5HM0A

Crystal structure of the first bromodomain of human brd4 bound to benzoisoxazoloazepine 3
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
125
structure length
125
Chain Sequence
STNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bromodomain-containing protein 4
publication title Identification of a Benzoisoxazoloazepine Inhibitor (CPI-0610) of the Bromodomain and Extra-Terminal (BET) Family as a Candidate for Human Clinical Trials.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 44
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2016-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5hm0A01
4YADA 5C7NA 5DBMA 3O37A 3MXFA 3LQIA 4UYEA 4TYLA 3I3JA 4TT4A 1JM4B 5E9KA 5F62A 4PCIA 4O77A 4HXOA 3QZSA 4NR4A 4TU6A 5FE7A 4MEQA 2F6NA 5C85A 2RS9B 4F3IA 4A9LA 4QC3A 5CU8A 3IU6A 3HMEA 5FB0A 4XUAA 5KO4A 4QR4A 5D3PA 4DONA 3MULA 3MQMA 5E9YA 2D9EA 5CQ7A 5F5ZA 4XUBA 2YYNA 5EQ1A 1WUMA 4YYNA 5I88A 5AD3A 5CY9A 5COIA 3UVDA 3Q2EA 2DVSA 5D3HA 5L96A 3SVGA 3RCWA 5CUGA 4QSPA 4UIZA 4CL9A 4XY8A 5BT3A 5IGNA 5E9VA 4UYFA 4Z93A 4CFKA 1JSPB 4MR3A 1EQFA 4OGIA 2YEMA 2N9GA 4Q0NA 5HQ7A 4O7EA 5HRXA 4BW4A 5E9LA 5H85A 4A9IA 3UV2A 5H1TA 5DYAA 5D7XA 4UYDA 5CP5A 4YH3A 5I1QA 4O72A 3P1CA 5F36A 5LKXA 5DW1A 5ENCA 5ENIA 5FG6A 5CQ8A 4MR5A 5AMEA 4LZSA 5IGKA 2RI7A 4CUUA 5EWDA 4A9JA 4UIYA 3S91A 5HM0A 5A5RA 2F6JA 4N4GA 5ETBA 4TT6A 4LYWA 5EICA 4NUCA 5EISA 5EPBA 4HXKA 3JVJA 4NRCA 5EVAA 5EI4A 4NR8A 5L99A 4YABA 5ENHA 5FDZA 4OGJA 2D82A 2I8NA 5G4RA 5HLSA 5EPSA 5DFDA 3ZYUA 3S92A 4YATA 5A7CA 2E7NA 4O7CA 3P1EA 4N3WA 5DKCA 5I83A 4PTBA 5HJCA 4Z1QA 4J3IA 4YY4A 2G4AA 4QSRA 3HMFA 5E7DA 5FFVA 4NS5A 4PCEA 5ENJA 4NQNA 4PY6A 5ENEA 5CQTA 3IU5A 3JVLA 4LZRA 5EGUA 5DX4A 5ACYA 5E73A 5EU1A 2E7OA 4KV1A 5E0RA 5F25A 5F2PA 4YK0A 5HRWA 3GG3A 3P5OA 3UVYA 4Z6HA 4Z6IA 3HMHA 5CQ6A 2NXBA 4QUTA 4E96A 1ZS5A 3O34A 4TT2A 4UIVA 3ONIA 2RNYA 4QC1A 5DKHA 3AADA 4MEPA 4OUFA 4ZC9A 3U5JA 4FLPA 5DLZA 2DKWA 4UIXA 5FE4A 5A5NA 5DYUA 5FFWA 3UVWA 3U5KA 3U5MA 2RO1A 3U5PA 5LKTA 5ENFA 5F61A 4Z1SA 4TU4A 5CTLA 4C66A 4A9FA 5LUUA 5F1HA 4A9MA 3LXJA 4RVRA 5DFBA 5FE8A 5CUBA 5DYCA 5A85A 4LRGA 5C89A 4J0SA 3SVHA 4TS8A 2WP1A 5G4SA 4HXPA 5I7XA 2E3KA 5CRMA 5IGLA 5I40A 5L8TA 3JVMA 5CUDA 4NYWA 5HRVA 2WP2A 1X0JA 4YY6A 2DVRA 2RNXA 5F63A 4YYDA 4HXLA 4NRBA 3P1FA 4CUTA 4MR6A 4BW3A 4O78A 4XY9A 4A9KA 5D3TA 5A5PA 3Q2FA 4O71A 5KTXA 5EWVA 5I86A 3FKMX 4YH4A 4NR7A 3UW9A 5E9IA 3MB3A 4KV4A 5HELA 5IGMA 4NQMA 5CPEA 4BHWA 4NR6A 2L5EA 4O75A 5LJ0A 2OO1A 5HFRA 5CUCA 2OUOA 4PS5A 4MR4A 3AQAA 4Y03A 4YYHA 3U5OA 4UYHA 2OSSA 4XYAA 5TB6A 4QSSA 2YDWA 4O7AA 5FBXA 5KTWA 2DATA 5FH8A 2YEKA 4ZW1A 3SVFA 5H1VA 4J0RA 5ETDA 5ENBA 5EWCA 3JVKA 5CZGA 4MEOA 5D3LA 3O35A 2L85A 4YYMA 5II1A 4YAXA 5DW2A 4TQNA 5E3GA 5CRZA 2DWWA 5D26A 5E74A 3QZTA 4NR9A 5D25A 5FE2A 4ZQLA 4QR5A 5D3RA 5KU3A 2GRCA 4GPJA 4IR6A 5F3AA 3LJWA 5E3DA 4NUEA 4LYSA 3P1DA 4O7FA 3DWYA 5L97A 5J0DA 4ALHA 5EWWA 5HEMA 5CUEA 4NXJA 3G0LA 4CURA 5FFYA 5FG4A 5FH7A 4LR6A 4UYFB 5I7YA 4IOQA 4NYVA 5C8GA 5LVQA 4HBXA 4LDFA 4WHUA 4QSVA 3TLPA 5BT5A 5E9MA 5L98A 5A81A 4HXSA 5DYXA 4C67A 2YQDA 5DFCA 3MUKA 4UYGA 4AKNA 2H60A 4QSXA 4QEWA 3LQJA 4IR3A 5EK9A 5EP7A 5CFWA 5CQ5A 4UIUA 5LKZA 4WIVA 5EWHA 2YELA 5II2A 4BJXA 4O76A 5FE3A 2MJVB 4BW1A 5FE5A 5FE9A 5I29A 5TCMA 4UIWA 4BW2A 4QY4A 5K29A 2FSAA 2L84A 3NXBA 5CS8A 5D3JA 4QNSA 4A9OA 3G0JA 4WHWA 3QZVA 5HFQA 4YYKA 5A5OA 4IR4A 4QEVA 5C87A 5KHMA 2DVQA 2I7KA 5EA1A 4YC9A 4HXNA 4O7BA 4YYGA 5A5SA 4NYXA 5BT4A 4CUSA 2R0SA 4QEUA 5FB1A 5EM3A 3UVXA 5I80A 5DLXA 5I89A 4A9NA 4QUUA 4UITA 5D0CA 4CLBA 5CQAA 4J1PA 5CUAA 4N4FA 5HENA 4IR5A 4QSQA 3MB4A 5A82A 4HXRA 5CQ4A 2R0YA 5EPRA 4CUQA 2DVVA 3U5NA 4IORA 4QSWA 5EV9A 3UV5A 5LJ2A 4HBWA 5FG5A 1WUGA 3U5LA 4TZ2A 4X2IA 4CFLA 5HQ6A 4O70A 5DY7A 5AMFA 5FE0A 5ENGA 4NRAA 2R0VA 4TZ8A 5IIDA 3O36A 4HBYA 5C4QA 4LC2A 5JWMA 5FE6A 4QZSA 5D3NA 5A5QA 4N4IA 5L8UA 2RNWA 5FH6A 5D3SA 2RFJA 4QB3A 4MENA 4QBMA 5AD2A 4NR5A 5FE1A 4YBSA 4A9EA 5LKUA 3UV4A 2KTBB 4QYLA 3DAIA 4IOOA 4QSUA 5CGPA 5D24A 2LSPB 2YW5A 5LVRA 4YBTA 5HCLA 1N72A 4TTEA 1F68A 5DKDA 5CQ3A 4YYJA 5IG6A 4PKLA 5F1LA 4KCXA 4ALGA 4HBVA 4N4HA 4YYIA 4QR3A 5A83A 4Q0OA 4A9HA 5HQ5A 3D7CA 4LZ2A 4NUDA 5IBNA 5H1UA 3LQHA 3O33A 4YBMA 4CUPA 5LJ1A 4O74A 2R10A 5F60A 4QSTA 3K2JA 5KTUA 1E6IA 4LYIA 4HXMA 4QYDA 5JI8A
chains in the Genus database with same CATH superfamily
4YADA 5C7NA 5DBMA 3O37A 3MXFA 3LQIA 4UYEA 4TYLA 3I3JA 4TT4A 1JM4B 5E9KA 5F62A 4PCIA 4O77A 4HXOA 3QZSA 4NR4A 4TU6A 5FE7A 4MEQA 2F6NA 5C85A 2RS9B 4F3IA 4A9LA 4QC3A 5CU8A 3IU6A 3HMEA 5FB0A 4XUAA 5KO4A 4QR4A 5D3PA 4DONA 3MULA 3MQMA 5E9YA 2D9EA 3D1BA 5CQ7A 5F5ZA 4XUBA 2YYNA 5EQ1A 1WUMA 4YYNA 5I88A 5AD3A 5CY9A 5COIA 3UVDA 3Q2EA 2DVSA 5D3HA 5L96A 3SVGA 3RCWA 5CUGA 4QSPA 4UIZA 4CL9A 4XY8A 5BT3A 5IGNA 5E9VA 4UYFA 4Z93A 4CFKA 1JSPB 4MR3A 1EQFA 4OGIA 2YEMA 2N9GA 4Q0NA 5HQ7A 4O7EA 5HRXA 4BW4A 5E9LA 5H85A 4A9IA 3UV2A 5H1TA 5DYAA 5D7XA 4UYDA 5CP5A 4YH3A 5I1QA 4O72A 3P1CA 5F36A 5LKXA 5DW1A 5ENCA 5ENIA 5FG6A 5CQ8A 4MR5A 5AMEA 4LZSA 5IGKA 2RI7A 4CUUA 5EWDA 4A9JA 4UIYA 4AKGA 3S91A 5HM0A 5A5RA 2F6JA 4N4GA 5ETBA 4TT6A 4LYWA 5EICA 4NUCA 5EISA 5EPBA 4HXKA 3JVJA 4NRCA 5EVAA 5EI4A 4NR8A 5L99A 4YABA 5ENHA 5FDZA 4OGJA 2D82A 2I8NA 5G4RA 5HLSA 5EPSA 5DFDA 3ZYUA 3S92A 4YATA 5A7CA 2E7NA 4O7CA 3P1EA 4N3WA 5DKCA 5I83A 4PTBA 5HJCA 4Z1QA 4J3IA 4YY4A 2G4AA 4QSRA 3HMFA 5E7DA 5FFVA 4NS5A 4PCEA 5ENJA 4NQNA 4PY6A 5ENEA 5CQTA 3IU5A 3JVLA 4LZRA 5EGUA 5DX4A 5ACYA 5E73A 5EU1A 2E7OA 4KV1A 5E0RA 5F25A 5F2PA 4YK0A 5HRWA 3GG3A 3P5OA 3UVYA 4Z6HA 4Z6IA 3HMHA 5CQ6A 2NXBA 4QUTA 4E96A 3ERRA 1ZS5A 3O34A 4TT2A 4UIVA 3ONIA 2RNYA 4QC1A 5DKHA 3AADA 4MEPA 4OUFA 4ZC9A 3U5JA 4FLPA 5DLZA 2DKWA 4UIXA 5FE4A 5A5NA 5DYUA 5FFWA 4AKIA 3UVWA 3U5KA 3U5MA 2RO1A 3U5PA 5LKTA 5ENFA 5F61A 4Z1SA 4TU4A 5CTLA 4C66A 4A9FA 5LUUA 5F1HA 4A9MA 3LXJA 4RVRA 5DFBA 5FE8A 5CUBA 5DYCA 5A85A 4LRGA 5C89A 4J0SA 3SVHA 4TS8A 2WP1A 5G4SA 4HXPA 5I7XA 2E3KA 5CRMA 5IGLA 5I40A 5L8TA 3JVMA 2EJNA 5CUDA 4NYWA 5HRVA 2WP2A 1X0JA 4YY6A 2DVRA 2RNXA 5F63A 4YYDA 4HXLA 4NRBA 3P1FA 4CUTA 4MR6A 4BW3A 4O78A 4XY9A 4A9KA 5D3TA 5A5PA 3Q2FA 4O71A 5KTXA 5EWVA 5I86A 3FKMX 4YH4A 4NR7A 3UW9A 5E9IA 3MB3A 4KV4A 5HELA 5IGMA 4NQMA 5CPEA 4BHWA 4NR6A 2L5EA 4O75A 5LJ0A 2OO1A 5HFRA 1PUOA 5CUCA 2OUOA 4PS5A 4MR4A 3AQAA 4Y03A 4YYHA 3U5OA 4UYHA 2OSSA 4XYAA 5TB6A 3VKGA 3D1DA 4QSSA 2YDWA 4O7AA 5FBXA 5KTWA 2DATA 5FH8A 2YEKA 4ZW1A 3SVFA 5H1VA 4J0RA 5ETDA 5ENBA 5EWCA 3JVKA 5CZGA 4MEOA 5D3LA 3O35A 2L85A 4YYMA 5II1A 4YAXA 5DW2A 4TQNA 5E3GA 5CRZA 2DWWA 5D26A 5E74A 3QZTA 4NR9A 5D25A 5FE2A 4ZQLA 4QR5A 5D3RA 5KU3A 2GRCA 4GPJA 4IR6A 5F3AA 3LJWA 5E3DA 4NUEA 4LYSA 3P1DA 4O7FA 3DWYA 5L97A 5J0DA 4ALHA 5EWWA 5HEMA 5CUEA 4NXJA 3G0LA 4CURA 5FFYA 5FG4A 5FH7A 4LR6A 4UYFB 5I7YA 4IOQA 4NYVA 5C8GA 5LVQA 4HBXA 4LDFA 4WHUA 4QSVA 3TLPA 5BT5A 5E9MA 5L98A 5A81A 4HXSA 5DYXA 4C67A 2YQDA 5DFCA 3MUKA 3VKHA 4UYGA 4AKNA 2H60A 4QSXA 4QEWA 3LQJA 4IR3A 5EK9A 5EP7A 5CFWA 5CQ5A 4UIUA 5LKZA 4WIVA 5EWHA 2YELA 5II2A 4BJXA 4O76A 5FE3A 2MJVB 4BW1A 5FE5A 5FE9A 5I29A 5TCMA 4UIWA 4BW2A 4QY4A 5K29A 2FSAA 2L84A 3NXBA 5CS8A 5D3JA 4QNSA 4A9OA 3G0JA 4WHWA 3QZVA 5HFQA 4YYKA 5A5OA 4IR4A 4QEVA 5C87A 5KHMA 2DVQA 2I7KA 5EA1A 4YC9A 4HXNA 4O7BA 4YYGA 5A5SA 4NYXA 5BT4A 4CUSA 2R0SA 4QEUA 5FB1A 5EM3A 3UVXA 5I80A 5DLXA 5I89A 4A9NA 4QUUA 4UITA 5D0CA 4CLBA 5CQAA 4J1PA 5CUAA 4N4FA 5HENA 4IR5A 4QSQA 3MB4A 5A82A 4HXRA 5CQ4A 2R0YA 5EPRA 4CUQA 2DVVA 3U5NA 4IORA 4QSWA 5EV9A 3UV5A 5LJ2A 4HBWA 5FG5A 1WUGA 3U5LA 4TZ2A 4X2IA 4CFLA 5HQ6A 4O70A 5DY7A 5AMFA 5FE0A 5ENGA 4NRAA 2R0VA 4TZ8A 5IIDA 3O36A 4HBYA 5C4QA 4LC2A 5JWMA 5FE6A 4QZSA 5D3NA 5A5QA 4N4IA 5L8UA 2RNWA 5FH6A 1ZKRA 5D3SA 2RFJA 4QB3A 4MENA 4QBMA 5AD2A 4NR5A 5FE1A 4YBSA 4A9EA 5LKUA 3UV4A 2KTBB 4QYLA 3DAIA 4IOOA 4QSUA 5CGPA 5D24A 2LSPB 4AI6A 2YW5A 5LVRA 4YBTA 5HCLA 1N72A 4TTEA 1F68A 5DKDA 5CQ3A 4YYJA 5IG6A 4PKLA 5F1LA 4KCXA 4ALGA 4HBVA 4N4HA 4YYIA 4QR3A 5A83A 4Q0OA 4A9HA 4AKHA 5HQ5A 3D7CA 4LZ2A 4NUDA 5IBNA 5H1UA 3LQHA 3O33A 4YBMA 4CUPA 5LJ1A 4O74A 2R10A 5F60A 4QSTA 3K2JA 5KTUA 1E6IA 4LYIA 4HXMA 4QYDA 5JI8A
chains in the Genus database with same CATH topology
4YADA 5C7NA 5DBMA 3O37A 3MXFA 3LQIA 4UYEA 4TYLA 3I3JA 4TT4A 1JM4B 5E9KA 5F62A 4PCIA 4O77A 4HXOA 3QZSA 4NR4A 4TU6A 5FE7A 4MEQA 2F6NA 5C85A 2RS9B 4F3IA 4A9LA 4QC3A 5CU8A 3IU6A 3HMEA 5FB0A 4XUAA 5KO4A 4QR4A 5D3PA 4DONA 3MULA 3MQMA 5E9YA 2D9EA 5CQ7A 5F5ZA 4XUBA 2YYNA 5EQ1A 1WUMA 4YYNA 5I88A 5AD3A 5CY9A 5COIA 3UVDA 3Q2EA 2DVSA 5D3HA 5L96A 3SVGA 3RCWA 5CUGA 4QSPA 4UIZA 4CL9A 4XY8A 5BT3A 5IGNA 5E9VA 4UYFA 4Z93A 4CFKA 1JSPB 4MR3A 1EQFA 4OGIA 2YEMA 2N9GA 4Q0NA 5HQ7A 4O7EA 5HRXA 4BW4A 5E9LA 5H85A 4A9IA 3UV2A 5H1TA 5DYAA 5D7XA 4UYDA 5CP5A 4YH3A 5I1QA 4O72A 3P1CA 5F36A 5LKXA 5DW1A 5ENCA 5ENIA 5FG6A 5CQ8A 4MR5A 5AMEA 4LZSA 5IGKA 2RI7A 4CUUA 5EWDA 4A9JA 4UIYA 3S91A 5HM0A 5A5RA 2F6JA 4N4GA 5ETBA 4TT6A 4LYWA 5EICA 4NUCA 5EISA 5EPBA 4HXKA 3JVJA 4NRCA 5EVAA 5EI4A 4NR8A 5L99A 4YABA 5ENHA 5FDZA 4OGJA 2D82A 2I8NA 5G4RA 5HLSA 5EPSA 5DFDA 3ZYUA 3S92A 4YATA 5A7CA 2E7NA 4O7CA 3P1EA 4N3WA 5DKCA 5I83A 4PTBA 5HJCA 4Z1QA 4J3IA 4YY4A 2G4AA 4QSRA 3HMFA 5E7DA 5FFVA 4NS5A 4PCEA 5ENJA 4NQNA 4PY6A 5ENEA 5CQTA 3IU5A 3JVLA 4LZRA 5EGUA 5DX4A 5ACYA 5E73A 5EU1A 2E7OA 4KV1A 5E0RA 5F25A 5F2PA 4YK0A 5HRWA 3GG3A 3P5OA 3UVYA 4Z6HA 4Z6IA 3HMHA 5CQ6A 2NXBA 4QUTA 4E96A 1ZS5A 3O34A 4TT2A 4UIVA 3ONIA 2RNYA 4QC1A 5DKHA 3AADA 4MEPA 4OUFA 4ZC9A 3U5JA 4FLPA 5DLZA 2DKWA 4UIXA 5FE4A 5A5NA 5DYUA 5FFWA 3UVWA 3U5KA 3U5MA 2RO1A 3U5PA 5LKTA 5ENFA 5F61A 4Z1SA 4TU4A 5CTLA 4C66A 4A9FA 5LUUA 5F1HA 4A9MA 3LXJA 4RVRA 5DFBA 5FE8A 5CUBA 5DYCA 5A85A 4LRGA 5C89A 4J0SA 3SVHA 4TS8A 2WP1A 5G4SA 4HXPA 5I7XA 2E3KA 5CRMA 5IGLA 5I40A 5L8TA 3JVMA 5CUDA 4NYWA 5HRVA 2WP2A 1X0JA 4YY6A 2DVRA 2RNXA 5F63A 4YYDA 4HXLA 4NRBA 3P1FA 4CUTA 4MR6A 4BW3A 4O78A 4XY9A 4A9KA 5D3TA 5A5PA 3Q2FA 4O71A 5KTXA 5EWVA 5I86A 3FKMX 4YH4A 4NR7A 3UW9A 5E9IA 3MB3A 4KV4A 5HELA 5IGMA 4NQMA 5CPEA 4BHWA 4NR6A 2L5EA 4O75A 5LJ0A 2OO1A 5HFRA 5CUCA 2OUOA 4PS5A 4MR4A 3AQAA 4Y03A 4YYHA 3U5OA 4UYHA 2OSSA 4XYAA 5TB6A 4QSSA 2YDWA 4O7AA 5FBXA 5KTWA 2DATA 5FH8A 2YEKA 4ZW1A 3SVFA 5H1VA 4J0RA 5ETDA 5ENBA 5EWCA 3JVKA 5CZGA 4MEOA 5D3LA 3O35A 2L85A 4YYMA 5II1A 4YAXA 5DW2A 4TQNA 5E3GA 5CRZA 2DWWA 5D26A 5E74A 3QZTA 4NR9A 5D25A 5FE2A 4ZQLA 4QR5A 5D3RA 5KU3A 2GRCA 4GPJA 4IR6A 5F3AA 3LJWA 5E3DA 4NUEA 4LYSA 3P1DA 4O7FA 3DWYA 5L97A 5J0DA 4ALHA 5EWWA 5HEMA 5CUEA 4NXJA 3G0LA 4CURA 5FFYA 5FG4A 5FH7A 4LR6A 4UYFB 5I7YA 4IOQA 4NYVA 5C8GA 5LVQA 4HBXA 4LDFA 4WHUA 4QSVA 3TLPA 5BT5A 5E9MA 5L98A 5A81A 4HXSA 5DYXA 4C67A 2YQDA 5DFCA 3MUKA 4UYGA 4AKNA 2H60A 4QSXA 4QEWA 3LQJA 4IR3A 5EK9A 5EP7A 5CFWA 5CQ5A 4UIUA 5LKZA 4WIVA 5EWHA 2YELA 5II2A 4BJXA 4O76A 5FE3A 2MJVB 4BW1A 5FE5A 5FE9A 5I29A 5TCMA 4UIWA 4BW2A 4QY4A 5K29A 2FSAA 2L84A 3NXBA 5CS8A 5D3JA 4QNSA 4A9OA 3G0JA 4WHWA 3QZVA 5HFQA 4YYKA 5A5OA 4IR4A 4QEVA 5C87A 5KHMA 2DVQA 2I7KA 5EA1A 4YC9A 4HXNA 4O7BA 4YYGA 5A5SA 4NYXA 5BT4A 4CUSA 2R0SA 4QEUA 5FB1A 5EM3A 3UVXA 5I80A 5DLXA 5I89A 4A9NA 4QUUA 4UITA 5D0CA 4CLBA 5CQAA 4J1PA 5CUAA 4N4FA 5HENA 4IR5A 4QSQA 3MB4A 5A82A 4HXRA 5CQ4A 2R0YA 5EPRA 4CUQA 2DVVA 3U5NA 4IORA 4QSWA 5EV9A 3UV5A 5LJ2A 4HBWA 5FG5A 1WUGA 3U5LA 4TZ2A 4X2IA 4CFLA 5HQ6A 4O70A 5DY7A 5AMFA 5FE0A 5ENGA 4NRAA 2R0VA 4TZ8A 5IIDA 3O36A 4HBYA 5C4QA 4LC2A 5JWMA 5FE6A 4QZSA 5D3NA 5A5QA 4N4IA 5L8UA 2RNWA 5FH6A 5D3SA 2RFJA 4QB3A 4MENA 4QBMA 5AD2A 4NR5A 5FE1A 4YBSA 4A9EA 5LKUA 3UV4A 2KTBB 4QYLA 3DAIA 4IOOA 4QSUA 5CGPA 5D24A 2LSPB 2YW5A 5LVRA 4YBTA 5HCLA 1N72A 4TTEA 1F68A 5DKDA 5CQ3A 4YYJA 5IG6A 4PKLA 5F1LA 4KCXA 4ALGA 4HBVA 4N4HA 4YYIA 4QR3A 5A83A 4Q0OA 4A9HA 5HQ5A 3D7CA 4LZ2A 4NUDA 5IBNA 5H1UA 3LQHA 3O33A 4YBMA 4CUPA 5LJ1A 4O74A 2R10A 5F60A 4QSTA 3K2JA 5KTUA 1E6IA 4LYIA 4HXMA 4QYDA 5JI8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YAD A;  5C7N A;  5DBM A;  3O37 A;  3MXF A;  3LQI A;  4UYE A;  4TYL A;  3I3J A;  4TT4 A;  1JM4 B;  5E9K A;  5F62 A;  4PCI A;  4O77 A;  4HXO A;  3QZS A;  4NR4 A;  4TU6 A;  5FE7 A;  4MEQ A;  2F6N A;  5C85 A;  2RS9 B;  4F3I A;  4A9L A;  4QC3 A;  5CU8 A;  3IU6 A;  3HME A;  5FB0 A;  4XUA A;  5KO4 A;  4QR4 A;  5D3P A;  4DON A;  3MUL A;  3MQM A;  5E9Y A;  2D9E A;  5CQ7 A;  5F5Z A;  4XUB A;  2YYN A;  5EQ1 A;  1WUM A;  4YYN A;  5I88 A;  5AD3 A;  5CY9 A;  5COI A;  3UVD A;  3Q2E A;  2DVS A;  5D3H A;  5L96 A;  3SVG A;  3RCW A;  5CUG A;  4QSP A;  4UIZ A;  4CL9 A;  4XY8 A;  5BT3 A;  5IGN A;  5E9V A;  4UYF A;  4Z93 A;  4CFK A;  1JSP B;  4MR3 A;  1EQF A;  4OGI A;  2YEM A;  2N9G A;  4Q0N A;  5HQ7 A;  4O7E A;  5HRX A;  4BW4 A;  5E9L A;  5H85 A;  4A9I A;  3UV2 A;  5H1T A;  5DYA A;  5D7X A;  4UYD A;  5CP5 A;  4YH3 A;  5I1Q A;  4O72 A;  3P1C A;  5F36 A;  5LKX A;  5DW1 A;  5ENC A;  5ENI A;  5FG6 A;  5CQ8 A;  4MR5 A;  5AME A;  4LZS A;  5IGK A;  2RI7 A;  4CUU A;  5EWD A;  4A9J A;  4UIY A;  3S91 A;  5HM0 A;  5A5R A;  2F6J A;  4N4G A;  5ETB A;  4TT6 A;  4LYW A;  5EIC A;  4NUC A;  5EIS A;  5EPB A;  4HXK A;  3JVJ A;  4NRC A;  5EVA A;  5EI4 A;  4NR8 A;  5L99 A;  4YAB A;  5ENH A;  5FDZ A;  4OGJ A;  2D82 A;  2I8N A;  5G4R A;  5HLS A;  5EPS A;  5DFD A;  3ZYU A;  3S92 A;  4YAT A;  5A7C A;  2E7N A;  4O7C A;  3P1E A;  4N3W A;  5DKC A;  5I83 A;  4PTB A;  5HJC A;  4Z1Q A;  4J3I A;  4YY4 A;  2G4A A;  4QSR A;  3HMF A;  5E7D A;  5FFV A;  4NS5 A;  4PCE A;  5ENJ A;  4NQN A;  4PY6 A;  5ENE A;  5CQT A;  3IU5 A;  3JVL A;  4LZR A;  5EGU A;  5DX4 A;  5ACY A;  5E73 A;  5EU1 A;  2E7O A;  4KV1 A;  5E0R A;  5F25 A;  5F2P A;  4YK0 A;  5HRW A;  3GG3 A;  3P5O A;  3UVY A;  4Z6H A;  4Z6I A;  3HMH A;  5CQ6 A;  2NXB A;  4QUT A;  4E96 A;  1ZS5 A;  3O34 A;  4TT2 A;  4UIV A;  3ONI A;  2RNY A;  4QC1 A;  5DKH A;  3AAD A;  4MEP A;  4OUF A;  4ZC9 A;  3U5J A;  4FLP A;  5DLZ A;  2DKW A;  4UIX A;  5FE4 A;  5A5N A;  5DYU A;  5FFW A;  3UVW A;  3U5K A;  3U5M A;  2RO1 A;  3U5P A;  5LKT A;  5ENF A;  5F61 A;  4Z1S A;  4TU4 A;  5CTL A;  4C66 A;  4A9F A;  5LUU A;  5F1H A;  4A9M A;  3LXJ A;  4RVR A;  5DFB A;  5FE8 A;  5CUB A;  5DYC A;  5A85 A;  4LRG A;  5C89 A;  4J0S A;  3SVH A;  4TS8 A;  2WP1 A;  5G4S A;  4HXP A;  5I7X A;  2E3K A;  5CRM A;  5IGL A;  5I40 A;  5L8T A;  3JVM A;  5CUD A;  4NYW A;  5HRV A;  2WP2 A;  1X0J A;  4YY6 A;  2DVR A;  2RNX A;  5F63 A;  4YYD A;  4HXL A;  4NRB A;  3P1F A;  4CUT A;  4MR6 A;  4BW3 A;  4O78 A;  4XY9 A;  4A9K A;  5D3T A;  5A5P A;  3Q2F A;  4O71 A;  5KTX A;  5EWV A;  5I86 A;  3FKM X;  4YH4 A;  4NR7 A;  3UW9 A;  5E9I A;  3MB3 A;  4KV4 A;  5HEL A;  5IGM A;  4NQM A;  5CPE A;  4BHW A;  4NR6 A;  2L5E A;  4O75 A;  5LJ0 A;  2OO1 A;  5HFR A;  5CUC A;  2OUO A;  4PS5 A;  4MR4 A;  3AQA A;  4Y03 A;  4YYH A;  3U5O A;  4UYH A;  2OSS A;  4XYA A;  5TB6 A;  4QSS A;  2YDW A;  4O7A A;  5FBX A;  5KTW A;  2DAT A;  5FH8 A;  2YEK A;  4ZW1 A;  3SVF A;  5H1V A;  4J0R A;  5ETD A;  5ENB A;  5EWC A;  3JVK A;  5CZG A;  4MEO A;  5D3L A;  3O35 A;  2L85 A;  4YYM A;  5II1 A;  4YAX A;  5DW2 A;  4TQN A;  5E3G A;  5CRZ A;  2DWW A;  5D26 A;  5E74 A;  3QZT A;  4NR9 A;  5D25 A;  5FE2 A;  4ZQL A;  4QR5 A;  5D3R A;  5KU3 A;  2GRC A;  4GPJ A;  4IR6 A;  5F3A A;  3LJW A;  5E3D A;  4NUE A;  4LYS A;  3P1D A;  4O7F A;  3DWY A;  5L97 A;  5J0D A;  4ALH A;  5EWW A;  5HEM A;  5CUE A;  4NXJ A;  3G0L A;  4CUR A;  5FFY A;  5FG4 A;  5FH7 A;  4LR6 A;  4UYF B;  5I7Y A;  4IOQ A;  4NYV A;  5C8G A;  5LVQ A;  4HBX A;  4LDF A;  4WHU A;  4QSV A;  3TLP A;  5BT5 A;  5E9M A;  5L98 A;  5A81 A;  4HXS A;  5DYX A;  4C67 A;  2YQD A;  5DFC A;  3MUK A;  4UYG A;  4AKN A;  2H60 A;  4QSX A;  4QEW A;  3LQJ A;  4IR3 A;  5EK9 A;  5EP7 A;  5CFW A;  5CQ5 A;  4UIU A;  5LKZ A;  4WIV A;  5EWH A;  2YEL A;  5II2 A;  4BJX A;  4O76 A;  5FE3 A;  2MJV B;  4BW1 A;  5FE5 A;  5FE9 A;  5I29 A;  5TCM A;  4UIW A;  4BW2 A;  4QY4 A;  5K29 A;  2FSA A;  2L84 A;  3NXB A;  5CS8 A;  5D3J A;  4QNS A;  4A9O A;  3G0J A;  4WHW A;  3QZV A;  5HFQ A;  4YYK A;  5A5O A;  4IR4 A;  4QEV A;  5C87 A;  5KHM A;  2DVQ A;  2I7K A;  5EA1 A;  4YC9 A;  4HXN A;  4O7B A;  4YYG A;  5A5S A;  4NYX A;  5BT4 A;  4CUS A;  2R0S A;  4QEU A;  5FB1 A;  5EM3 A;  3UVX A;  5I80 A;  5DLX A;  5I89 A;  4A9N A;  4QUU A;  4UIT A;  5D0C A;  4CLB A;  5CQA A;  4J1P A;  5CUA A;  4N4F A;  5HEN A;  4IR5 A;  4QSQ A;  3MB4 A;  5A82 A;  4HXR A;  5CQ4 A;  2R0Y A;  5EPR A;  4CUQ A;  2DVV A;  3U5N A;  4IOR A;  4QSW A;  5EV9 A;  3UV5 A;  5LJ2 A;  4HBW A;  5FG5 A;  1WUG A;  3U5L A;  4TZ2 A;  4X2I A;  4CFL A;  5HQ6 A;  4O70 A;  5DY7 A;  5AMF A;  5FE0 A;  5ENG A;  4NRA A;  2R0V A;  4TZ8 A;  5IID A;  3O36 A;  4HBY A;  5C4Q A;  4LC2 A;  5JWM A;  5FE6 A;  4QZS A;  5D3N A;  5A5Q A;  4N4I A;  5L8U A;  2RNW A;  5FH6 A;  5D3S A;  2RFJ A;  4QB3 A;  4MEN A;  4QBM A;  5AD2 A;  4NR5 A;  5FE1 A;  4YBS A;  4A9E A;  5LKU A;  3UV4 A;  2KTB B;  4QYL A;  3DAI A;  4IOO A;  4QSU A;  5CGP A;  5D24 A;  2LSP B;  2YW5 A;  5LVR A;  4YBT A;  5HCL A;  1N72 A;  4TTE A;  1F68 A;  5DKD A;  5CQ3 A;  4YYJ A;  5IG6 A;  4PKL A;  5F1L A;  4KCX A;  4ALG A;  4HBV A;  4N4H A;  4YYI A;  4QR3 A;  5A83 A;  4Q0O A;  4A9H A;  5HQ5 A;  3D7C A;  4LZ2 A;  4NUD A;  5IBN A;  5H1U A;  3LQH A;  3O33 A;  4YBM A;  4CUP A;  5LJ1 A;  4O74 A;  2R10 A;  5F60 A;  4QST A;  3K2J A;  5KTU A;  1E6I A;  4LYI A;  4HXM A;  4QYD A;  5JI8 A; 
#chains in the Genus database with same CATH topology
 4YAD A;  5C7N A;  5DBM A;  3O37 A;  3MXF A;  3LQI A;  4UYE A;  4TYL A;  3I3J A;  4TT4 A;  1JM4 B;  5E9K A;  5F62 A;  4PCI A;  4O77 A;  4HXO A;  3QZS A;  4NR4 A;  4TU6 A;  5FE7 A;  4MEQ A;  2F6N A;  5C85 A;  2RS9 B;  4F3I A;  4A9L A;  4QC3 A;  5CU8 A;  3IU6 A;  3HME A;  5FB0 A;  4XUA A;  5KO4 A;  4QR4 A;  5D3P A;  4DON A;  3MUL A;  3MQM A;  5E9Y A;  2D9E A;  3D1B A;  5CQ7 A;  5F5Z A;  4XUB A;  2YYN A;  5EQ1 A;  1WUM A;  4YYN A;  5I88 A;  5AD3 A;  5CY9 A;  5COI A;  3UVD A;  3Q2E A;  2DVS A;  5D3H A;  5L96 A;  3SVG A;  3RCW A;  5CUG A;  4QSP A;  4UIZ A;  4CL9 A;  4XY8 A;  5BT3 A;  5IGN A;  5E9V A;  4UYF A;  4Z93 A;  4CFK A;  1JSP B;  4MR3 A;  1EQF A;  4OGI A;  2YEM A;  2N9G A;  4Q0N A;  5HQ7 A;  4O7E A;  5HRX A;  4BW4 A;  5E9L A;  5H85 A;  4A9I A;  3UV2 A;  5H1T A;  5DYA A;  5D7X A;  4UYD A;  5CP5 A;  4YH3 A;  5I1Q A;  4O72 A;  3P1C A;  5F36 A;  5LKX A;  5DW1 A;  5ENC A;  5ENI A;  5FG6 A;  5CQ8 A;  4MR5 A;  5AME A;  4LZS A;  5IGK A;  2RI7 A;  4CUU A;  5EWD A;  4A9J A;  4UIY A;  4AKG A;  3S91 A;  5HM0 A;  5A5R A;  2F6J A;  4N4G A;  5ETB A;  4TT6 A;  4LYW A;  5EIC A;  4NUC A;  5EIS A;  5EPB A;  4HXK A;  3JVJ A;  4NRC A;  5EVA A;  5EI4 A;  4NR8 A;  5L99 A;  4YAB A;  5ENH A;  5FDZ A;  4OGJ A;  2D82 A;  2I8N A;  5G4R A;  5HLS A;  5EPS A;  5DFD A;  3ZYU A;  3S92 A;  4YAT A;  5A7C A;  2E7N A;  4O7C A;  3P1E A;  4N3W A;  5DKC A;  5I83 A;  4PTB A;  5HJC A;  4Z1Q A;  4J3I A;  4YY4 A;  2G4A A;  4QSR A;  3HMF A;  5E7D A;  5FFV A;  4NS5 A;  4PCE A;  5ENJ A;  4NQN A;  4PY6 A;  5ENE A;  5CQT A;  3IU5 A;  3JVL A;  4LZR A;  5EGU A;  5DX4 A;  5ACY A;  5E73 A;  5EU1 A;  2E7O A;  4KV1 A;  5E0R A;  5F25 A;  5F2P A;  4YK0 A;  5HRW A;  3GG3 A;  3P5O A;  3UVY A;  4Z6H A;  4Z6I A;  3HMH A;  5CQ6 A;  2NXB A;  4QUT A;  4E96 A;  3ERR A;  1ZS5 A;  3O34 A;  4TT2 A;  4UIV A;  3ONI A;  2RNY A;  4QC1 A;  5DKH A;  3AAD A;  4MEP A;  4OUF A;  4ZC9 A;  3U5J A;  4FLP A;  5DLZ A;  2DKW A;  4UIX A;  5FE4 A;  5A5N A;  5DYU A;  5FFW A;  4AKI A;  3UVW A;  3U5K A;  3U5M A;  2RO1 A;  3U5P A;  5LKT A;  5ENF A;  5F61 A;  4Z1S A;  4TU4 A;  5CTL A;  4C66 A;  4A9F A;  5LUU A;  5F1H A;  4A9M A;  3LXJ A;  4RVR A;  5DFB A;  5FE8 A;  5CUB A;  5DYC A;  5A85 A;  4LRG A;  5C89 A;  4J0S A;  3SVH A;  4TS8 A;  2WP1 A;  5G4S A;  4HXP A;  5I7X A;  2E3K A;  5CRM A;  5IGL A;  5I40 A;  5L8T A;  3JVM A;  2EJN A;  5CUD A;  4NYW A;  5HRV A;  2WP2 A;  1X0J A;  4YY6 A;  2DVR A;  2RNX A;  5F63 A;  4YYD A;  4HXL A;  4NRB A;  3P1F A;  4CUT A;  4MR6 A;  4BW3 A;  4O78 A;  4XY9 A;  4A9K A;  5D3T A;  5A5P A;  3Q2F A;  4O71 A;  5KTX A;  5EWV A;  5I86 A;  3FKM X;  4YH4 A;  4NR7 A;  3UW9 A;  5E9I A;  3MB3 A;  4KV4 A;  5HEL A;  5IGM A;  4NQM A;  5CPE A;  4BHW A;  4NR6 A;  2L5E A;  4O75 A;  5LJ0 A;  2OO1 A;  5HFR A;  1PUO A;  5CUC A;  2OUO A;  4PS5 A;  4MR4 A;  3AQA A;  4Y03 A;  4YYH A;  3U5O A;  4UYH A;  2OSS A;  4XYA A;  5TB6 A;  3VKG A;  3D1D A;  4QSS A;  2YDW A;  4O7A A;  5FBX A;  5KTW A;  2DAT A;  5FH8 A;  2YEK A;  4ZW1 A;  3SVF A;  5H1V A;  4J0R A;  5ETD A;  5ENB A;  5EWC A;  3JVK A;  5CZG A;  4MEO A;  5D3L A;  3O35 A;  2L85 A;  4YYM A;  5II1 A;  4YAX A;  5DW2 A;  4TQN A;  5E3G A;  5CRZ A;  2DWW A;  5D26 A;  5E74 A;  3QZT A;  4NR9 A;  5D25 A;  5FE2 A;  4ZQL A;  4QR5 A;  5D3R A;  5KU3 A;  2GRC A;  4GPJ A;  4IR6 A;  5F3A A;  3LJW A;  5E3D A;  4NUE A;  4LYS A;  3P1D A;  4O7F A;  3DWY A;  5L97 A;  5J0D A;  4ALH A;  5EWW A;  5HEM A;  5CUE A;  4NXJ A;  3G0L A;  4CUR A;  5FFY A;  5FG4 A;  5FH7 A;  4LR6 A;  4UYF B;  5I7Y A;  4IOQ A;  4NYV A;  5C8G A;  5LVQ A;  4HBX A;  4LDF A;  4WHU A;  4QSV A;  3TLP A;  5BT5 A;  5E9M A;  5L98 A;  5A81 A;  4HXS A;  5DYX A;  4C67 A;  2YQD A;  5DFC A;  3MUK A;  3VKH A;  4UYG A;  4AKN A;  2H60 A;  4QSX A;  4QEW A;  3LQJ A;  4IR3 A;  5EK9 A;  5EP7 A;  5CFW A;  5CQ5 A;  4UIU A;  5LKZ A;  4WIV A;  5EWH A;  2YEL A;  5II2 A;  4BJX A;  4O76 A;  5FE3 A;  2MJV B;  4BW1 A;  5FE5 A;  5FE9 A;  5I29 A;  5TCM A;  4UIW A;  4BW2 A;  4QY4 A;  5K29 A;  2FSA A;  2L84 A;  3NXB A;  5CS8 A;  5D3J A;  4QNS A;  4A9O A;  3G0J A;  4WHW A;  3QZV A;  5HFQ A;  4YYK A;  5A5O A;  4IR4 A;  4QEV A;  5C87 A;  5KHM A;  2DVQ A;  2I7K A;  5EA1 A;  4YC9 A;  4HXN A;  4O7B A;  4YYG A;  5A5S A;  4NYX A;  5BT4 A;  4CUS A;  2R0S A;  4QEU A;  5FB1 A;  5EM3 A;  3UVX A;  5I80 A;  5DLX A;  5I89 A;  4A9N A;  4QUU A;  4UIT A;  5D0C A;  4CLB A;  5CQA A;  4J1P A;  5CUA A;  4N4F A;  5HEN A;  4IR5 A;  4QSQ A;  3MB4 A;  5A82 A;  4HXR A;  5CQ4 A;  2R0Y A;  5EPR A;  4CUQ A;  2DVV A;  3U5N A;  4IOR A;  4QSW A;  5EV9 A;  3UV5 A;  5LJ2 A;  4HBW A;  5FG5 A;  1WUG A;  3U5L A;  4TZ2 A;  4X2I A;  4CFL A;  5HQ6 A;  4O70 A;  5DY7 A;  5AMF A;  5FE0 A;  5ENG A;  4NRA A;  2R0V A;  4TZ8 A;  5IID A;  3O36 A;  4HBY A;  5C4Q A;  4LC2 A;  5JWM A;  5FE6 A;  4QZS A;  5D3N A;  5A5Q A;  4N4I A;  5L8U A;  2RNW A;  5FH6 A;  1ZKR A;  5D3S A;  2RFJ A;  4QB3 A;  4MEN A;  4QBM A;  5AD2 A;  4NR5 A;  5FE1 A;  4YBS A;  4A9E A;  5LKU A;  3UV4 A;  2KTB B;  4QYL A;  3DAI A;  4IOO A;  4QSU A;  5CGP A;  5D24 A;  2LSP B;  4AI6 A;  2YW5 A;  5LVR A;  4YBT A;  5HCL A;  1N72 A;  4TTE A;  1F68 A;  5DKD A;  5CQ3 A;  4YYJ A;  5IG6 A;  4PKL A;  5F1L A;  4KCX A;  4ALG A;  4HBV A;  4N4H A;  4YYI A;  4QR3 A;  5A83 A;  4Q0O A;  4A9H A;  4AKH A;  5HQ5 A;  3D7C A;  4LZ2 A;  4NUD A;  5IBN A;  5H1U A;  3LQH A;  3O33 A;  4YBM A;  4CUP A;  5LJ1 A;  4O74 A;  2R10 A;  5F60 A;  4QST A;  3K2J A;  5KTU A;  1E6I A;  4LYI A;  4HXM A;  4QYD A;  5JI8 A; 
#chains in the Genus database with same CATH homology
 4YAD A;  5C7N A;  5DBM A;  3O37 A;  3MXF A;  3LQI A;  4UYE A;  4TYL A;  3I3J A;  4TT4 A;  1JM4 B;  5E9K A;  5F62 A;  4PCI A;  4O77 A;  4HXO A;  3QZS A;  4NR4 A;  4TU6 A;  5FE7 A;  4MEQ A;  2F6N A;  5C85 A;  2RS9 B;  4F3I A;  4A9L A;  4QC3 A;  5CU8 A;  3IU6 A;  3HME A;  5FB0 A;  4XUA A;  5KO4 A;  4QR4 A;  5D3P A;  4DON A;  3MUL A;  3MQM A;  5E9Y A;  2D9E A;  5CQ7 A;  5F5Z A;  4XUB A;  2YYN A;  5EQ1 A;  1WUM A;  4YYN A;  5I88 A;  5AD3 A;  5CY9 A;  5COI A;  3UVD A;  3Q2E A;  2DVS A;  5D3H A;  5L96 A;  3SVG A;  3RCW A;  5CUG A;  4QSP A;  4UIZ A;  4CL9 A;  4XY8 A;  5BT3 A;  5IGN A;  5E9V A;  4UYF A;  4Z93 A;  4CFK A;  1JSP B;  4MR3 A;  1EQF A;  4OGI A;  2YEM A;  2N9G A;  4Q0N A;  5HQ7 A;  4O7E A;  5HRX A;  4BW4 A;  5E9L A;  5H85 A;  4A9I A;  3UV2 A;  5H1T A;  5DYA A;  5D7X A;  4UYD A;  5CP5 A;  4YH3 A;  5I1Q A;  4O72 A;  3P1C A;  5F36 A;  5LKX A;  5DW1 A;  5ENC A;  5ENI A;  5FG6 A;  5CQ8 A;  4MR5 A;  5AME A;  4LZS A;  5IGK A;  2RI7 A;  4CUU A;  5EWD A;  4A9J A;  4UIY A;  3S91 A;  5HM0 A;  5A5R A;  2F6J A;  4N4G A;  5ETB A;  4TT6 A;  4LYW A;  5EIC A;  4NUC A;  5EIS A;  5EPB A;  4HXK A;  3JVJ A;  4NRC A;  5EVA A;  5EI4 A;  4NR8 A;  5L99 A;  4YAB A;  5ENH A;  5FDZ A;  4OGJ A;  2D82 A;  2I8N A;  5G4R A;  5HLS A;  5EPS A;  5DFD A;  3ZYU A;  3S92 A;  4YAT A;  5A7C A;  2E7N A;  4O7C A;  3P1E A;  4N3W A;  5DKC A;  5I83 A;  4PTB A;  5HJC A;  4Z1Q A;  4J3I A;  4YY4 A;  2G4A A;  4QSR A;  3HMF A;  5E7D A;  5FFV A;  4NS5 A;  4PCE A;  5ENJ A;  4NQN A;  4PY6 A;  5ENE A;  5CQT A;  3IU5 A;  3JVL A;  4LZR A;  5EGU A;  5DX4 A;  5ACY A;  5E73 A;  5EU1 A;  2E7O A;  4KV1 A;  5E0R A;  5F25 A;  5F2P A;  4YK0 A;  5HRW A;  3GG3 A;  3P5O A;  3UVY A;  4Z6H A;  4Z6I A;  3HMH A;  5CQ6 A;  2NXB A;  4QUT A;  4E96 A;  1ZS5 A;  3O34 A;  4TT2 A;  4UIV A;  3ONI A;  2RNY A;  4QC1 A;  5DKH A;  3AAD A;  4MEP A;  4OUF A;  4ZC9 A;  3U5J A;  4FLP A;  5DLZ A;  2DKW A;  4UIX A;  5FE4 A;  5A5N A;  5DYU A;  5FFW A;  3UVW A;  3U5K A;  3U5M A;  2RO1 A;  3U5P A;  5LKT A;  5ENF A;  5F61 A;  4Z1S A;  4TU4 A;  5CTL A;  4C66 A;  4A9F A;  5LUU A;  5F1H A;  4A9M A;  3LXJ A;  4RVR A;  5DFB A;  5FE8 A;  5CUB A;  5DYC A;  5A85 A;  4LRG A;  5C89 A;  4J0S A;  3SVH A;  4TS8 A;  2WP1 A;  5G4S A;  4HXP A;  5I7X A;  2E3K A;  5CRM A;  5IGL A;  5I40 A;  5L8T A;  3JVM A;  5CUD A;  4NYW A;  5HRV A;  2WP2 A;  1X0J A;  4YY6 A;  2DVR A;  2RNX A;  5F63 A;  4YYD A;  4HXL A;  4NRB A;  3P1F A;  4CUT A;  4MR6 A;  4BW3 A;  4O78 A;  4XY9 A;  4A9K A;  5D3T A;  5A5P A;  3Q2F A;  4O71 A;  5KTX A;  5EWV A;  5I86 A;  3FKM X;  4YH4 A;  4NR7 A;  3UW9 A;  5E9I A;  3MB3 A;  4KV4 A;  5HEL A;  5IGM A;  4NQM A;  5CPE A;  4BHW A;  4NR6 A;  2L5E A;  4O75 A;  5LJ0 A;  2OO1 A;  5HFR A;  5CUC A;  2OUO A;  4PS5 A;  4MR4 A;  3AQA A;  4Y03 A;  4YYH A;  3U5O A;  4UYH A;  2OSS A;  4XYA A;  5TB6 A;  4QSS A;  2YDW A;  4O7A A;  5FBX A;  5KTW A;  2DAT A;  5FH8 A;  2YEK A;  4ZW1 A;  3SVF A;  5H1V A;  4J0R A;  5ETD A;  5ENB A;  5EWC A;  3JVK A;  5CZG A;  4MEO A;  5D3L A;  3O35 A;  2L85 A;  4YYM A;  5II1 A;  4YAX A;  5DW2 A;  4TQN A;  5E3G A;  5CRZ A;  2DWW A;  5D26 A;  5E74 A;  3QZT A;  4NR9 A;  5D25 A;  5FE2 A;  4ZQL A;  4QR5 A;  5D3R A;  5KU3 A;  2GRC A;  4GPJ A;  4IR6 A;  5F3A A;  3LJW A;  5E3D A;  4NUE A;  4LYS A;  3P1D A;  4O7F A;  3DWY A;  5L97 A;  5J0D A;  4ALH A;  5EWW A;  5HEM A;  5CUE A;  4NXJ A;  3G0L A;  4CUR A;  5FFY A;  5FG4 A;  5FH7 A;  4LR6 A;  4UYF B;  5I7Y A;  4IOQ A;  4NYV A;  5C8G A;  5LVQ A;  4HBX A;  4LDF A;  4WHU A;  4QSV A;  3TLP A;  5BT5 A;  5E9M A;  5L98 A;  5A81 A;  4HXS A;  5DYX A;  4C67 A;  2YQD A;  5DFC A;  3MUK A;  4UYG A;  4AKN A;  2H60 A;  4QSX A;  4QEW A;  3LQJ A;  4IR3 A;  5EK9 A;  5EP7 A;  5CFW A;  5CQ5 A;  4UIU A;  5LKZ A;  4WIV A;  5EWH A;  2YEL A;  5II2 A;  4BJX A;  4O76 A;  5FE3 A;  2MJV B;  4BW1 A;  5FE5 A;  5FE9 A;  5I29 A;  5TCM A;  4UIW A;  4BW2 A;  4QY4 A;  5K29 A;  2FSA A;  2L84 A;  3NXB A;  5CS8 A;  5D3J A;  4QNS A;  4A9O A;  3G0J A;  4WHW A;  3QZV A;  5HFQ A;  4YYK A;  5A5O A;  4IR4 A;  4QEV A;  5C87 A;  5KHM A;  2DVQ A;  2I7K A;  5EA1 A;  4YC9 A;  4HXN A;  4O7B A;  4YYG A;  5A5S A;  4NYX A;  5BT4 A;  4CUS A;  2R0S A;  4QEU A;  5FB1 A;  5EM3 A;  3UVX A;  5I80 A;  5DLX A;  5I89 A;  4A9N A;  4QUU A;  4UIT A;  5D0C A;  4CLB A;  5CQA A;  4J1P A;  5CUA A;  4N4F A;  5HEN A;  4IR5 A;  4QSQ A;  3MB4 A;  5A82 A;  4HXR A;  5CQ4 A;  2R0Y A;  5EPR A;  4CUQ A;  2DVV A;  3U5N A;  4IOR A;  4QSW A;  5EV9 A;  3UV5 A;  5LJ2 A;  4HBW A;  5FG5 A;  1WUG A;  3U5L A;  4TZ2 A;  4X2I A;  4CFL A;  5HQ6 A;  4O70 A;  5DY7 A;  5AMF A;  5FE0 A;  5ENG A;  4NRA A;  2R0V A;  4TZ8 A;  5IID A;  3O36 A;  4HBY A;  5C4Q A;  4LC2 A;  5JWM A;  5FE6 A;  4QZS A;  5D3N A;  5A5Q A;  4N4I A;  5L8U A;  2RNW A;  5FH6 A;  5D3S A;  2RFJ A;  4QB3 A;  4MEN A;  4QBM A;  5AD2 A;  4NR5 A;  5FE1 A;  4YBS A;  4A9E A;  5LKU A;  3UV4 A;  2KTB B;  4QYL A;  3DAI A;  4IOO A;  4QSU A;  5CGP A;  5D24 A;  2LSP B;  2YW5 A;  5LVR A;  4YBT A;  5HCL A;  1N72 A;  4TTE A;  1F68 A;  5DKD A;  5CQ3 A;  4YYJ A;  5IG6 A;  4PKL A;  5F1L A;  4KCX A;  4ALG A;  4HBV A;  4N4H A;  4YYI A;  4QR3 A;  5A83 A;  4Q0O A;  4A9H A;  5HQ5 A;  3D7C A;  4LZ2 A;  4NUD A;  5IBN A;  5H1U A;  3LQH A;  3O33 A;  4YBM A;  4CUP A;  5LJ1 A;  4O74 A;  2R10 A;  5F60 A;  4QST A;  3K2J A;  5KTU A;  1E6I A;  4LYI A;  4HXM A;  4QYD A;  5JI8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...