5F25A

Crystal structure of the brd9 bromodomain in complex with compound 4.
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
113
structure length
113
Chain Sequence
STPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDFGTMKDKIVANEYKSVTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMSKERLLALKRSMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords BRD9
publication title Structure-Based Design of an in Vivo Active Selective BRD9 Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
total genus 41
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5f25A00
5D3SA 4UYHA 5EK9A 4A9IA 5D25A 5DFBA 5EV9A 3LQJA 5ENEA 5FE6A 4O75A 5LKZA 4IOQA 5LJ0A 4MEPA 5F1LA 5A5QA 1JSPB 4QC3A 3P1CA 2D9EA 4LYSA 5F63A 5DY7A 5C85A 4YBMA 4CUSA 5H1TA 4YH3A 5HM0A 4QR4A 5F60A 2YDWA 3LQIA 5DW1A 3U5OA 4YYNA 5HCLA 3MB3A 5L98A 5D3PA 4C66A 4A9NA 5AD3A 4O7FA 3UV5A 4QSTA 5LJ2A 5KU3A 2DVVA 4NS5A 4UITA 3ONIA 5FE3A 5A83A 5DKDA 4CLBA 4XUBA 5I88A 5CQ7A 5D0CA 4HXSA 4TT4A 4WIVA 5CY9A 5D24A 4PY6A 5CQ8A 5CU8A 5L97A 4BW2A 4QSVA 5FDZA 3UVWA 4YADA 4HBWA 5EQ1A 5E7DA 5E3GA 5D26A 5FG4A 5H1UA 2YELA 4MR5A 4UYGA 4QEVA 4UYFB 4BHWA 4LRGA 5EWCA 4NRCA 5C4QA 2WP2A 5LUUA 5IGLA 3S92A 4OGIA 5I29A 4O70A 3FKMX 3NXBA 4NQMA 4PCIA 5D3NA 5E9LA 5E9MA 5FFVA 5ENJA 4C67A 5CPEA 4UIVA 3RCWA 5CQ5A 4Y03A 4QZSA 4CL9A 2DVSA 4RVRA 4X2IA 4IORA 2OUOA 5BT3A 5F62A 4PTBA 4XYAA 4TZ2A 4QSRA 5KHMA 5ENGA 5CRMA 5I1QA 5EICA 4O7EA 5LKUA 5AMEA 4NUCA 5F61A 4Q0NA 4XUAA 5A5RA 4ZQLA 4LZRA 5CUAA 4Z93A 3SVHA 4NR4A 1WUMA 4N4FA 1WUGA 4O71A 2YW5A 5IGMA 2GRCA 5HFQA 4CURA 4HBVA 4DONA 2KTBB 5H1VA 4TYLA 2R0SA 2D82A 3UVDA 3UW9A 5DX4A 5CUCA 4NR9A 3K2JA 4NYWA 4F3IA 5A81A 5KO4A 4MEOA 5D3JA 5FE5A 3U5PA 5EWDA 3TLPA 2H60A 3O36A 5FG5A 4J1PA 5L8UA 3LXJA 5FE2A 5EI4A 5HRVA 4PCEA 4CUQA 5ENCA 5E9IA 4HXPA 5II1A 4YYGA 4J0RA 4CUTA 4UIZA 4QUTA 5C7NA 4MENA 5L96A 4QC1A 3DWYA 1JM4B 4YYHA 3GG3A 5HRWA 4QEUA 4QB3A 3QZVA 5KTXA 2DVRA 4A9FA 5ENIA 2RNXA 5ETBA 5I86A 4A9EA 5ENHA 5DYXA 4ALGA 4YY4A 3HMFA 5EPBA 5E0RA 5KTWA 3U5KA 4ALHA 5IIDA 5TB6A 4PKLA 4WHWA 4UIUA 4BW3A 2DWWA 3S91A 3ZYUA 4YYJA 3I3JA 4LYWA 5BT5A 5HQ6A 5BT4A 3Q2FA 4OGJA 4PS5A 5EWHA 5HRXA 4O74A 5C87A 4WHUA 5HQ7A 4QSXA 2L85A 2E7OA 4N4HA 3AQAA 3MUKA 2DVQA 5EM3A 4IOOA 3UVXA 3AADA 5FE1A 5DYUA 4NQNA 5FFWA 4FLPA 4QYLA 5D3HA 4NR6A 3UVYA 5EP7A 4TU4A 4YAXA 5IBNA 5EISA 5I7XA 5EU1A 2RFJA 4O72A 5E9YA 2L5EA 5FE9A 4NRAA 4UIWA 2YEKA 5A5PA 2I7KA 2FSAA 3MQMA 4MR3A 4QSQA 5A5OA 5J0DA 2F6NA 3P1EA 5CUBA 5LVRA 5EPRA 2RNWA 4J3IA 4TT2A 4O78A 4TU6A 5CQAA 4LYIA 5CUGA 5H85A 4QSPA 5D3RA 4N4GA 3HMEA 4HXKA 4TZ8A 3U5MA 2RI7A 4XY9A 2WP1A 5DLZA 4UYFA 2E7NA 4QUUA 5E74A 2E3KA 5CQ3A 5I80A 5CFWA 5CS8A 5F1HA 5A7CA 4IR5A 2N9GA 3D7CA 2R10A 3O37A 5DLXA 3G0JA 5LKXA 4YY6A 5F2PA 5HQ5A 4A9KA 5DFDA 4KV4A 5IGKA 2OO1A 2R0VA 5FE8A 4NR5A 4O77A 3HMHA 2RNYA 5ENFA 3IU6A 4TT6A 4Z1QA 5CRZA 3U5NA 4NYVA 2NXBA 3O33A 2L84A 4Q0OA 4YYIA 5AMFA 4QYDA 4A9LA 1N72A 5EA1A 5I83A 5FH8A 3JVMA 5F25A 5LJ1A 2F6JA 5F3AA 4NUEA 4A9JA 5CTLA 4GPJA 4QEWA 5EWVA 4MR6A 5A5NA 4YH4A 5LKTA 4CUPA 4O76A 4LDFA 4CUUA 4Z6IA 1X0JA 5FE4A 4HXLA 5I7YA 4NUDA 5G4SA 3QZTA 4BW1A 5A5SA 4MR4A 5FH6A 2G4AA 5CP5A 4ZW1A 4HBYA 4UYDA 5DFCA 4HXMA 5L99A 3O34A 4Z1SA 3SVGA 2RS9B 3MB4A 4TS8A 5KTUA 5D3LA 5DW2A 2DATA 5E9VA 5II2A 4IR3A 3MXFA 5E3DA 5DKCA 3G0LA 3P5OA 5FG6A 5HFRA 4LC2A 5FB1A 5IGNA 2LSPB 4TTEA 5CUEA 3P1FA 5CZGA 4BJXA 5FFYA 5CGPA 4UIXA 4HXRA 4A9MA 1F68A 5FE0A 4YBSA 5A85A 4O7AA 4IR4A 4O7CA 4NXJA 3JVLA 4IR6A 3UV2A 5IG6A 4QBMA 5HJCA 4QNSA 4QR5A 2YEMA 5HLSA 2OSSA 3Q2EA 1EQFA 5HEMA 2RO1A 5CUDA 5F5ZA 5I40A 3SVFA 4UYEA 4BW4A 4LZ2A 5C8GA 4YYKA 5I89A 4N4IA 5ACYA 5FB0A 4KV1A 5HELA 4NRBA 3DAIA 5DBMA 3U5JA 3LJWA 2R0YA 5ENBA 5D7XA 4YBTA 4E96A 4YYDA 4NR8A 4QSSA 4UIYA 3LQHA 5D3TA 4XY8A 5EPSA 4Z6HA 2DKWA 3QZSA 4N3WA 3MULA 2I8NA 5EWWA 5EGUA 4HXNA 3O35A 5A82A 5EVAA 5AD2A 5K29A 5DYAA 4AKNA 4A9HA 3UV4A 4QY4A 4YYMA 5TCMA 4HBXA 2YYNA 5JI8A 5C89A 4O7BA 5E9KA 4QSWA 5F36A 5CQ4A 4LR6A 4TQNA 5ETDA 4CFKA 5DKHA 5CQ6A 1ZS5A 4YABA 2YQDA 3JVJA 4OUFA 4YK0A 4YC9A 4MEQA 5JWMA 4HXOA 5CQTA 1E6IA 5DYCA 4CFLA 3JVKA 4YATA 4J0SA 5LVQA 5E73A 4A9OA 5FH7A 5FE7A 3IU5A 5FBXA 3U5LA 4LZSA 3P1DA 4QSUA 4QR3A 2MJVB 4NR7A 4NYXA 5G4RA 4KCXA 4ZC9A 5COIA 5HENA 5L8TA
chains in the Genus database with same CATH superfamily
5D3SA 4UYHA 5EK9A 4A9IA 5D25A 5DFBA 5EV9A 3LQJA 5ENEA 5FE6A 4O75A 5LKZA 4IOQA 5LJ0A 4MEPA 5F1LA 5A5QA 1JSPB 4QC3A 3P1CA 2D9EA 4LYSA 5F63A 5DY7A 5C85A 4YBMA 4CUSA 5H1TA 4YH3A 5HM0A 4QR4A 5F60A 2YDWA 3LQIA 5DW1A 3U5OA 4YYNA 5HCLA 3MB3A 5L98A 5D3PA 4C66A 4A9NA 5AD3A 4O7FA 3UV5A 4QSTA 5LJ2A 5KU3A 2DVVA 4NS5A 4UITA 3ONIA 5FE3A 5A83A 5DKDA 4CLBA 4XUBA 5I88A 5CQ7A 5D0CA 4HXSA 4TT4A 4WIVA 5CY9A 5D24A 4PY6A 5CQ8A 5CU8A 5L97A 4BW2A 4QSVA 5FDZA 1PUOA 3UVWA 4YADA 4HBWA 5EQ1A 5E7DA 5E3GA 5D26A 5FG4A 5H1UA 2YELA 4MR5A 4UYGA 4QEVA 4UYFB 4BHWA 4LRGA 5EWCA 4NRCA 5C4QA 2WP2A 5LUUA 5IGLA 3S92A 4OGIA 5I29A 4O70A 3FKMX 3NXBA 4NQMA 4PCIA 5D3NA 5E9LA 5E9MA 5FFVA 5ENJA 4C67A 5CPEA 4UIVA 3RCWA 5CQ5A 4Y03A 4QZSA 4CL9A 2DVSA 4RVRA 4X2IA 4IORA 2OUOA 5BT3A 5F62A 4PTBA 4XYAA 4TZ2A 4QSRA 5KHMA 5ENGA 5CRMA 5I1QA 5EICA 4O7EA 5LKUA 5AMEA 4NUCA 5F61A 4Q0NA 4XUAA 5A5RA 4ZQLA 4LZRA 5CUAA 4Z93A 3SVHA 4NR4A 1WUMA 4N4FA 1WUGA 4O71A 2YW5A 5IGMA 2GRCA 5HFQA 4CURA 4HBVA 4DONA 2KTBB 5H1VA 4TYLA 2R0SA 2D82A 3UVDA 3UW9A 5DX4A 5CUCA 4NR9A 3K2JA 4NYWA 4F3IA 5A81A 5KO4A 4MEOA 5D3JA 5FE5A 3U5PA 5EWDA 3TLPA 2H60A 3O36A 5FG5A 4J1PA 5L8UA 3LXJA 5FE2A 5EI4A 5HRVA 4PCEA 4CUQA 5ENCA 5E9IA 4HXPA 5II1A 4YYGA 4J0RA 4CUTA 4UIZA 4QUTA 5C7NA 4MENA 5L96A 4AKHA 4QC1A 3DWYA 1JM4B 4YYHA 3GG3A 5HRWA 4QEUA 4QB3A 3QZVA 5KTXA 2DVRA 4A9FA 5ENIA 2RNXA 5ETBA 5I86A 4A9EA 5ENHA 5DYXA 4ALGA 4YY4A 3HMFA 5EPBA 5E0RA 5KTWA 3U5KA 4ALHA 5IIDA 5TB6A 4PKLA 4WHWA 4UIUA 4BW3A 2DWWA 3S91A 3ZYUA 4YYJA 3I3JA 4LYWA 5BT5A 5HQ6A 5BT4A 3Q2FA 4OGJA 4PS5A 5EWHA 5HRXA 4O74A 5C87A 4WHUA 5HQ7A 4QSXA 2L85A 2E7OA 4N4HA 3AQAA 3MUKA 2DVQA 5EM3A 4IOOA 3UVXA 3AADA 5FE1A 5DYUA 4NQNA 3D1BA 5FFWA 4FLPA 4QYLA 5D3HA 4NR6A 3UVYA 5EP7A 3D1DA 4TU4A 4YAXA 5IBNA 5EISA 5I7XA 5EU1A 2RFJA 4O72A 5E9YA 2L5EA 5FE9A 4NRAA 4UIWA 2YEKA 5A5PA 2I7KA 2FSAA 3MQMA 4MR3A 4QSQA 5A5OA 5J0DA 2F6NA 3P1EA 5CUBA 5LVRA 5EPRA 2RNWA 4J3IA 4TT2A 4O78A 4TU6A 5CQAA 4LYIA 5CUGA 5H85A 4QSPA 5D3RA 4N4GA 3HMEA 4HXKA 4TZ8A 3U5MA 2RI7A 4XY9A 2WP1A 5DLZA 4UYFA 2E7NA 4QUUA 5E74A 2E3KA 5CQ3A 5I80A 5CFWA 5CS8A 3VKHA 5F1HA 5A7CA 3ERRA 4IR5A 2N9GA 3D7CA 2R10A 3O37A 5DLXA 3G0JA 5LKXA 4YY6A 5F2PA 5HQ5A 4A9KA 5DFDA 4KV4A 5IGKA 2OO1A 2R0VA 5FE8A 4NR5A 4O77A 3HMHA 2RNYA 5ENFA 3IU6A 4TT6A 4Z1QA 5CRZA 3U5NA 4NYVA 2NXBA 3O33A 2L84A 4Q0OA 4YYIA 5AMFA 4QYDA 4A9LA 1N72A 5EA1A 5I83A 5FH8A 3JVMA 5F25A 5LJ1A 2F6JA 5F3AA 4NUEA 4A9JA 5CTLA 4GPJA 4QEWA 5EWVA 4MR6A 5A5NA 4YH4A 5LKTA 4CUPA 4O76A 4LDFA 4CUUA 4Z6IA 1X0JA 5FE4A 4HXLA 5I7YA 4NUDA 5G4SA 3QZTA 4BW1A 5A5SA 4MR4A 5FH6A 2G4AA 5CP5A 4ZW1A 4HBYA 4UYDA 5DFCA 4HXMA 5L99A 3O34A 4Z1SA 3SVGA 2RS9B 3MB4A 4TS8A 5KTUA 5D3LA 5DW2A 2DATA 5E9VA 5II2A 4IR3A 3MXFA 5E3DA 5DKCA 3G0LA 3P5OA 5FG6A 5HFRA 4LC2A 5FB1A 5IGNA 2LSPB 4TTEA 5CUEA 3P1FA 5CZGA 4BJXA 5FFYA 5CGPA 4UIXA 4HXRA 4A9MA 1F68A 5FE0A 4YBSA 5A85A 4O7AA 4IR4A 4O7CA 4NXJA 3JVLA 4IR6A 3UV2A 4AKIA 5IG6A 4QBMA 5HJCA 4QNSA 4QR5A 2YEMA 5HLSA 2OSSA 3Q2EA 1EQFA 5HEMA 2RO1A 5CUDA 5F5ZA 5I40A 3SVFA 4UYEA 4BW4A 4LZ2A 5C8GA 4YYKA 5I89A 4N4IA 5ACYA 5FB0A 4KV1A 5HELA 4NRBA 3DAIA 5DBMA 3U5JA 4AI6A 3LJWA 2R0YA 5ENBA 5D7XA 4YBTA 4E96A 4YYDA 4NR8A 4QSSA 4UIYA 3LQHA 5D3TA 4XY8A 5EPSA 4Z6HA 2DKWA 3QZSA 4N3WA 3MULA 2I8NA 5EWWA 4AKGA 5EGUA 4HXNA 3O35A 5A82A 5EVAA 5AD2A 2EJNA 5K29A 5DYAA 4AKNA 4A9HA 3UV4A 4QY4A 4YYMA 5TCMA 4HBXA 2YYNA 5JI8A 5C89A 3VKGA 4O7BA 5E9KA 4QSWA 5F36A 5CQ4A 4LR6A 4TQNA 5ETDA 4CFKA 5DKHA 5CQ6A 1ZS5A 4YABA 2YQDA 3JVJA 4OUFA 4YK0A 4YC9A 4MEQA 5JWMA 4HXOA 5CQTA 1E6IA 5DYCA 4CFLA 3JVKA 4YATA 4J0SA 5LVQA 5E73A 4A9OA 5FH7A 5FE7A 3IU5A 5FBXA 3U5LA 4LZSA 3P1DA 4QSUA 4QR3A 2MJVB 4NR7A 1ZKRA 4NYXA 5G4RA 4KCXA 4ZC9A 5COIA 5HENA 5L8TA
chains in the Genus database with same CATH topology
5D3SA 4UYHA 5EK9A 4A9IA 5D25A 5DFBA 5EV9A 3LQJA 5ENEA 5FE6A 4O75A 5LKZA 4IOQA 5LJ0A 4MEPA 5F1LA 5A5QA 1JSPB 4QC3A 3P1CA 2D9EA 4LYSA 5F63A 5DY7A 5C85A 4YBMA 4CUSA 5H1TA 4YH3A 5HM0A 4QR4A 5F60A 2YDWA 3LQIA 5DW1A 3U5OA 4YYNA 5HCLA 3MB3A 5L98A 5D3PA 4C66A 4A9NA 5AD3A 4O7FA 3UV5A 4QSTA 5LJ2A 5KU3A 2DVVA 4NS5A 4UITA 3ONIA 5FE3A 5A83A 5DKDA 4CLBA 4XUBA 5I88A 5CQ7A 5D0CA 4HXSA 4TT4A 4WIVA 5CY9A 5D24A 4PY6A 5CQ8A 5CU8A 5L97A 4BW2A 4QSVA 5FDZA 3UVWA 4YADA 4HBWA 5EQ1A 5E7DA 5E3GA 5D26A 5FG4A 5H1UA 2YELA 4MR5A 4UYGA 4QEVA 4UYFB 4BHWA 4LRGA 5EWCA 4NRCA 5C4QA 2WP2A 5LUUA 5IGLA 3S92A 4OGIA 5I29A 4O70A 3FKMX 3NXBA 4NQMA 4PCIA 5D3NA 5E9LA 5E9MA 5FFVA 5ENJA 4C67A 5CPEA 4UIVA 3RCWA 5CQ5A 4Y03A 4QZSA 4CL9A 2DVSA 4RVRA 4X2IA 4IORA 2OUOA 5BT3A 5F62A 4PTBA 4XYAA 4TZ2A 4QSRA 5KHMA 5ENGA 5CRMA 5I1QA 5EICA 4O7EA 5LKUA 5AMEA 4NUCA 5F61A 4Q0NA 4XUAA 5A5RA 4ZQLA 4LZRA 5CUAA 4Z93A 3SVHA 4NR4A 1WUMA 4N4FA 1WUGA 4O71A 2YW5A 5IGMA 2GRCA 5HFQA 4CURA 4HBVA 4DONA 2KTBB 5H1VA 4TYLA 2R0SA 2D82A 3UVDA 3UW9A 5DX4A 5CUCA 4NR9A 3K2JA 4NYWA 4F3IA 5A81A 5KO4A 4MEOA 5D3JA 5FE5A 3U5PA 5EWDA 3TLPA 2H60A 3O36A 5FG5A 4J1PA 5L8UA 3LXJA 5FE2A 5EI4A 5HRVA 4PCEA 4CUQA 5ENCA 5E9IA 4HXPA 5II1A 4YYGA 4J0RA 4CUTA 4UIZA 4QUTA 5C7NA 4MENA 5L96A 4QC1A 3DWYA 1JM4B 4YYHA 3GG3A 5HRWA 4QEUA 4QB3A 3QZVA 5KTXA 2DVRA 4A9FA 5ENIA 2RNXA 5ETBA 5I86A 4A9EA 5ENHA 5DYXA 4ALGA 4YY4A 3HMFA 5EPBA 5E0RA 5KTWA 3U5KA 4ALHA 5IIDA 5TB6A 4PKLA 4WHWA 4UIUA 4BW3A 2DWWA 3S91A 3ZYUA 4YYJA 3I3JA 4LYWA 5BT5A 5HQ6A 5BT4A 3Q2FA 4OGJA 4PS5A 5EWHA 5HRXA 4O74A 5C87A 4WHUA 5HQ7A 4QSXA 2L85A 2E7OA 4N4HA 3AQAA 3MUKA 2DVQA 5EM3A 4IOOA 3UVXA 3AADA 5FE1A 5DYUA 4NQNA 5FFWA 4FLPA 4QYLA 5D3HA 4NR6A 3UVYA 5EP7A 4TU4A 4YAXA 5IBNA 5EISA 5I7XA 5EU1A 2RFJA 4O72A 5E9YA 2L5EA 5FE9A 4NRAA 4UIWA 2YEKA 5A5PA 2I7KA 2FSAA 3MQMA 4MR3A 4QSQA 5A5OA 5J0DA 2F6NA 3P1EA 5CUBA 5LVRA 5EPRA 2RNWA 4J3IA 4TT2A 4O78A 4TU6A 5CQAA 4LYIA 5CUGA 5H85A 4QSPA 5D3RA 4N4GA 3HMEA 4HXKA 4TZ8A 3U5MA 2RI7A 4XY9A 2WP1A 5DLZA 4UYFA 2E7NA 4QUUA 5E74A 2E3KA 5CQ3A 5I80A 5CFWA 5CS8A 5F1HA 5A7CA 4IR5A 2N9GA 3D7CA 2R10A 3O37A 5DLXA 3G0JA 5LKXA 4YY6A 5F2PA 5HQ5A 4A9KA 5DFDA 4KV4A 5IGKA 2OO1A 2R0VA 5FE8A 4NR5A 4O77A 3HMHA 2RNYA 5ENFA 3IU6A 4TT6A 4Z1QA 5CRZA 3U5NA 4NYVA 2NXBA 3O33A 2L84A 4Q0OA 4YYIA 5AMFA 4QYDA 4A9LA 1N72A 5EA1A 5I83A 5FH8A 3JVMA 5F25A 5LJ1A 2F6JA 5F3AA 4NUEA 4A9JA 5CTLA 4GPJA 4QEWA 5EWVA 4MR6A 5A5NA 4YH4A 5LKTA 4CUPA 4O76A 4LDFA 4CUUA 4Z6IA 1X0JA 5FE4A 4HXLA 5I7YA 4NUDA 5G4SA 3QZTA 4BW1A 5A5SA 4MR4A 5FH6A 2G4AA 5CP5A 4ZW1A 4HBYA 4UYDA 5DFCA 4HXMA 5L99A 3O34A 4Z1SA 3SVGA 2RS9B 3MB4A 4TS8A 5KTUA 5D3LA 5DW2A 2DATA 5E9VA 5II2A 4IR3A 3MXFA 5E3DA 5DKCA 3G0LA 3P5OA 5FG6A 5HFRA 4LC2A 5FB1A 5IGNA 2LSPB 4TTEA 5CUEA 3P1FA 5CZGA 4BJXA 5FFYA 5CGPA 4UIXA 4HXRA 4A9MA 1F68A 5FE0A 4YBSA 5A85A 4O7AA 4IR4A 4O7CA 4NXJA 3JVLA 4IR6A 3UV2A 5IG6A 4QBMA 5HJCA 4QNSA 4QR5A 2YEMA 5HLSA 2OSSA 3Q2EA 1EQFA 5HEMA 2RO1A 5CUDA 5F5ZA 5I40A 3SVFA 4UYEA 4BW4A 4LZ2A 5C8GA 4YYKA 5I89A 4N4IA 5ACYA 5FB0A 4KV1A 5HELA 4NRBA 3DAIA 5DBMA 3U5JA 3LJWA 2R0YA 5ENBA 5D7XA 4YBTA 4E96A 4YYDA 4NR8A 4QSSA 4UIYA 3LQHA 5D3TA 4XY8A 5EPSA 4Z6HA 2DKWA 3QZSA 4N3WA 3MULA 2I8NA 5EWWA 5EGUA 4HXNA 3O35A 5A82A 5EVAA 5AD2A 5K29A 5DYAA 4AKNA 4A9HA 3UV4A 4QY4A 4YYMA 5TCMA 4HBXA 2YYNA 5JI8A 5C89A 4O7BA 5E9KA 4QSWA 5F36A 5CQ4A 4LR6A 4TQNA 5ETDA 4CFKA 5DKHA 5CQ6A 1ZS5A 4YABA 2YQDA 3JVJA 4OUFA 4YK0A 4YC9A 4MEQA 5JWMA 4HXOA 5CQTA 1E6IA 5DYCA 4CFLA 3JVKA 4YATA 4J0SA 5LVQA 5E73A 4A9OA 5FH7A 5FE7A 3IU5A 5FBXA 3U5LA 4LZSA 3P1DA 4QSUA 4QR3A 2MJVB 4NR7A 4NYXA 5G4RA 4KCXA 4ZC9A 5COIA 5HENA 5L8TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D3S A;  4UYH A;  5EK9 A;  4A9I A;  5D25 A;  5DFB A;  5EV9 A;  3LQJ A;  5ENE A;  5FE6 A;  4O75 A;  5LKZ A;  4IOQ A;  5LJ0 A;  4MEP A;  5F1L A;  5A5Q A;  1JSP B;  4QC3 A;  3P1C A;  2D9E A;  4LYS A;  5F63 A;  5DY7 A;  5C85 A;  4YBM A;  4CUS A;  5H1T A;  4YH3 A;  5HM0 A;  4QR4 A;  5F60 A;  2YDW A;  3LQI A;  5DW1 A;  3U5O A;  4YYN A;  5HCL A;  3MB3 A;  5L98 A;  5D3P A;  4C66 A;  4A9N A;  5AD3 A;  4O7F A;  3UV5 A;  4QST A;  5LJ2 A;  5KU3 A;  2DVV A;  4NS5 A;  4UIT A;  3ONI A;  5FE3 A;  5A83 A;  5DKD A;  4CLB A;  4XUB A;  5I88 A;  5CQ7 A;  5D0C A;  4HXS A;  4TT4 A;  4WIV A;  5CY9 A;  5D24 A;  4PY6 A;  5CQ8 A;  5CU8 A;  5L97 A;  4BW2 A;  4QSV A;  5FDZ A;  3UVW A;  4YAD A;  4HBW A;  5EQ1 A;  5E7D A;  5E3G A;  5D26 A;  5FG4 A;  5H1U A;  2YEL A;  4MR5 A;  4UYG A;  4QEV A;  4UYF B;  4BHW A;  4LRG A;  5EWC A;  4NRC A;  5C4Q A;  2WP2 A;  5LUU A;  5IGL A;  3S92 A;  4OGI A;  5I29 A;  4O70 A;  3FKM X;  3NXB A;  4NQM A;  4PCI A;  5D3N A;  5E9L A;  5E9M A;  5FFV A;  5ENJ A;  4C67 A;  5CPE A;  4UIV A;  3RCW A;  5CQ5 A;  4Y03 A;  4QZS A;  4CL9 A;  2DVS A;  4RVR A;  4X2I A;  4IOR A;  2OUO A;  5BT3 A;  5F62 A;  4PTB A;  4XYA A;  4TZ2 A;  4QSR A;  5KHM A;  5ENG A;  5CRM A;  5I1Q A;  5EIC A;  4O7E A;  5LKU A;  5AME A;  4NUC A;  5F61 A;  4Q0N A;  4XUA A;  5A5R A;  4ZQL A;  4LZR A;  5CUA A;  4Z93 A;  3SVH A;  4NR4 A;  1WUM A;  4N4F A;  1WUG A;  4O71 A;  2YW5 A;  5IGM A;  2GRC A;  5HFQ A;  4CUR A;  4HBV A;  4DON A;  2KTB B;  5H1V A;  4TYL A;  2R0S A;  2D82 A;  3UVD A;  3UW9 A;  5DX4 A;  5CUC A;  4NR9 A;  3K2J A;  4NYW A;  4F3I A;  5A81 A;  5KO4 A;  4MEO A;  5D3J A;  5FE5 A;  3U5P A;  5EWD A;  3TLP A;  2H60 A;  3O36 A;  5FG5 A;  4J1P A;  5L8U A;  3LXJ A;  5FE2 A;  5EI4 A;  5HRV A;  4PCE A;  4CUQ A;  5ENC A;  5E9I A;  4HXP A;  5II1 A;  4YYG A;  4J0R A;  4CUT A;  4UIZ A;  4QUT A;  5C7N A;  4MEN A;  5L96 A;  4QC1 A;  3DWY A;  1JM4 B;  4YYH A;  3GG3 A;  5HRW A;  4QEU A;  4QB3 A;  3QZV A;  5KTX A;  2DVR A;  4A9F A;  5ENI A;  2RNX A;  5ETB A;  5I86 A;  4A9E A;  5ENH A;  5DYX A;  4ALG A;  4YY4 A;  3HMF A;  5EPB A;  5E0R A;  5KTW A;  3U5K A;  4ALH A;  5IID A;  5TB6 A;  4PKL A;  4WHW A;  4UIU A;  4BW3 A;  2DWW A;  3S91 A;  3ZYU A;  4YYJ A;  3I3J A;  4LYW A;  5BT5 A;  5HQ6 A;  5BT4 A;  3Q2F A;  4OGJ A;  4PS5 A;  5EWH A;  5HRX A;  4O74 A;  5C87 A;  4WHU A;  5HQ7 A;  4QSX A;  2L85 A;  2E7O A;  4N4H A;  3AQA A;  3MUK A;  2DVQ A;  5EM3 A;  4IOO A;  3UVX A;  3AAD A;  5FE1 A;  5DYU A;  4NQN A;  5FFW A;  4FLP A;  4QYL A;  5D3H A;  4NR6 A;  3UVY A;  5EP7 A;  4TU4 A;  4YAX A;  5IBN A;  5EIS A;  5I7X A;  5EU1 A;  2RFJ A;  4O72 A;  5E9Y A;  2L5E A;  5FE9 A;  4NRA A;  4UIW A;  2YEK A;  5A5P A;  2I7K A;  2FSA A;  3MQM A;  4MR3 A;  4QSQ A;  5A5O A;  5J0D A;  2F6N A;  3P1E A;  5CUB A;  5LVR A;  5EPR A;  2RNW A;  4J3I A;  4TT2 A;  4O78 A;  4TU6 A;  5CQA A;  4LYI A;  5CUG A;  5H85 A;  4QSP A;  5D3R A;  4N4G A;  3HME A;  4HXK A;  4TZ8 A;  3U5M A;  2RI7 A;  4XY9 A;  2WP1 A;  5DLZ A;  4UYF A;  2E7N A;  4QUU A;  5E74 A;  2E3K A;  5CQ3 A;  5I80 A;  5CFW A;  5CS8 A;  5F1H A;  5A7C A;  4IR5 A;  2N9G A;  3D7C A;  2R10 A;  3O37 A;  5DLX A;  3G0J A;  5LKX A;  4YY6 A;  5F2P A;  5HQ5 A;  4A9K A;  5DFD A;  4KV4 A;  5IGK A;  2OO1 A;  2R0V A;  5FE8 A;  4NR5 A;  4O77 A;  3HMH A;  2RNY A;  5ENF A;  3IU6 A;  4TT6 A;  4Z1Q A;  5CRZ A;  3U5N A;  4NYV A;  2NXB A;  3O33 A;  2L84 A;  4Q0O A;  4YYI A;  5AMF A;  4QYD A;  4A9L A;  1N72 A;  5EA1 A;  5I83 A;  5FH8 A;  3JVM A;  5F25 A;  5LJ1 A;  2F6J A;  5F3A A;  4NUE A;  4A9J A;  5CTL A;  4GPJ A;  4QEW A;  5EWV A;  4MR6 A;  5A5N A;  4YH4 A;  5LKT A;  4CUP A;  4O76 A;  4LDF A;  4CUU A;  4Z6I A;  1X0J A;  5FE4 A;  4HXL A;  5I7Y A;  4NUD A;  5G4S A;  3QZT A;  4BW1 A;  5A5S A;  4MR4 A;  5FH6 A;  2G4A A;  5CP5 A;  4ZW1 A;  4HBY A;  4UYD A;  5DFC A;  4HXM A;  5L99 A;  3O34 A;  4Z1S A;  3SVG A;  2RS9 B;  3MB4 A;  4TS8 A;  5KTU A;  5D3L A;  5DW2 A;  2DAT A;  5E9V A;  5II2 A;  4IR3 A;  3MXF A;  5E3D A;  5DKC A;  3G0L A;  3P5O A;  5FG6 A;  5HFR A;  4LC2 A;  5FB1 A;  5IGN A;  2LSP B;  4TTE A;  5CUE A;  3P1F A;  5CZG A;  4BJX A;  5FFY A;  5CGP A;  4UIX A;  4HXR A;  4A9M A;  1F68 A;  5FE0 A;  4YBS A;  5A85 A;  4O7A A;  4IR4 A;  4O7C A;  4NXJ A;  3JVL A;  4IR6 A;  3UV2 A;  5IG6 A;  4QBM A;  5HJC A;  4QNS A;  4QR5 A;  2YEM A;  5HLS A;  2OSS A;  3Q2E A;  1EQF A;  5HEM A;  2RO1 A;  5CUD A;  5F5Z A;  5I40 A;  3SVF A;  4UYE A;  4BW4 A;  4LZ2 A;  5C8G A;  4YYK A;  5I89 A;  4N4I A;  5ACY A;  5FB0 A;  4KV1 A;  5HEL A;  4NRB A;  3DAI A;  5DBM A;  3U5J A;  3LJW A;  2R0Y A;  5ENB A;  5D7X A;  4YBT A;  4E96 A;  4YYD A;  4NR8 A;  4QSS A;  4UIY A;  3LQH A;  5D3T A;  4XY8 A;  5EPS A;  4Z6H A;  2DKW A;  3QZS A;  4N3W A;  3MUL A;  2I8N A;  5EWW A;  5EGU A;  4HXN A;  3O35 A;  5A82 A;  5EVA A;  5AD2 A;  5K29 A;  5DYA A;  4AKN A;  4A9H A;  3UV4 A;  4QY4 A;  4YYM A;  5TCM A;  4HBX A;  2YYN A;  5JI8 A;  5C89 A;  4O7B A;  5E9K A;  4QSW A;  5F36 A;  5CQ4 A;  4LR6 A;  4TQN A;  5ETD A;  4CFK A;  5DKH A;  5CQ6 A;  1ZS5 A;  4YAB A;  2YQD A;  3JVJ A;  4OUF A;  4YK0 A;  4YC9 A;  4MEQ A;  5JWM A;  4HXO A;  5CQT A;  1E6I A;  5DYC A;  4CFL A;  3JVK A;  4YAT A;  4J0S A;  5LVQ A;  5E73 A;  4A9O A;  5FH7 A;  5FE7 A;  3IU5 A;  5FBX A;  3U5L A;  4LZS A;  3P1D A;  4QSU A;  4QR3 A;  2MJV B;  4NR7 A;  4NYX A;  5G4R A;  4KCX A;  4ZC9 A;  5COI A;  5HEN A;  5L8T A; 
#chains in the Genus database with same CATH topology
 5D3S A;  4UYH A;  5EK9 A;  4A9I A;  5D25 A;  5DFB A;  5EV9 A;  3LQJ A;  5ENE A;  5FE6 A;  4O75 A;  5LKZ A;  4IOQ A;  5LJ0 A;  4MEP A;  5F1L A;  5A5Q A;  1JSP B;  4QC3 A;  3P1C A;  2D9E A;  4LYS A;  5F63 A;  5DY7 A;  5C85 A;  4YBM A;  4CUS A;  5H1T A;  4YH3 A;  5HM0 A;  4QR4 A;  5F60 A;  2YDW A;  3LQI A;  5DW1 A;  3U5O A;  4YYN A;  5HCL A;  3MB3 A;  5L98 A;  5D3P A;  4C66 A;  4A9N A;  5AD3 A;  4O7F A;  3UV5 A;  4QST A;  5LJ2 A;  5KU3 A;  2DVV A;  4NS5 A;  4UIT A;  3ONI A;  5FE3 A;  5A83 A;  5DKD A;  4CLB A;  4XUB A;  5I88 A;  5CQ7 A;  5D0C A;  4HXS A;  4TT4 A;  4WIV A;  5CY9 A;  5D24 A;  4PY6 A;  5CQ8 A;  5CU8 A;  5L97 A;  4BW2 A;  4QSV A;  5FDZ A;  1PUO A;  3UVW A;  4YAD A;  4HBW A;  5EQ1 A;  5E7D A;  5E3G A;  5D26 A;  5FG4 A;  5H1U A;  2YEL A;  4MR5 A;  4UYG A;  4QEV A;  4UYF B;  4BHW A;  4LRG A;  5EWC A;  4NRC A;  5C4Q A;  2WP2 A;  5LUU A;  5IGL A;  3S92 A;  4OGI A;  5I29 A;  4O70 A;  3FKM X;  3NXB A;  4NQM A;  4PCI A;  5D3N A;  5E9L A;  5E9M A;  5FFV A;  5ENJ A;  4C67 A;  5CPE A;  4UIV A;  3RCW A;  5CQ5 A;  4Y03 A;  4QZS A;  4CL9 A;  2DVS A;  4RVR A;  4X2I A;  4IOR A;  2OUO A;  5BT3 A;  5F62 A;  4PTB A;  4XYA A;  4TZ2 A;  4QSR A;  5KHM A;  5ENG A;  5CRM A;  5I1Q A;  5EIC A;  4O7E A;  5LKU A;  5AME A;  4NUC A;  5F61 A;  4Q0N A;  4XUA A;  5A5R A;  4ZQL A;  4LZR A;  5CUA A;  4Z93 A;  3SVH A;  4NR4 A;  1WUM A;  4N4F A;  1WUG A;  4O71 A;  2YW5 A;  5IGM A;  2GRC A;  5HFQ A;  4CUR A;  4HBV A;  4DON A;  2KTB B;  5H1V A;  4TYL A;  2R0S A;  2D82 A;  3UVD A;  3UW9 A;  5DX4 A;  5CUC A;  4NR9 A;  3K2J A;  4NYW A;  4F3I A;  5A81 A;  5KO4 A;  4MEO A;  5D3J A;  5FE5 A;  3U5P A;  5EWD A;  3TLP A;  2H60 A;  3O36 A;  5FG5 A;  4J1P A;  5L8U A;  3LXJ A;  5FE2 A;  5EI4 A;  5HRV A;  4PCE A;  4CUQ A;  5ENC A;  5E9I A;  4HXP A;  5II1 A;  4YYG A;  4J0R A;  4CUT A;  4UIZ A;  4QUT A;  5C7N A;  4MEN A;  5L96 A;  4AKH A;  4QC1 A;  3DWY A;  1JM4 B;  4YYH A;  3GG3 A;  5HRW A;  4QEU A;  4QB3 A;  3QZV A;  5KTX A;  2DVR A;  4A9F A;  5ENI A;  2RNX A;  5ETB A;  5I86 A;  4A9E A;  5ENH A;  5DYX A;  4ALG A;  4YY4 A;  3HMF A;  5EPB A;  5E0R A;  5KTW A;  3U5K A;  4ALH A;  5IID A;  5TB6 A;  4PKL A;  4WHW A;  4UIU A;  4BW3 A;  2DWW A;  3S91 A;  3ZYU A;  4YYJ A;  3I3J A;  4LYW A;  5BT5 A;  5HQ6 A;  5BT4 A;  3Q2F A;  4OGJ A;  4PS5 A;  5EWH A;  5HRX A;  4O74 A;  5C87 A;  4WHU A;  5HQ7 A;  4QSX A;  2L85 A;  2E7O A;  4N4H A;  3AQA A;  3MUK A;  2DVQ A;  5EM3 A;  4IOO A;  3UVX A;  3AAD A;  5FE1 A;  5DYU A;  4NQN A;  3D1B A;  5FFW A;  4FLP A;  4QYL A;  5D3H A;  4NR6 A;  3UVY A;  5EP7 A;  3D1D A;  4TU4 A;  4YAX A;  5IBN A;  5EIS A;  5I7X A;  5EU1 A;  2RFJ A;  4O72 A;  5E9Y A;  2L5E A;  5FE9 A;  4NRA A;  4UIW A;  2YEK A;  5A5P A;  2I7K A;  2FSA A;  3MQM A;  4MR3 A;  4QSQ A;  5A5O A;  5J0D A;  2F6N A;  3P1E A;  5CUB A;  5LVR A;  5EPR A;  2RNW A;  4J3I A;  4TT2 A;  4O78 A;  4TU6 A;  5CQA A;  4LYI A;  5CUG A;  5H85 A;  4QSP A;  5D3R A;  4N4G A;  3HME A;  4HXK A;  4TZ8 A;  3U5M A;  2RI7 A;  4XY9 A;  2WP1 A;  5DLZ A;  4UYF A;  2E7N A;  4QUU A;  5E74 A;  2E3K A;  5CQ3 A;  5I80 A;  5CFW A;  5CS8 A;  3VKH A;  5F1H A;  5A7C A;  3ERR A;  4IR5 A;  2N9G A;  3D7C A;  2R10 A;  3O37 A;  5DLX A;  3G0J A;  5LKX A;  4YY6 A;  5F2P A;  5HQ5 A;  4A9K A;  5DFD A;  4KV4 A;  5IGK A;  2OO1 A;  2R0V A;  5FE8 A;  4NR5 A;  4O77 A;  3HMH A;  2RNY A;  5ENF A;  3IU6 A;  4TT6 A;  4Z1Q A;  5CRZ A;  3U5N A;  4NYV A;  2NXB A;  3O33 A;  2L84 A;  4Q0O A;  4YYI A;  5AMF A;  4QYD A;  4A9L A;  1N72 A;  5EA1 A;  5I83 A;  5FH8 A;  3JVM A;  5F25 A;  5LJ1 A;  2F6J A;  5F3A A;  4NUE A;  4A9J A;  5CTL A;  4GPJ A;  4QEW A;  5EWV A;  4MR6 A;  5A5N A;  4YH4 A;  5LKT A;  4CUP A;  4O76 A;  4LDF A;  4CUU A;  4Z6I A;  1X0J A;  5FE4 A;  4HXL A;  5I7Y A;  4NUD A;  5G4S A;  3QZT A;  4BW1 A;  5A5S A;  4MR4 A;  5FH6 A;  2G4A A;  5CP5 A;  4ZW1 A;  4HBY A;  4UYD A;  5DFC A;  4HXM A;  5L99 A;  3O34 A;  4Z1S A;  3SVG A;  2RS9 B;  3MB4 A;  4TS8 A;  5KTU A;  5D3L A;  5DW2 A;  2DAT A;  5E9V A;  5II2 A;  4IR3 A;  3MXF A;  5E3D A;  5DKC A;  3G0L A;  3P5O A;  5FG6 A;  5HFR A;  4LC2 A;  5FB1 A;  5IGN A;  2LSP B;  4TTE A;  5CUE A;  3P1F A;  5CZG A;  4BJX A;  5FFY A;  5CGP A;  4UIX A;  4HXR A;  4A9M A;  1F68 A;  5FE0 A;  4YBS A;  5A85 A;  4O7A A;  4IR4 A;  4O7C A;  4NXJ A;  3JVL A;  4IR6 A;  3UV2 A;  4AKI A;  5IG6 A;  4QBM A;  5HJC A;  4QNS A;  4QR5 A;  2YEM A;  5HLS A;  2OSS A;  3Q2E A;  1EQF A;  5HEM A;  2RO1 A;  5CUD A;  5F5Z A;  5I40 A;  3SVF A;  4UYE A;  4BW4 A;  4LZ2 A;  5C8G A;  4YYK A;  5I89 A;  4N4I A;  5ACY A;  5FB0 A;  4KV1 A;  5HEL A;  4NRB A;  3DAI A;  5DBM A;  3U5J A;  4AI6 A;  3LJW A;  2R0Y A;  5ENB A;  5D7X A;  4YBT A;  4E96 A;  4YYD A;  4NR8 A;  4QSS A;  4UIY A;  3LQH A;  5D3T A;  4XY8 A;  5EPS A;  4Z6H A;  2DKW A;  3QZS A;  4N3W A;  3MUL A;  2I8N A;  5EWW A;  4AKG A;  5EGU A;  4HXN A;  3O35 A;  5A82 A;  5EVA A;  5AD2 A;  2EJN A;  5K29 A;  5DYA A;  4AKN A;  4A9H A;  3UV4 A;  4QY4 A;  4YYM A;  5TCM A;  4HBX A;  2YYN A;  5JI8 A;  5C89 A;  3VKG A;  4O7B A;  5E9K A;  4QSW A;  5F36 A;  5CQ4 A;  4LR6 A;  4TQN A;  5ETD A;  4CFK A;  5DKH A;  5CQ6 A;  1ZS5 A;  4YAB A;  2YQD A;  3JVJ A;  4OUF A;  4YK0 A;  4YC9 A;  4MEQ A;  5JWM A;  4HXO A;  5CQT A;  1E6I A;  5DYC A;  4CFL A;  3JVK A;  4YAT A;  4J0S A;  5LVQ A;  5E73 A;  4A9O A;  5FH7 A;  5FE7 A;  3IU5 A;  5FBX A;  3U5L A;  4LZS A;  3P1D A;  4QSU A;  4QR3 A;  2MJV B;  4NR7 A;  1ZKR A;  4NYX A;  5G4R A;  4KCX A;  4ZC9 A;  5COI A;  5HEN A;  5L8T A; 
#chains in the Genus database with same CATH homology
 5D3S A;  4UYH A;  5EK9 A;  4A9I A;  5D25 A;  5DFB A;  5EV9 A;  3LQJ A;  5ENE A;  5FE6 A;  4O75 A;  5LKZ A;  4IOQ A;  5LJ0 A;  4MEP A;  5F1L A;  5A5Q A;  1JSP B;  4QC3 A;  3P1C A;  2D9E A;  4LYS A;  5F63 A;  5DY7 A;  5C85 A;  4YBM A;  4CUS A;  5H1T A;  4YH3 A;  5HM0 A;  4QR4 A;  5F60 A;  2YDW A;  3LQI A;  5DW1 A;  3U5O A;  4YYN A;  5HCL A;  3MB3 A;  5L98 A;  5D3P A;  4C66 A;  4A9N A;  5AD3 A;  4O7F A;  3UV5 A;  4QST A;  5LJ2 A;  5KU3 A;  2DVV A;  4NS5 A;  4UIT A;  3ONI A;  5FE3 A;  5A83 A;  5DKD A;  4CLB A;  4XUB A;  5I88 A;  5CQ7 A;  5D0C A;  4HXS A;  4TT4 A;  4WIV A;  5CY9 A;  5D24 A;  4PY6 A;  5CQ8 A;  5CU8 A;  5L97 A;  4BW2 A;  4QSV A;  5FDZ A;  3UVW A;  4YAD A;  4HBW A;  5EQ1 A;  5E7D A;  5E3G A;  5D26 A;  5FG4 A;  5H1U A;  2YEL A;  4MR5 A;  4UYG A;  4QEV A;  4UYF B;  4BHW A;  4LRG A;  5EWC A;  4NRC A;  5C4Q A;  2WP2 A;  5LUU A;  5IGL A;  3S92 A;  4OGI A;  5I29 A;  4O70 A;  3FKM X;  3NXB A;  4NQM A;  4PCI A;  5D3N A;  5E9L A;  5E9M A;  5FFV A;  5ENJ A;  4C67 A;  5CPE A;  4UIV A;  3RCW A;  5CQ5 A;  4Y03 A;  4QZS A;  4CL9 A;  2DVS A;  4RVR A;  4X2I A;  4IOR A;  2OUO A;  5BT3 A;  5F62 A;  4PTB A;  4XYA A;  4TZ2 A;  4QSR A;  5KHM A;  5ENG A;  5CRM A;  5I1Q A;  5EIC A;  4O7E A;  5LKU A;  5AME A;  4NUC A;  5F61 A;  4Q0N A;  4XUA A;  5A5R A;  4ZQL A;  4LZR A;  5CUA A;  4Z93 A;  3SVH A;  4NR4 A;  1WUM A;  4N4F A;  1WUG A;  4O71 A;  2YW5 A;  5IGM A;  2GRC A;  5HFQ A;  4CUR A;  4HBV A;  4DON A;  2KTB B;  5H1V A;  4TYL A;  2R0S A;  2D82 A;  3UVD A;  3UW9 A;  5DX4 A;  5CUC A;  4NR9 A;  3K2J A;  4NYW A;  4F3I A;  5A81 A;  5KO4 A;  4MEO A;  5D3J A;  5FE5 A;  3U5P A;  5EWD A;  3TLP A;  2H60 A;  3O36 A;  5FG5 A;  4J1P A;  5L8U A;  3LXJ A;  5FE2 A;  5EI4 A;  5HRV A;  4PCE A;  4CUQ A;  5ENC A;  5E9I A;  4HXP A;  5II1 A;  4YYG A;  4J0R A;  4CUT A;  4UIZ A;  4QUT A;  5C7N A;  4MEN A;  5L96 A;  4QC1 A;  3DWY A;  1JM4 B;  4YYH A;  3GG3 A;  5HRW A;  4QEU A;  4QB3 A;  3QZV A;  5KTX A;  2DVR A;  4A9F A;  5ENI A;  2RNX A;  5ETB A;  5I86 A;  4A9E A;  5ENH A;  5DYX A;  4ALG A;  4YY4 A;  3HMF A;  5EPB A;  5E0R A;  5KTW A;  3U5K A;  4ALH A;  5IID A;  5TB6 A;  4PKL A;  4WHW A;  4UIU A;  4BW3 A;  2DWW A;  3S91 A;  3ZYU A;  4YYJ A;  3I3J A;  4LYW A;  5BT5 A;  5HQ6 A;  5BT4 A;  3Q2F A;  4OGJ A;  4PS5 A;  5EWH A;  5HRX A;  4O74 A;  5C87 A;  4WHU A;  5HQ7 A;  4QSX A;  2L85 A;  2E7O A;  4N4H A;  3AQA A;  3MUK A;  2DVQ A;  5EM3 A;  4IOO A;  3UVX A;  3AAD A;  5FE1 A;  5DYU A;  4NQN A;  5FFW A;  4FLP A;  4QYL A;  5D3H A;  4NR6 A;  3UVY A;  5EP7 A;  4TU4 A;  4YAX A;  5IBN A;  5EIS A;  5I7X A;  5EU1 A;  2RFJ A;  4O72 A;  5E9Y A;  2L5E A;  5FE9 A;  4NRA A;  4UIW A;  2YEK A;  5A5P A;  2I7K A;  2FSA A;  3MQM A;  4MR3 A;  4QSQ A;  5A5O A;  5J0D A;  2F6N A;  3P1E A;  5CUB A;  5LVR A;  5EPR A;  2RNW A;  4J3I A;  4TT2 A;  4O78 A;  4TU6 A;  5CQA A;  4LYI A;  5CUG A;  5H85 A;  4QSP A;  5D3R A;  4N4G A;  3HME A;  4HXK A;  4TZ8 A;  3U5M A;  2RI7 A;  4XY9 A;  2WP1 A;  5DLZ A;  4UYF A;  2E7N A;  4QUU A;  5E74 A;  2E3K A;  5CQ3 A;  5I80 A;  5CFW A;  5CS8 A;  5F1H A;  5A7C A;  4IR5 A;  2N9G A;  3D7C A;  2R10 A;  3O37 A;  5DLX A;  3G0J A;  5LKX A;  4YY6 A;  5F2P A;  5HQ5 A;  4A9K A;  5DFD A;  4KV4 A;  5IGK A;  2OO1 A;  2R0V A;  5FE8 A;  4NR5 A;  4O77 A;  3HMH A;  2RNY A;  5ENF A;  3IU6 A;  4TT6 A;  4Z1Q A;  5CRZ A;  3U5N A;  4NYV A;  2NXB A;  3O33 A;  2L84 A;  4Q0O A;  4YYI A;  5AMF A;  4QYD A;  4A9L A;  1N72 A;  5EA1 A;  5I83 A;  5FH8 A;  3JVM A;  5F25 A;  5LJ1 A;  2F6J A;  5F3A A;  4NUE A;  4A9J A;  5CTL A;  4GPJ A;  4QEW A;  5EWV A;  4MR6 A;  5A5N A;  4YH4 A;  5LKT A;  4CUP A;  4O76 A;  4LDF A;  4CUU A;  4Z6I A;  1X0J A;  5FE4 A;  4HXL A;  5I7Y A;  4NUD A;  5G4S A;  3QZT A;  4BW1 A;  5A5S A;  4MR4 A;  5FH6 A;  2G4A A;  5CP5 A;  4ZW1 A;  4HBY A;  4UYD A;  5DFC A;  4HXM A;  5L99 A;  3O34 A;  4Z1S A;  3SVG A;  2RS9 B;  3MB4 A;  4TS8 A;  5KTU A;  5D3L A;  5DW2 A;  2DAT A;  5E9V A;  5II2 A;  4IR3 A;  3MXF A;  5E3D A;  5DKC A;  3G0L A;  3P5O A;  5FG6 A;  5HFR A;  4LC2 A;  5FB1 A;  5IGN A;  2LSP B;  4TTE A;  5CUE A;  3P1F A;  5CZG A;  4BJX A;  5FFY A;  5CGP A;  4UIX A;  4HXR A;  4A9M A;  1F68 A;  5FE0 A;  4YBS A;  5A85 A;  4O7A A;  4IR4 A;  4O7C A;  4NXJ A;  3JVL A;  4IR6 A;  3UV2 A;  5IG6 A;  4QBM A;  5HJC A;  4QNS A;  4QR5 A;  2YEM A;  5HLS A;  2OSS A;  3Q2E A;  1EQF A;  5HEM A;  2RO1 A;  5CUD A;  5F5Z A;  5I40 A;  3SVF A;  4UYE A;  4BW4 A;  4LZ2 A;  5C8G A;  4YYK A;  5I89 A;  4N4I A;  5ACY A;  5FB0 A;  4KV1 A;  5HEL A;  4NRB A;  3DAI A;  5DBM A;  3U5J A;  3LJW A;  2R0Y A;  5ENB A;  5D7X A;  4YBT A;  4E96 A;  4YYD A;  4NR8 A;  4QSS A;  4UIY A;  3LQH A;  5D3T A;  4XY8 A;  5EPS A;  4Z6H A;  2DKW A;  3QZS A;  4N3W A;  3MUL A;  2I8N A;  5EWW A;  5EGU A;  4HXN A;  3O35 A;  5A82 A;  5EVA A;  5AD2 A;  5K29 A;  5DYA A;  4AKN A;  4A9H A;  3UV4 A;  4QY4 A;  4YYM A;  5TCM A;  4HBX A;  2YYN A;  5JI8 A;  5C89 A;  4O7B A;  5E9K A;  4QSW A;  5F36 A;  5CQ4 A;  4LR6 A;  4TQN A;  5ETD A;  4CFK A;  5DKH A;  5CQ6 A;  1ZS5 A;  4YAB A;  2YQD A;  3JVJ A;  4OUF A;  4YK0 A;  4YC9 A;  4MEQ A;  5JWM A;  4HXO A;  5CQT A;  1E6I A;  5DYC A;  4CFL A;  3JVK A;  4YAT A;  4J0S A;  5LVQ A;  5E73 A;  4A9O A;  5FH7 A;  5FE7 A;  3IU5 A;  5FBX A;  3U5L A;  4LZS A;  3P1D A;  4QSU A;  4QR3 A;  2MJV B;  4NR7 A;  4NYX A;  5G4R A;  4KCX A;  4ZC9 A;  5COI A;  5HEN A;  5L8T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...