJ2A 5TCMA 4NUEA 4Z6HA 4O75A 2YDWA 4BW4A 4YYIA 3QZTA 5E73A 4QC1A 3UV5A 4QR4A 4NXJA 4UIUA 4NYXA 2RNYA 5ENFA 3AQAA 4YYNA 2YW5A 2R0SA 5EISA 5DKDA 5HEMA 3U5MA 5A5SA 5BT3A 3IU5A 2EJNA 5HM0A 4CUUA 4KCXA 4NR4A 4HXOA 4O7CA 5C85A 4MR4A 4UIXA 4QSWA 4N4FA 5DKHA 3U5PA 5I1QA 5I89A 2DVRA 2RS9B 5G4SA 5A85A 2L84A 4NRBA 4UIZA 5H1UA 1JM4B 4AKNA 3QZSA 4XY8A 4TTEA 3D7CA 5C8GA 3JVKA 3MXFA 4GPJA 4Z1SA 4TZ8A 4C67A 2WP2A 4XYAA 3LJWA 5CPEA 4AI6A 4NR5A 5CQ6A 2RFJA 4CFLA 2I8NA 5EPBA 5I7YA 5CQ5A 4QSUA 5KHMA 4A9EA 4HXKA 4MEPA 4YYMA 4PCIA 5DYCA 4XY9A 5ACYA 4NR6A 5HRVA 5L98A 5AMFA 4NUCA 4YATA 4O7BA 4YYKA
chains in the Genus database with same CATH topology
4ZC9A 4HXSA 4HXRA 5A5RA 3U5KA 4QC3A 2R0VA 3HMFA 4QSRA 4TZ2A 5CQ8A 2R0YA 4TT4A 5DLXA 4NRCA 4QZSA 4YBMA 4LR6A 3UVYA 5FE5A 4TS8A 5JI8A 5CTLA 4OGJA 5A7CA 5LUUA 2GRCA 5A5PA 2RNWA 5HENA 5CFWA 5BT4A 4PTBA 3IU6A 5AD2A 4O7FA 4C66A 5F62A 4QBMA 4TU4A 5II1A 5DYAA 4NRAA 4QR3A 4HXNA 4CL9A 4O76A 5CY9A 4CLBA 2L5EA 2DVQA 2F6JA 3JVJA 5L8UA 4A9FA 5IGMA 4UYDA 5ENEA 4MR5A 4BW3A 4LDFA 2L85A 4TYLA 3MUKA 4MENA 4IR6A 5KTWA 5LVRA 5FG5A 5CUAA 5CS8A 5CUBA 4HBYA 5HRWA 4Z93A 5EGUA 3S91A 2RNXA 4TU6A 5E7DA 3AADA 4LZ2A 3Q2FA 5F1HA 4A9KA 2DKWA 5HFRA 4PS5A 4LZSA 5L97A 4YH3A 4Z6IA 4QSPA 4HXPA 5FDZA 5CZGA 3UVWA 4ALGA 5LKTA 4WHWA 4BJXA 5DFBA 3K2JA 5EWDA 5HQ6A 5CQAA 5D3HA 1JSPB 5FFVA 4DONA 5EWHA 4BW2A 5DYXA 2YEKA 3DWYA 4QY4A 5HELA 4A9HA 2I7KA 4QSQA 5KTUA 3O36A 4MEQA 5D3PA 4Z1QA 4LYIA 5LKXA 4YBSA 5FB1A 5KTXA 1F68A 3MQMA 5EK9A 5C4QA 3U5LA 4YYGA 5HLSA 5FH8A 5LKUA 2N9GA 5JWMA 5J0DA 4HBVA 2DWWA 5E0RA 1EQFA 3S92A 2MJVB 5ENJA 5H1VA 4YYHA 5I88A 4FLPA 4O78A 4O74A 4YABA 4BHWA 4UIWA 2R10A 5I80A 5A82A 4HBXA 4QEVA 4UYGA 5FE3A 3MULA 5E9VA 5DKCA 2RI7A 4YAXA 3NXBA 3O35A 3P1DA 5IG6A 2YQDA 5CUEA 2DVSA 4QEUA 5ETBA 4LYSA 3MB4A 5FH6A 5DFDA 5H85A 3QZVA 2RO1A 5II2A 3U5JA 4J3IA 2D9EA 5F2PA 5CQTA 5AMEA 5FE1A 5LJ0A 3FKMX 4QEWA 1ZS5A 4QSVA 4N4GA 3UW9A 4N4HA 2H60A 5F5ZA 1WUMA 5D26A 3P1EA 4QUTA 4LZRA 4O7AA 4YH4A 5FFYA 2YELA 4J0SA 4UYHA 4J0RA 5FFWA 5F63A 4TT6A 5HQ5A 4OGIA 5D0CA 5IGLA 3JVMA 4NR7A 5D3SA 5DW1A 5EQ1A 5IBNA 5DBMA 4MEOA 3LQIA 5I29A 3ONIA 5I7XA 4Y03A 3TLPA 4LC2A 4PY6A 4PKLA 5FE8A 5CRMA 5C7NA 4YADA 4LRGA 5FE6A 5EM3A 5HJCA 5F60A 5IIDA 4N4IA 4MR3A 4X2IA 5FG6A 5CQ3A 4CURA 4KV1A 5COIA 5FE4A 4NQMA 4HXMA 5HRXA 5FB0A 4HXLA 5F3AA 3G0LA 4XUBA 5D3TA 5D24A 4Q0OA 5D3RA 5D25A 4A9JA 3U5NA 4NYVA 5BT5A 4J1PA 4TT2A 4IR3A 4UIVA 3SVHA 2YEMA 2D82A 5DX4A 5CU8A 4YBTA 4UYFB 5EWVA 5DLZA 4YYDA 2E3KA 3O34A 4ALHA 4QUUA 3UVDA 5FE0A 4O7EA 4YC9A 4ZQLA 4XUAA 5F61A 5TB6A 5ENHA 5D3JA 1E6IA 2WP1A 2LSPB 5HCLA 5D3LA 4IOOA 5EI4A 4OUFA 3GG3A 5EA1A 5EWCA 5E9MA 5ENCA 5ETDA 5LVQA 5HFQA 5A81A 4NQNA 4IORA 4QB3A 2E7NA 5DFCA 3U5OA 4TQNA 2KTBB 5EPSA 4YK0A 4ZW1A 3P5OA 5DY7A 5I40A 5FE9A 5ENIA 5EICA 4CFKA 5K29A 5E9LA 4A9LA 4CUSA 4UITA 5FE2A 4MR6A 2FSAA 5DW2A 5EP7A 2DATA 5C87A 4A9MA 5EV9A 5CGPA 1WUGA 3SVFA 5IGNA 4O71A 4CUPA 2E7OA 2OUOA 3O37A 5CQ4A 5LJ1A 4NUDA 4UIYA 5A5NA 3LQJA 2OO1A 4E96A 4QSXA 2OSSA 5FBXA 5A83A 4O72A 5HQ7A 5E3DA 4YY6A 5A5QA 5CUCA 5L96A 2NXBA 3LXJA 4QNSA 4A9OA 4NR9A 4WIVA 4CUQA 4HBWA 5G4RA 4O70A 5LKZA 3I3JA 3P1FA 4LYWA 4QR5A 5H1TA 2YYNA 5D3NA 5I86A 1X0JA 4QSSA 5CRZA 4O77A 5ENGA 4RVRA 5E9KA 4YYJA 5EU1A 3G0JA 4QYLA 3O33A 4IOQA 5CQ7A 5L8TA 5F1LA 3UVXA 4A9IA 3HMEA 5KO4A 1N72A 4A9NA 5CP5A 5CUGA 5FE7A 5AD3A 4PCEA 5E74A 5FH7A 5E9YA 5EVAA 5E9IA 4QYDA 5KU3A 3MB3A 4NYWA 4CUTA 4YY4A 3UV4A 3Q2EA 4N3WA 3RCWA 2DVVA 5D7XA 3HMHA 4IR5A 4KV4A 2F6NA 4BW1A 3UV2A 5F25A 5EWWA 4WHUA 5C89A 3P1CA 3DAIA 2G4AA 4QSTA 5IGKA 5I83A 4UYFA 4UYEA 4Q0NA 5FG4A 5DYUA 3SVGA 4NR8A 5E3GA 3JVLA 4F3IA 3ZYUA 4IR4A 3LQHA 5CUDA 4NS5A 5A5OA 5EPRA 5L99A 5F36A 5ENBA 5LJ2A 5TCMA 4NUEA 4Z6HA 4O75A 2YDWA 4BW4A 4YYIA 3QZTA 5E73A 4QC1A 3UV5A 4QR4A 4NXJA 4UIUA 4NYXA 2RNYA 5ENFA 3AQAA 4YYNA 2YW5A 2R0SA 5EISA 5DKDA 5HEMA 3U5MA 5A5SA 5BT3A 3IU5A 5HM0A 4CUUA 4KCXA 4NR4A 4HXOA 4O7CA 5C85A 4MR4A 4UIXA 4QSWA 4N4FA 5DKHA 3U5PA 5I1QA 5I89A 2DVRA 2RS9B 5G4SA 5A85A 2L84A 4NRBA 4UIZA 5H1UA 1JM4B 4AKNA 3QZSA 4XY8A 4TTEA 3D7CA 5C8GA 3JVKA 3MXFA 4GPJA 4Z1SA 4TZ8A 4C67A 2WP2A 4XYAA 3LJWA 5CPEA 4NR5A 5CQ6A 2RFJA 4CFLA 2I8NA 5EPBA 5I7YA 5CQ5A 4QSUA 5KHMA 4A9EA 4HXKA 4MEPA 4YYMA 4PCIA 5DYCA 4XY9A 5ACYA 4NR6A 5HRVA 5L98A 5AMFA 4NUCA 4YATA 4O7BA 4YYKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZC9 A;  4HXS A;  4HXR A;  5A5R A;  3U5K A;  4QC3 A;  2R0V A;  3HMF A;  4QSR A;  4TZ2 A;  5CQ8 A;  2R0Y A;  4TT4 A;  5DLX A;  4NRC A;  4QZS A;  4YBM A;  4LR6 A;  3UVY A;  5FE5 A;  4TS8 A;  5JI8 A;  5CTL A;  4OGJ A;  5A7C A;  5LUU A;  2GRC A;  5A5P A;  2RNW A;  5HEN A;  5CFW A;  5BT4 A;  4PTB A;  3IU6 A;  5AD2 A;  4O7F A;  4C66 A;  5F62 A;  4QBM A;  4TU4 A;  5II1 A;  5DYA A;  4NRA A;  4QR3 A;  4HXN A;  4CL9 A;  4O76 A;  5CY9 A;  4CLB A;  2L5E A;  2DVQ A;  2F6J A;  3JVJ A;  5L8U A;  4A9F A;  5IGM A;  4UYD A;  5ENE A;  4MR5 A;  4BW3 A;  4LDF A;  2L85 A;  4TYL A;  3MUK A;  4MEN A;  4IR6 A;  5KTW A;  5LVR A;  5FG5 A;  5CUA A;  5CS8 A;  5CUB A;  4HBY A;  5HRW A;  4Z93 A;  5EGU A;  3S91 A;  2RNX A;  4TU6 A;  5E7D A;  3AAD A;  4LZ2 A;  3Q2F A;  5F1H A;  4A9K A;  2DKW A;  5HFR A;  4PS5 A;  4LZS A;  5L97 A;  4YH3 A;  4Z6I A;  4QSP A;  4HXP A;  5FDZ A;  5CZG A;  3UVW A;  4ALG A;  5LKT A;  4WHW A;  4BJX A;  5DFB A;  3K2J A;  5EWD A;  5HQ6 A;  5CQA A;  5D3H A;  1JSP B;  5FFV A;  4DON A;  5EWH A;  4BW2 A;  5DYX A;  2YEK A;  3DWY A;  4QY4 A;  5HEL A;  4A9H A;  2I7K A;  4QSQ A;  5KTU A;  3O36 A;  4MEQ A;  5D3P A;  4Z1Q A;  4LYI A;  5LKX A;  4YBS A;  5FB1 A;  5KTX A;  1F68 A;  3MQM A;  5EK9 A;  5C4Q A;  3U5L A;  4YYG A;  5HLS A;  5FH8 A;  5LKU A;  2N9G A;  5JWM A;  5J0D A;  4HBV A;  2DWW A;  5E0R A;  1EQF A;  3S92 A;  2MJV B;  5ENJ A;  5H1V A;  4YYH A;  5I88 A;  4FLP A;  4O78 A;  4O74 A;  4YAB A;  4BHW A;  4UIW A;  2R10 A;  5I80 A;  5A82 A;  4HBX A;  4QEV A;  4UYG A;  5FE3 A;  3MUL A;  5E9V A;  5DKC A;  2RI7 A;  4YAX A;  3NXB A;  3O35 A;  3P1D A;  5IG6 A;  2YQD A;  5CUE A;  2DVS A;  4QEU A;  5ETB A;  4LYS A;  3MB4 A;  5FH6 A;  5DFD A;  5H85 A;  3QZV A;  2RO1 A;  5II2 A;  3U5J A;  4J3I A;  2D9E A;  5F2P A;  5CQT A;  5AME A;  5FE1 A;  5LJ0 A;  3FKM X;  4QEW A;  1ZS5 A;  4QSV A;  4N4G A;  3UW9 A;  4N4H A;  2H60 A;  5F5Z A;  1WUM A;  5D26 A;  3P1E A;  4QUT A;  4LZR A;  4O7A A;  4YH4 A;  5FFY A;  2YEL A;  4J0S A;  4UYH A;  4J0R A;  5FFW A;  5F63 A;  4TT6 A;  5HQ5 A;  4OGI A;  5D0C A;  5IGL A;  3JVM A;  4NR7 A;  5D3S A;  5DW1 A;  5EQ1 A;  5IBN A;  5DBM A;  4MEO A;  3LQI A;  5I29 A;  3ONI A;  5I7X A;  4Y03 A;  3TLP A;  4LC2 A;  4PY6 A;  4PKL A;  5FE8 A;  5CRM A;  5C7N A;  4YAD A;  4LRG A;  5FE6 A;  5EM3 A;  5HJC A;  5F60 A;  5IID A;  4N4I A;  4MR3 A;  4X2I A;  5FG6 A;  5CQ3 A;  4CUR A;  4KV1 A;  5COI A;  5FE4 A;  4NQM A;  4HXM A;  5HRX A;  5FB0 A;  4HXL A;  5F3A A;  3G0L A;  4XUB A;  5D3T A;  5D24 A;  4Q0O A;  5D3R A;  5D25 A;  4A9J A;  3U5N A;  4NYV A;  5BT5 A;  4J1P A;  4TT2 A;  4IR3 A;  4UIV A;  3SVH A;  2YEM A;  2D82 A;  5DX4 A;  5CU8 A;  4YBT A;  4UYF B;  5EWV A;  5DLZ A;  4YYD A;  2E3K A;  3O34 A;  4ALH A;  4QUU A;  3UVD A;  5FE0 A;  4O7E A;  4YC9 A;  4ZQL A;  4XUA A;  5F61 A;  5TB6 A;  5ENH A;  5D3J A;  1E6I A;  2WP1 A;  2LSP B;  5HCL A;  5D3L A;  4IOO A;  5EI4 A;  4OUF A;  3GG3 A;  5EA1 A;  5EWC A;  5E9M A;  5ENC A;  5ETD A;  5LVQ A;  5HFQ A;  5A81 A;  4NQN A;  4IOR A;  4QB3 A;  2E7N A;  5DFC A;  3U5O A;  4TQN A;  2KTB B;  5EPS A;  4YK0 A;  4ZW1 A;  3P5O A;  5DY7 A;  5I40 A;  5FE9 A;  5ENI A;  5EIC A;  4CFK A;  5K29 A;  5E9L A;  4A9L A;  4CUS A;  4UIT A;  5FE2 A;  4MR6 A;  2FSA A;  5DW2 A;  5EP7 A;  2DAT A;  5C87 A;  4A9M A;  5EV9 A;  5CGP A;  1WUG A;  3SVF A;  5IGN A;  4O71 A;  4CUP A;  2E7O A;  2OUO A;  3O37 A;  5CQ4 A;  5LJ1 A;  4NUD A;  4UIY A;  5A5N A;  3LQJ A;  2OO1 A;  4E96 A;  4QSX A;  2OSS A;  5FBX A;  5A83 A;  4O72 A;  5HQ7 A;  5E3D A;  4YY6 A;  5A5Q A;  5CUC A;  5L96 A;  2NXB A;  3LXJ A;  4QNS A;  4A9O A;  4NR9 A;  4WIV A;  4CUQ A;  4HBW A;  5G4R A;  4O70 A;  5LKZ A;  3I3J A;  3P1F A;  4LYW A;  4QR5 A;  5H1T A;  2YYN A;  5D3N A;  5I86 A;  1X0J A;  4QSS A;  5CRZ A;  4O77 A;  5ENG A;  4RVR A;  5E9K A;  4YYJ A;  5EU1 A;  3G0J A;  4QYL A;  3O33 A;  4IOQ A;  5CQ7 A;  5L8T A;  5F1L A;  3UVX A;  4A9I A;  3HME A;  5KO4 A;  1N72 A;  4A9N A;  5CP5 A;  5CUG A;  5FE7 A;  5AD3 A;  4PCE A;  5E74 A;  5FH7 A;  5E9Y A;  5EVA A;  5E9I A;  4QYD A;  5KU3 A;  3MB3 A;  4NYW A;  4CUT A;  4YY4 A;  3UV4 A;  3Q2E A;  4N3W A;  3RCW A;  2DVV A;  5D7X A;  3HMH A;  4IR5 A;  4KV4 A;  2F6N A;  4BW1 A;  3UV2 A;  5F25 A;  5EWW A;  4WHU A;  5C89 A;  3P1C A;  3DAI A;  2G4A A;  4QST A;  5IGK A;  5I83 A;  4UYF A;  4UYE A;  4Q0N A;  5FG4 A;  5DYU A;  3SVG A;  4NR8 A;  5E3G A;  3JVL A;  4F3I A;  3ZYU A;  4IR4 A;  3LQH A;  5CUD A;  4NS5 A;  5A5O A;  5EPR A;  5L99 A;  5F36 A;  5ENB A;  5LJ2 A;  5TCM A;  4NUE A;  4Z6H A;  4O75 A;  2YDW A;  4BW4 A;  4YYI A;  3QZT A;  5E73 A;  4QC1 A;  3UV5 A;  4QR4 A;  4NXJ A;  4UIU A;  4NYX A;  2RNY A;  5ENF A;  3AQA A;  4YYN A;  2YW5 A;  2R0S A;  5EIS A;  5DKD A;  5HEM A;  3U5M A;  5A5S A;  5BT3 A;  3IU5 A;  5HM0 A;  4CUU A;  4KCX A;  4NR4 A;  4HXO A;  4O7C A;  5C85 A;  4MR4 A;  4UIX A;  4QSW A;  4N4F A;  5DKH A;  3U5P A;  5I1Q A;  5I89 A;  2DVR A;  2RS9 B;  5G4S A;  5A85 A;  2L84 A;  4NRB A;  4UIZ A;  5H1U A;  1JM4 B;  4AKN A;  3QZS A;  4XY8 A;  4TTE A;  3D7C A;  5C8G A;  3JVK A;  3MXF A;  4GPJ A;  4Z1S A;  4TZ8 A;  4C67 A;  2WP2 A;  4XYA A;  3LJW A;  5CPE A;  4NR5 A;  5CQ6 A;  2RFJ A;  4CFL A;  2I8N A;  5EPB A;  5I7Y A;  5CQ5 A;  4QSU A;  5KHM A;  4A9E A;  4HXK A;  4MEP A;  4YYM A;  4PCI A;  5DYC A;  4XY9 A;  5ACY A;  4NR6 A;  5HRV A;  5L98 A;  5AMF A;  4NUC A;  4YAT A;  4O7B A;  4YYK A; 
#chains in the Genus database with same CATH topology
 4ZC9 A;  4HXS A;  4HXR A;  5A5R A;  3U5K A;  4QC3 A;  2R0V A;  3HMF A;  4QSR A;  4TZ2 A;  5CQ8 A;  2R0Y A;  4TT4 A;  5DLX A;  4NRC A;  4QZS A;  4YBM A;  4LR6 A;  3UVY A;  5FE5 A;  4TS8 A;  5JI8 A;  5CTL A;  4OGJ A;  5A7C A;  5LUU A;  2GRC A;  5A5P A;  2RNW A;  5HEN A;  5CFW A;  5BT4 A;  4PTB A;  3IU6 A;  5AD2 A;  4O7F A;  4C66 A;  5F62 A;  4QBM A;  4TU4 A;  5II1 A;  5DYA A;  4NRA A;  4QR3 A;  4HXN A;  4CL9 A;  4O76 A;  5CY9 A;  4CLB A;  2L5E A;  2DVQ A;  2F6J A;  3JVJ A;  5L8U A;  4A9F A;  5IGM A;  4UYD A;  5ENE A;  4MR5 A;  4BW3 A;  4LDF A;  2L85 A;  4TYL A;  3MUK A;  4MEN A;  4IR6 A;  5KTW A;  5LVR A;  5FG5 A;  5CUA A;  5CS8 A;  5CUB A;  4HBY A;  5HRW A;  4Z93 A;  5EGU A;  3S91 A;  2RNX A;  4TU6 A;  5E7D A;  3AAD A;  4LZ2 A;  3Q2F A;  5F1H A;  4A9K A;  2DKW A;  5HFR A;  4PS5 A;  4LZS A;  5L97 A;  4YH3 A;  4Z6I A;  3D1B A;  4QSP A;  4HXP A;  5FDZ A;  5CZG A;  3UVW A;  4ALG A;  5LKT A;  4WHW A;  4BJX A;  5DFB A;  3K2J A;  5EWD A;  5HQ6 A;  5CQA A;  5D3H A;  1JSP B;  5FFV A;  4DON A;  5EWH A;  4BW2 A;  5DYX A;  2YEK A;  3DWY A;  4QY4 A;  5HEL A;  4A9H A;  2I7K A;  4QSQ A;  5KTU A;  3O36 A;  4MEQ A;  5D3P A;  4Z1Q A;  4LYI A;  5LKX A;  4YBS A;  5FB1 A;  5KTX A;  1F68 A;  3MQM A;  5EK9 A;  5C4Q A;  3U5L A;  4YYG A;  5HLS A;  5FH8 A;  5LKU A;  2N9G A;  5JWM A;  5J0D A;  4HBV A;  2DWW A;  5E0R A;  1EQF A;  3S92 A;  2MJV B;  5ENJ A;  5H1V A;  4YYH A;  5I88 A;  4FLP A;  4O78 A;  4O74 A;  4YAB A;  4BHW A;  4UIW A;  2R10 A;  5I80 A;  5A82 A;  4HBX A;  4QEV A;  4UYG A;  5FE3 A;  3MUL A;  5E9V A;  5DKC A;  2RI7 A;  4YAX A;  3NXB A;  3O35 A;  3P1D A;  5IG6 A;  2YQD A;  5CUE A;  2DVS A;  4QEU A;  5ETB A;  4LYS A;  3MB4 A;  5FH6 A;  5DFD A;  5H85 A;  3QZV A;  2RO1 A;  5II2 A;  3U5J A;  4J3I A;  2D9E A;  5F2P A;  5CQT A;  5AME A;  5FE1 A;  5LJ0 A;  3FKM X;  4QEW A;  1ZS5 A;  4QSV A;  4N4G A;  3UW9 A;  4N4H A;  2H60 A;  5F5Z A;  1WUM A;  5D26 A;  3P1E A;  4QUT A;  4LZR A;  4O7A A;  4YH4 A;  5FFY A;  2YEL A;  4J0S A;  4UYH A;  4J0R A;  5FFW A;  5F63 A;  4TT6 A;  5HQ5 A;  4OGI A;  5D0C A;  5IGL A;  3JVM A;  4NR7 A;  5D3S A;  5DW1 A;  5EQ1 A;  5IBN A;  5DBM A;  4MEO A;  3LQI A;  5I29 A;  3ONI A;  5I7X A;  4Y03 A;  3TLP A;  4LC2 A;  4PY6 A;  4PKL A;  5FE8 A;  5CRM A;  5C7N A;  4YAD A;  4LRG A;  1PUO A;  5FE6 A;  5EM3 A;  5HJC A;  5F60 A;  5IID A;  4AKI A;  4N4I A;  4MR3 A;  4X2I A;  5FG6 A;  5CQ3 A;  4CUR A;  4KV1 A;  5COI A;  5FE4 A;  4NQM A;  4HXM A;  5HRX A;  5FB0 A;  4HXL A;  5F3A A;  3G0L A;  4XUB A;  5D3T A;  5D24 A;  4Q0O A;  5D3R A;  5D25 A;  4A9J A;  3U5N A;  4NYV A;  5BT5 A;  4J1P A;  4TT2 A;  4IR3 A;  4UIV A;  3SVH A;  2YEM A;  2D82 A;  5DX4 A;  5CU8 A;  4YBT A;  4UYF B;  5EWV A;  5DLZ A;  4YYD A;  2E3K A;  3O34 A;  4ALH A;  4QUU A;  3VKH A;  3UVD A;  5FE0 A;  4O7E A;  4YC9 A;  4ZQL A;  4XUA A;  5F61 A;  5TB6 A;  5ENH A;  5D3J A;  1E6I A;  2WP1 A;  2LSP B;  5HCL A;  5D3L A;  4IOO A;  5EI4 A;  4OUF A;  3GG3 A;  5EA1 A;  5EWC A;  5E9M A;  5ENC A;  5ETD A;  5LVQ A;  5HFQ A;  5A81 A;  4NQN A;  4IOR A;  4QB3 A;  2E7N A;  5DFC A;  3U5O A;  4TQN A;  2KTB B;  5EPS A;  4YK0 A;  4ZW1 A;  3P5O A;  5DY7 A;  5I40 A;  5FE9 A;  5ENI A;  5EIC A;  4CFK A;  5K29 A;  5E9L A;  4A9L A;  4CUS A;  4UIT A;  5FE2 A;  4MR6 A;  4AKG A;  2FSA A;  5DW2 A;  5EP7 A;  2DAT A;  5C87 A;  4A9M A;  5EV9 A;  5CGP A;  1WUG A;  3SVF A;  5IGN A;  4O71 A;  4CUP A;  2E7O A;  2OUO A;  3O37 A;  5CQ4 A;  5LJ1 A;  4NUD A;  4UIY A;  5A5N A;  3LQJ A;  2OO1 A;  4E96 A;  4QSX A;  2OSS A;  5FBX A;  5A83 A;  4O72 A;  5HQ7 A;  5E3D A;  4YY6 A;  5A5Q A;  5CUC A;  5L96 A;  2NXB A;  3LXJ A;  4QNS A;  4A9O A;  4NR9 A;  4WIV A;  4CUQ A;  4HBW A;  5G4R A;  4O70 A;  5LKZ A;  3I3J A;  3P1F A;  4LYW A;  4QR5 A;  5H1T A;  4AKH A;  2YYN A;  5D3N A;  5I86 A;  1X0J A;  4QSS A;  5CRZ A;  3D1D A;  4O77 A;  5ENG A;  4RVR A;  5E9K A;  4YYJ A;  5EU1 A;  3G0J A;  4QYL A;  3O33 A;  4IOQ A;  5CQ7 A;  5L8T A;  5F1L A;  3UVX A;  4A9I A;  3HME A;  5KO4 A;  1N72 A;  4A9N A;  5CP5 A;  5CUG A;  5FE7 A;  5AD3 A;  4PCE A;  5E74 A;  5FH7 A;  5E9Y A;  5EVA A;  5E9I A;  4QYD A;  3ERR A;  5KU3 A;  3MB3 A;  4NYW A;  4CUT A;  4YY4 A;  3UV4 A;  3Q2E A;  4N3W A;  3RCW A;  2DVV A;  5D7X A;  3HMH A;  4IR5 A;  4KV4 A;  2F6N A;  3VKG A;  4BW1 A;  3UV2 A;  5F25 A;  1ZKR A;  5EWW A;  4WHU A;  5C89 A;  3P1C A;  3DAI A;  2G4A A;  4QST A;  5IGK A;  5I83 A;  4UYF A;  4UYE A;  4Q0N A;  5FG4 A;  5DYU A;  3SVG A;  4NR8 A;  5E3G A;  3JVL A;  4F3I A;  3ZYU A;  4IR4 A;  3LQH A;  5CUD A;  4NS5 A;  5A5O A;  5EPR A;  5L99 A;  5F36 A;  5ENB A;  5LJ2 A;  5TCM A;  4NUE A;  4Z6H A;  4O75 A;  2YDW A;  4BW4 A;  4YYI A;  3QZT A;  5E73 A;  4QC1 A;  3UV5 A;  4QR4 A;  4NXJ A;  4UIU A;  4NYX A;  2RNY A;  5ENF A;  3AQA A;  4YYN A;  2YW5 A;  2R0S A;  5EIS A;  5DKD A;  5HEM A;  3U5M A;  5A5S A;  5BT3 A;  3IU5 A;  2EJN A;  5HM0 A;  4CUU A;  4KCX A;  4NR4 A;  4HXO A;  4O7C A;  5C85 A;  4MR4 A;  4UIX A;  4QSW A;  4N4F A;  5DKH A;  3U5P A;  5I1Q A;  5I89 A;  2DVR A;  2RS9 B;  5G4S A;  5A85 A;  2L84 A;  4NRB A;  4UIZ A;  5H1U A;  1JM4 B;  4AKN A;  3QZS A;  4XY8 A;  4TTE A;  3D7C A;  5C8G A;  3JVK A;  3MXF A;  4GPJ A;  4Z1S A;  4TZ8 A;  4C67 A;  2WP2 A;  4XYA A;  3LJW A;  5CPE A;  4AI6 A;  4NR5 A;  5CQ6 A;  2RFJ A;  4CFL A;  2I8N A;  5EPB A;  5I7Y A;  5CQ5 A;  4QSU A;  5KHM A;  4A9E A;  4HXK A;  4MEP A;  4YYM A;  4PCI A;  5DYC A;  4XY9 A;  5ACY A;  4NR6 A;  5HRV A;  5L98 A;  5AMF A;  4NUC A;  4YAT A;  4O7B A;  4YYK A; 
#chains in the Genus database with same CATH homology
 4ZC9 A;  4HXS A;  4HXR A;  5A5R A;  3U5K A;  4QC3 A;  2R0V A;  3HMF A;  4QSR A;  4TZ2 A;  5CQ8 A;  2R0Y A;  4TT4 A;  5DLX A;  4NRC A;  4QZS A;  4YBM A;  4LR6 A;  3UVY A;  5FE5 A;  4TS8 A;  5JI8 A;  5CTL A;  4OGJ A;  5A7C A;  5LUU A;  2GRC A;  5A5P A;  2RNW A;  5HEN A;  5CFW A;  5BT4 A;  4PTB A;  3IU6 A;  5AD2 A;  4O7F A;  4C66 A;  5F62 A;  4QBM A;  4TU4 A;  5II1 A;  5DYA A;  4NRA A;  4QR3 A;  4HXN A;  4CL9 A;  4O76 A;  5CY9 A;  4CLB A;  2L5E A;  2DVQ A;  2F6J A;  3JVJ A;  5L8U A;  4A9F A;  5IGM A;  4UYD A;  5ENE A;  4MR5 A;  4BW3 A;  4LDF A;  2L85 A;  4TYL A;  3MUK A;  4MEN A;  4IR6 A;  5KTW A;  5LVR A;  5FG5 A;  5CUA A;  5CS8 A;  5CUB A;  4HBY A;  5HRW A;  4Z93 A;  5EGU A;  3S91 A;  2RNX A;  4TU6 A;  5E7D A;  3AAD A;  4LZ2 A;  3Q2F A;  5F1H A;  4A9K A;  2DKW A;  5HFR A;  4PS5 A;  4LZS A;  5L97 A;  4YH3 A;  4Z6I A;  4QSP A;  4HXP A;  5FDZ A;  5CZG A;  3UVW A;  4ALG A;  5LKT A;  4WHW A;  4BJX A;  5DFB A;  3K2J A;  5EWD A;  5HQ6 A;  5CQA A;  5D3H A;  1JSP B;  5FFV A;  4DON A;  5EWH A;  4BW2 A;  5DYX A;  2YEK A;  3DWY A;  4QY4 A;  5HEL A;  4A9H A;  2I7K A;  4QSQ A;  5KTU A;  3O36 A;  4MEQ A;  5D3P A;  4Z1Q A;  4LYI A;  5LKX A;  4YBS A;  5FB1 A;  5KTX A;  1F68 A;  3MQM A;  5EK9 A;  5C4Q A;  3U5L A;  4YYG A;  5HLS A;  5FH8 A;  5LKU A;  2N9G A;  5JWM A;  5J0D A;  4HBV A;  2DWW A;  5E0R A;  1EQF A;  3S92 A;  2MJV B;  5ENJ A;  5H1V A;  4YYH A;  5I88 A;  4FLP A;  4O78 A;  4O74 A;  4YAB A;  4BHW A;  4UIW A;  2R10 A;  5I80 A;  5A82 A;  4HBX A;  4QEV A;  4UYG A;  5FE3 A;  3MUL A;  5E9V A;  5DKC A;  2RI7 A;  4YAX A;  3NXB A;  3O35 A;  3P1D A;  5IG6 A;  2YQD A;  5CUE A;  2DVS A;  4QEU A;  5ETB A;  4LYS A;  3MB4 A;  5FH6 A;  5DFD A;  5H85 A;  3QZV A;  2RO1 A;  5II2 A;  3U5J A;  4J3I A;  2D9E A;  5F2P A;  5CQT A;  5AME A;  5FE1 A;  5LJ0 A;  3FKM X;  4QEW A;  1ZS5 A;  4QSV A;  4N4G A;  3UW9 A;  4N4H A;  2H60 A;  5F5Z A;  1WUM A;  5D26 A;  3P1E A;  4QUT A;  4LZR A;  4O7A A;  4YH4 A;  5FFY A;  2YEL A;  4J0S A;  4UYH A;  4J0R A;  5FFW A;  5F63 A;  4TT6 A;  5HQ5 A;  4OGI A;  5D0C A;  5IGL A;  3JVM A;  4NR7 A;  5D3S A;  5DW1 A;  5EQ1 A;  5IBN A;  5DBM A;  4MEO A;  3LQI A;  5I29 A;  3ONI A;  5I7X A;  4Y03 A;  3TLP A;  4LC2 A;  4PY6 A;  4PKL A;  5FE8 A;  5CRM A;  5C7N A;  4YAD A;  4LRG A;  5FE6 A;  5EM3 A;  5HJC A;  5F60 A;  5IID A;  4N4I A;  4MR3 A;  4X2I A;  5FG6 A;  5CQ3 A;  4CUR A;  4KV1 A;  5COI A;  5FE4 A;  4NQM A;  4HXM A;  5HRX A;  5FB0 A;  4HXL A;  5F3A A;  3G0L A;  4XUB A;  5D3T A;  5D24 A;  4Q0O A;  5D3R A;  5D25 A;  4A9J A;  3U5N A;  4NYV A;  5BT5 A;  4J1P A;  4TT2 A;  4IR3 A;  4UIV A;  3SVH A;  2YEM A;  2D82 A;  5DX4 A;  5CU8 A;  4YBT A;  4UYF B;  5EWV A;  5DLZ A;  4YYD A;  2E3K A;  3O34 A;  4ALH A;  4QUU A;  3UVD A;  5FE0 A;  4O7E A;  4YC9 A;  4ZQL A;  4XUA A;  5F61 A;  5TB6 A;  5ENH A;  5D3J A;  1E6I A;  2WP1 A;  2LSP B;  5HCL A;  5D3L A;  4IOO A;  5EI4 A;  4OUF A;  3GG3 A;  5EA1 A;  5EWC A;  5E9M A;  5ENC A;  5ETD A;  5LVQ A;  5HFQ A;  5A81 A;  4NQN A;  4IOR A;  4QB3 A;  2E7N A;  5DFC A;  3U5O A;  4TQN A;  2KTB B;  5EPS A;  4YK0 A;  4ZW1 A;  3P5O A;  5DY7 A;  5I40 A;  5FE9 A;  5ENI A;  5EIC A;  4CFK A;  5K29 A;  5E9L A;  4A9L A;  4CUS A;  4UIT A;  5FE2 A;  4MR6 A;  2FSA A;  5DW2 A;  5EP7 A;  2DAT A;  5C87 A;  4A9M A;  5EV9 A;  5CGP A;  1WUG A;  3SVF A;  5IGN A;  4O71 A;  4CUP A;  2E7O A;  2OUO A;  3O37 A;  5CQ4 A;  5LJ1 A;  4NUD A;  4UIY A;  5A5N A;  3LQJ A;  2OO1 A;  4E96 A;  4QSX A;  2OSS A;  5FBX A;  5A83 A;  4O72 A;  5HQ7 A;  5E3D A;  4YY6 A;  5A5Q A;  5CUC A;  5L96 A;  2NXB A;  3LXJ A;  4QNS A;  4A9O A;  4NR9 A;  4WIV A;  4CUQ A;  4HBW A;  5G4R A;  4O70 A;  5LKZ A;  3I3J A;  3P1F A;  4LYW A;  4QR5 A;  5H1T A;  2YYN A;  5D3N A;  5I86 A;  1X0J A;  4QSS A;  5CRZ A;  4O77 A;  5ENG A;  4RVR A;  5E9K A;  4YYJ A;  5EU1 A;  3G0J A;  4QYL A;  3O33 A;  4IOQ A;  5CQ7 A;  5L8T A;  5F1L A;  3UVX A;  4A9I A;  3HME A;  5KO4 A;  1N72 A;  4A9N A;  5CP5 A;  5CUG A;  5FE7 A;  5AD3 A;  4PCE A;  5E74 A;  5FH7 A;  5E9Y A;  5EVA A;  5E9I A;  4QYD A;  5KU3 A;  3MB3 A;  4NYW A;  4CUT A;  4YY4 A;  3UV4 A;  3Q2E A;  4N3W A;  3RCW A;  2DVV A;  5D7X A;  3HMH A;  4IR5 A;  4KV4 A;  2F6N A;  4BW1 A;  3UV2 A;  5F25 A;  5EWW A;  4WHU A;  5C89 A;  3P1C A;  3DAI A;  2G4A A;  4QST A;  5IGK A;  5I83 A;  4UYF A;  4UYE A;  4Q0N A;  5FG4 A;  5DYU A;  3SVG A;  4NR8 A;  5E3G A;  3JVL A;  4F3I A;  3ZYU A;  4IR4 A;  3LQH A;  5CUD A;  4NS5 A;  5A5O A;  5EPR A;  5L99 A;  5F36 A;  5ENB A;  5LJ2 A;  5TCM A;  4NUE A;  4Z6H A;  4O75 A;  2YDW A;  4BW4 A;  4YYI A;  3QZT A;  5E73 A;  4QC1 A;  3UV5 A;  4QR4 A;  4NXJ A;  4UIU A;  4NYX A;  2RNY A;  5ENF A;  3AQA A;  4YYN A;  2YW5 A;  2R0S A;  5EIS A;  5DKD A;  5HEM A;  3U5M A;  5A5S A;  5BT3 A;  3IU5 A;  5HM0 A;  4CUU A;  4KCX A;  4NR4 A;  4HXO A;  4O7C A;  5C85 A;  4MR4 A;  4UIX A;  4QSW A;  4N4F A;  5DKH A;  3U5P A;  5I1Q A;  5I89 A;  2DVR A;  2RS9 B;  5G4S A;  5A85 A;  2L84 A;  4NRB A;  4UIZ A;  5H1U A;  1JM4 B;  4AKN A;  3QZS A;  4XY8 A;  4TTE A;  3D7C A;  5C8G A;  3JVK A;  3MXF A;  4GPJ A;  4Z1S A;  4TZ8 A;  4C67 A;  2WP2 A;  4XYA A;  3LJW A;  5CPE A;  4NR5 A;  5CQ6 A;  2RFJ A;  4CFL A;  2I8N A;  5EPB A;  5I7Y A;  5CQ5 A;  4QSU A;  5KHM A;  4A9E A;  4HXK A;  4MEP A;  4YYM A;  4PCI A;  5DYC A;  4XY9 A;  5ACY A;  4NR6 A;  5HRV A;  5L98 A;  5AMF A;  4NUC A;  4YAT A;  4O7B A;  4YYK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...