5F25A

Crystal structure of the brd9 bromodomain in complex with compound 4.
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
113
structure length
113
Chain Sequence
STPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDFGTMKDKIVANEYKSVTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMSKERLLALKRSMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BRD9
publication title Structure-Based Design of an in Vivo Active Selective BRD9 Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 41
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5f25A00
5CQ5A 2R0VA 3MULA 3P5OA 5F3AA 4LZRA 4TT6A 3JVJA 3U5OA 2I8NA 4OGIA 4WHUA 5EWHA 5LVQA 4ALHA 4J0SA 5H85A 5DFDA 3G0JA 4NR6A 2OSSA 5JWMA 5FB1A 4F3IA 5EV9A 1N72A 5CQ7A 5IGNA 4IORA 4MR6A 4CUQA 4QSQA 2MJVB 4MR3A 5EPBA 2DKWA 3HMEA 5FE0A 4NUEA 5LKTA 3G0LA 5FG5A 4QUTA 4UIVA 2KTBB 4UYFA 4CLBA 4IOQA 5FFWA 5DLXA 4YH4A 4CUUA 5FH6A 4C67A 2E7NA 4RVRA 2DVVA 4QR5A 5CP5A 5I89A 5A5OA 3P1FA 4HXRA 4A9EA 4QEVA 2DVQA 5KHMA 5HQ6A 4YYIA 4XYAA 5EI4A 5FH8A 3ONIA 4PCIA 4CUSA 4Z6HA 4HBYA 5I29A 5EM3A 5E3GA 5C87A 4QSSA 5ENHA 5E9KA 4BJXA 5C7NA 5II2A 4DONA 5EP7A 2I7KA 5ETBA 4O7BA 3U5KA 5COIA 5AD2A 5D3HA 5IGLA 4YYHA 2OUOA 4NUCA 5KO4A 5I83A 5F5ZA 5HELA 4Q0NA 5A81A 4XY9A 5DKHA 5LKXA 5F25A 5CQ4A 5ENGA 4YH3A 4QB3A 4QSWA 4WIVA 5DW1A 4NR5A 2G4AA 3QZTA 4AKNA 3LQHA 4LRGA 5A5NA 4YY6A 4QSUA 5AMFA 5LJ1A 4HXMA 5IIDA 4UYHA 4TZ8A 4E96A 5D3SA 4A9NA 5D7XA 2E3KA 4HBXA 5LUUA 5CUAA 5DKCA 4QY4A 5H1TA 5FH7A 1EQFA 5D3PA 5CRMA 4NRBA 5I40A 5FE1A 1WUGA 4HBWA 5F62A 3Q2FA 4YATA 5CUDA 5E0RA 5DKDA 5D3NA 5IBNA 5A5RA 4QYLA 5CRZA 4CFKA 2YQDA 5A5SA 3LXJA 5DY7A 3UV5A 4C66A 5CUBA 5L96A 5HJCA 5FE6A 4X2IA 5I7YA 4YYMA 2N9GA 2NXBA 4BW3A 5KTXA 4O7EA 4UITA 1E6IA 4CURA 4QSTA 5HQ7A 4NR7A 4MEPA 5FE7A 4MR5A 4MR4A 5L99A 5CQ8A 4LYSA 4KCXA 5EK9A 5EVAA 5D26A 4NUDA 5DLZA 5HENA 3LQJA 4QC1A 5CQ6A 5L97A 4FLPA 3S91A 5EISA 5IGKA 4HXNA 4QZSA 2D82A 3MQMA 4LDFA 3UVWA 5HFQA 5E9VA 5E7DA 4HXOA 5CUCA 4QNSA 4O71A 2YEKA 1WUMA 3ZYUA 5D3TA 5HCLA 4PCEA 2YEMA 4ZQLA 5C89A 5LJ0A 5FE8A 3RCWA 5LJ2A 5EWWA 1JSPB 5F36A 4YADA 4NR4A 4LYIA 5CTLA 2RNXA 5C85A 2RO1A 3O37A 4CL9A 5DFBA 4TYLA 5DYXA 5EWCA 4OUFA 3DWYA 4YBTA 3MB3A 2R0SA 3MXFA 4N4HA 1F68A 3S92A 4Q0OA 4MEQA 5KTWA 2R0YA 4BHWA 4IR4A 4YYNA 4A9LA 3U5NA 5EWDA 2D9EA 5CZGA 5A83A 5D0CA 4O72A 2YDWA 5D24A 5F2PA 5L8TA 3UVXA 5DYUA 5HRWA 5ENEA 5HM0A 5CUGA 5CGPA 5I1QA 5D25A 4NR9A 4CUTA 5FB0A 3JVLA 4IR3A 4UYEA 4N3WA 5EGUA 4A9HA 4O75A 3UW9A 3SVHA 5L8UA 4O7AA 4QR3A 5ETDA 4HBVA 3UV4A 5E9IA 5KU3A 4TT4A 4QSVA 4BW2A 5LKZA 4XUBA 4NYXA 4NR8A 4J3IA 5FFVA 2DWWA 4YC9A 5CS8A 4ZW1A 4A9JA 3GG3A 5E73A 5HQ5A 4GPJA 4YABA 4KV4A 5A5PA 3K2JA 4LR6A 5DBMA 3DAIA 4Z1QA 5CUEA 5D3LA 4YBSA 5FE3A 5HRVA 5DFCA 4QUUA 4BW1A 5CU8A 4A9MA 3MUKA 4PY6A 4UIUA 4IOOA 4O78A 4UYFB 4CFLA 3UV2A 4PKLA 4YYKA 4PS5A 4Y03A 5I88A 5F1HA 5D3JA 2RI7A 4TU4A 4MEOA 3D7CA 2RFJA 4NQNA 5E3DA 3U5JA 5A82A 4UIYA 4HXLA 4PTBA 4UYGA 2WP2A 4NQMA 5FG6A 4J0RA 5CFWA 5KTUA 4KV1A 4BW4A 5F61A 4YK0A 2RNYA 4LYWA 5HRXA 4YY4A 3QZSA 5FBXA 5ENBA 4O77A 3LQIA 4N4GA 3Q2EA 4QSXA 4NRAA 2RNWA 5H1VA 4OGJA 5FDZA 4NYWA 5E9MA 1JM4B 3O36A 5E74A 5ENJA 5A5QA 5EICA 5DYCA 3NXBA 2H60A 4O74A 4QEUA 4LZSA 4UIWA 4YBMA 3HMFA 4NYVA 4O7FA 4J1PA 5HLSA 5FFYA 4TT2A 5CQ3A 3HMHA 3IU6A 3AADA 5EA1A 5IG6A 3SVFA 5CQAA 3I3JA 5HEMA 5IGMA 4HXSA 3P1CA 4IR5A 3AQAA 4WHWA 2YELA 5EQ1A 4QBMA 5BT5A 2GRCA 2OO1A 4N4IA 3UVYA 5BT4A 5EWVA 5DYAA 4ALGA 5EPSA 5I86A 3U5PA 4HXPA 5J0DA 5C4QA 4A9FA 2DATA 4XY8A 5CY9A 4CUPA 3U5LA 5E9YA 5A85A 5C8GA 4YYDA 3IU5A 3U5MA 5AMEA 2LSPB 1ZS5A 2DVRA 2F6JA 4QSRA 4QSPA 2YYNA 5BT3A 4A9IA 2L85A 5F63A 4ZC9A 2DVSA 5CQTA 5I80A 4MENA 5ENCA 2FSAA 4TTEA 4O76A 5G4SA 5FE5A 5ENIA 5G4RA 4IR6A 5F60A 5LVRA 4NXJA 5CPEA 5D3RA 5FE9A 2L84A 5I7XA 5ACYA 5EPRA 1X0JA 2L5EA 2R10A 3O35A 4HXKA 4TS8A 4XUAA 4TZ2A 4O7CA 5L98A 4UIZA 5K29A 3JVKA 4Z93A 3JVMA 3MB4A 5FE4A 3FKMX 5DX4A 3TLPA 4Z1SA 3QZVA 5FE2A 3SVGA 5DW2A 4NRCA 5FG4A 4YYGA 3UVDA 2WP1A 4N4FA 5HFRA 4NS5A 5EU1A 2RS9B 4YAXA 3LJWA 4QR4A 4UYDA 4UIXA 2YW5A 3P1EA 2F6NA 4A9KA 5A7CA 4LC2A 4QC3A 5E9LA 4QEWA 4A9OA 4QYDA 5TB6A 5AD3A 3O33A 4TU6A 4LZ2A 3O34A 5JI8A 4YYJA 5TCMA 5LKUA 5II1A 4O70A 5H1UA 2E7OA 5ENFA 5F1LA 4Z6IA 4TQNA 3P1DA
chains in the Genus database with same CATH superfamily
5CQ5A 2R0VA 3MULA 3P5OA 5F3AA 4LZRA 4TT6A 3JVJA 3U5OA 2I8NA 4AKIA 3VKGA 4OGIA 4WHUA 5EWHA 5LVQA 4ALHA 4J0SA 5H85A 5DFDA 3G0JA 4NR6A 2OSSA 5JWMA 5FB1A 4F3IA 5EV9A 1N72A 5CQ7A 5IGNA 4IORA 4MR6A 4CUQA 4QSQA 2MJVB 4MR3A 5EPBA 2DKWA 3HMEA 5FE0A 4NUEA 5LKTA 3G0LA 5FG5A 4QUTA 4UIVA 2KTBB 4UYFA 4CLBA 4IOQA 5FFWA 5DLXA 4YH4A 4CUUA 5FH6A 4C67A 2E7NA 4RVRA 2DVVA 4QR5A 5CP5A 5I89A 5A5OA 3D1BA 3P1FA 4HXRA 4A9EA 4QEVA 2DVQA 5KHMA 5HQ6A 4YYIA 4XYAA 5EI4A 5FH8A 3ONIA 4PCIA 4CUSA 4Z6HA 4HBYA 5I29A 5EM3A 5E3GA 5C87A 4QSSA 5ENHA 5E9KA 4BJXA 5C7NA 5II2A 4DONA 5EP7A 2I7KA 5ETBA 4O7BA 3U5KA 5COIA 5AD2A 5D3HA 5IGLA 4YYHA 2OUOA 4NUCA 5KO4A 5I83A 5F5ZA 5HELA 4Q0NA 5A81A 4XY9A 5DKHA 5LKXA 5F25A 5CQ4A 5ENGA 4YH3A 4QB3A 4QSWA 4WIVA 5DW1A 4NR5A 2G4AA 3QZTA 4AKNA 3LQHA 4LRGA 5A5NA 4YY6A 4QSUA 5AMFA 5LJ1A 4HXMA 5IIDA 3D1DA 4UYHA 4TZ8A 4E96A 4AKHA 5D3SA 4A9NA 5D7XA 2E3KA 4HBXA 5LUUA 5CUAA 5DKCA 4QY4A 5H1TA 5FH7A 1EQFA 5D3PA 5CRMA 4NRBA 5I40A 5FE1A 1WUGA 4HBWA 5F62A 3Q2FA 4YATA 5CUDA 5E0RA 5DKDA 5D3NA 5IBNA 5A5RA 4QYLA 5CRZA 4CFKA 2YQDA 5A5SA 3LXJA 5DY7A 3UV5A 4C66A 5CUBA 5L96A 5HJCA 5FE6A 4X2IA 5I7YA 4YYMA 1PUOA 2N9GA 2NXBA 4BW3A 5KTXA 4O7EA 4UITA 1E6IA 4CURA 4QSTA 5HQ7A 4NR7A 4MEPA 5FE7A 4MR5A 4MR4A 5L99A 5CQ8A 4LYSA 4KCXA 5EK9A 5EVAA 5D26A 4NUDA 5DLZA 5HENA 3LQJA 4QC1A 5CQ6A 5L97A 4FLPA 3S91A 5EISA 5IGKA 4HXNA 4QZSA 2D82A 3MQMA 4LDFA 3UVWA 5HFQA 5E9VA 5E7DA 4HXOA 5CUCA 4QNSA 4O71A 2YEKA 1WUMA 3ZYUA 5D3TA 5HCLA 4PCEA 2YEMA 4ZQLA 5C89A 5LJ0A 5FE8A 3RCWA 5LJ2A 5EWWA 1JSPB 5F36A 4YADA 4NR4A 4LYIA 5CTLA 2RNXA 5C85A 2RO1A 3O37A 4CL9A 5DFBA 4TYLA 5DYXA 5EWCA 4OUFA 3DWYA 4YBTA 3MB3A 2R0SA 3MXFA 4N4HA 1F68A 3S92A 4Q0OA 4MEQA 5KTWA 2R0YA 4BHWA 4IR4A 4YYNA 4A9LA 3U5NA 5EWDA 2D9EA 5CZGA 5A83A 5D0CA 4O72A 2YDWA 5D24A 5F2PA 5L8TA 3UVXA 5DYUA 5HRWA 5ENEA 5HM0A 5CUGA 5CGPA 5I1QA 5D25A 4NR9A 4CUTA 5FB0A 3JVLA 4IR3A 4UYEA 4N3WA 5EGUA 4A9HA 4O75A 3UW9A 3SVHA 5L8UA 4O7AA 4QR3A 5ETDA 4HBVA 3UV4A 5E9IA 5KU3A 4TT4A 4QSVA 4BW2A 5LKZA 4XUBA 4NYXA 4NR8A 4J3IA 5FFVA 2DWWA 4YC9A 5CS8A 4ZW1A 4A9JA 3GG3A 5E73A 5HQ5A 4GPJA 4YABA 4KV4A 5A5PA 3K2JA 4LR6A 5DBMA 3DAIA 4Z1QA 5CUEA 5D3LA 4YBSA 5FE3A 5HRVA 5DFCA 4QUUA 4BW1A 5CU8A 4A9MA 3MUKA 4PY6A 4UIUA 4IOOA 4O78A 4UYFB 4CFLA 3UV2A 4PKLA 4YYKA 4PS5A 4Y03A 5I88A 5F1HA 5D3JA 2RI7A 4TU4A 4MEOA 3D7CA 2RFJA 4NQNA 5E3DA 3U5JA 2EJNA 5A82A 4UIYA 4HXLA 4PTBA 4UYGA 2WP2A 4NQMA 5FG6A 4J0RA 5CFWA 5KTUA 4KV1A 4BW4A 5F61A 4YK0A 2RNYA 4LYWA 5HRXA 4YY4A 3QZSA 5FBXA 5ENBA 4O77A 3LQIA 4N4GA 3Q2EA 4QSXA 4NRAA 2RNWA 5H1VA 4OGJA 5FDZA 4NYWA 5E9MA 1JM4B 3O36A 5E74A 5ENJA 5A5QA 5EICA 5DYCA 3NXBA 2H60A 4O74A 4QEUA 4LZSA 4UIWA 4YBMA 3HMFA 4NYVA 4O7FA 4J1PA 5HLSA 5FFYA 4TT2A 5CQ3A 3HMHA 3IU6A 3AADA 5EA1A 5IG6A 3SVFA 5CQAA 3I3JA 5HEMA 5IGMA 4HXSA 3P1CA 4IR5A 3AQAA 4WHWA 2YELA 5EQ1A 4QBMA 1ZKRA 5BT5A 2GRCA 2OO1A 4N4IA 3UVYA 5BT4A 5EWVA 5DYAA 4ALGA 5EPSA 5I86A 3U5PA 3ERRA 4HXPA 5J0DA 5C4QA 4A9FA 2DATA 4XY8A 5CY9A 4CUPA 3U5LA 5E9YA 5A85A 5C8GA 4YYDA 3IU5A 3U5MA 5AMEA 2LSPB 1ZS5A 2DVRA 2F6JA 4QSRA 4QSPA 2YYNA 5BT3A 4A9IA 2L85A 5F63A 4ZC9A 2DVSA 5CQTA 5I80A 4AKGA 4MENA 5ENCA 2FSAA 4TTEA 4O76A 5G4SA 5FE5A 5ENIA 5G4RA 4IR6A 5F60A 5LVRA 4NXJA 5CPEA 5D3RA 5FE9A 2L84A 5I7XA 5ACYA 5EPRA 1X0JA 2L5EA 2R10A 3O35A 4HXKA 4TS8A 4XUAA 4TZ2A 4O7CA 5L98A 4UIZA 5K29A 3JVKA 4Z93A 3JVMA 3MB4A 5FE4A 3FKMX 5DX4A 3TLPA 4Z1SA 3QZVA 5FE2A 3SVGA 5DW2A 4NRCA 5FG4A 4YYGA 3UVDA 2WP1A 4N4FA 5HFRA 4NS5A 5EU1A 2RS9B 4YAXA 3LJWA 4QR4A 4UYDA 4UIXA 2YW5A 3P1EA 2F6NA 4A9KA 5A7CA 4LC2A 4QC3A 5E9LA 4QEWA 4A9OA 4QYDA 5TB6A 5AD3A 3VKHA 3O33A 4TU6A 4LZ2A 3O34A 5JI8A 4YYJA 5TCMA 5LKUA 4AI6A 5II1A 4O70A 5H1UA 2E7OA 5ENFA 5F1LA 4Z6IA 4TQNA 3P1DA
chains in the Genus database with same CATH topology
5CQ5A 2R0VA 3MULA 3P5OA 5F3AA 4LZRA 4TT6A 3JVJA 3U5OA 2I8NA 4OGIA 4WHUA 5EWHA 5LVQA 4ALHA 4J0SA 5H85A 5DFDA 3G0JA 4NR6A 2OSSA 5JWMA 5FB1A 4F3IA 5EV9A 1N72A 5CQ7A 5IGNA 4IORA 4MR6A 4CUQA 4QSQA 2MJVB 4MR3A 5EPBA 2DKWA 3HMEA 5FE0A 4NUEA 5LKTA 3G0LA 5FG5A 4QUTA 4UIVA 2KTBB 4UYFA 4CLBA 4IOQA 5FFWA 5DLXA 4YH4A 4CUUA 5FH6A 4C67A 2E7NA 4RVRA 2DVVA 4QR5A 5CP5A 5I89A 5A5OA 3P1FA 4HXRA 4A9EA 4QEVA 2DVQA 5KHMA 5HQ6A 4YYIA 4XYAA 5EI4A 5FH8A 3ONIA 4PCIA 4CUSA 4Z6HA 4HBYA 5I29A 5EM3A 5E3GA 5C87A 4QSSA 5ENHA 5E9KA 4BJXA 5C7NA 5II2A 4DONA 5EP7A 2I7KA 5ETBA 4O7BA 3U5KA 5COIA 5AD2A 5D3HA 5IGLA 4YYHA 2OUOA 4NUCA 5KO4A 5I83A 5F5ZA 5HELA 4Q0NA 5A81A 4XY9A 5DKHA 5LKXA 5F25A 5CQ4A 5ENGA 4YH3A 4QB3A 4QSWA 4WIVA 5DW1A 4NR5A 2G4AA 3QZTA 4AKNA 3LQHA 4LRGA 5A5NA 4YY6A 4QSUA 5AMFA 5LJ1A 4HXMA 5IIDA 4UYHA 4TZ8A 4E96A 5D3SA 4A9NA 5D7XA 2E3KA 4HBXA 5LUUA 5CUAA 5DKCA 4QY4A 5H1TA 5FH7A 1EQFA 5D3PA 5CRMA 4NRBA 5I40A 5FE1A 1WUGA 4HBWA 5F62A 3Q2FA 4YATA 5CUDA 5E0RA 5DKDA 5D3NA 5IBNA 5A5RA 4QYLA 5CRZA 4CFKA 2YQDA 5A5SA 3LXJA 5DY7A 3UV5A 4C66A 5CUBA 5L96A 5HJCA 5FE6A 4X2IA 5I7YA 4YYMA 2N9GA 2NXBA 4BW3A 5KTXA 4O7EA 4UITA 1E6IA 4CURA 4QSTA 5HQ7A 4NR7A 4MEPA 5FE7A 4MR5A 4MR4A 5L99A 5CQ8A 4LYSA 4KCXA 5EK9A 5EVAA 5D26A 4NUDA 5DLZA 5HENA 3LQJA 4QC1A 5CQ6A 5L97A 4FLPA 3S91A 5EISA 5IGKA 4HXNA 4QZSA 2D82A 3MQMA 4LDFA 3UVWA 5HFQA 5E9VA 5E7DA 4HXOA 5CUCA 4QNSA 4O71A 2YEKA 1WUMA 3ZYUA 5D3TA 5HCLA 4PCEA 2YEMA 4ZQLA 5C89A 5LJ0A 5FE8A 3RCWA 5LJ2A 5EWWA 1JSPB 5F36A 4YADA 4NR4A 4LYIA 5CTLA 2RNXA 5C85A 2RO1A 3O37A 4CL9A 5DFBA 4TYLA 5DYXA 5EWCA 4OUFA 3DWYA 4YBTA 3MB3A 2R0SA 3MXFA 4N4HA 1F68A 3S92A 4Q0OA 4MEQA 5KTWA 2R0YA 4BHWA 4IR4A 4YYNA 4A9LA 3U5NA 5EWDA 2D9EA 5CZGA 5A83A 5D0CA 4O72A 2YDWA 5D24A 5F2PA 5L8TA 3UVXA 5DYUA 5HRWA 5ENEA 5HM0A 5CUGA 5CGPA 5I1QA 5D25A 4NR9A 4CUTA 5FB0A 3JVLA 4IR3A 4UYEA 4N3WA 5EGUA 4A9HA 4O75A 3UW9A 3SVHA 5L8UA 4O7AA 4QR3A 5ETDA 4HBVA 3UV4A 5E9IA 5KU3A 4TT4A 4QSVA 4BW2A 5LKZA 4XUBA 4NYXA 4NR8A 4J3IA 5FFVA 2DWWA 4YC9A 5CS8A 4ZW1A 4A9JA 3GG3A 5E73A 5HQ5A 4GPJA 4YABA 4KV4A 5A5PA 3K2JA 4LR6A 5DBMA 3DAIA 4Z1QA 5CUEA 5D3LA 4YBSA 5FE3A 5HRVA 5DFCA 4QUUA 4BW1A 5CU8A 4A9MA 3MUKA 4PY6A 4UIUA 4IOOA 4O78A 4UYFB 4CFLA 3UV2A 4PKLA 4YYKA 4PS5A 4Y03A 5I88A 5F1HA 5D3JA 2RI7A 4TU4A 4MEOA 3D7CA 2RFJA 4NQNA 5E3DA 3U5JA 5A82A 4UIYA 4HXLA 4PTBA 4UYGA 2WP2A 4NQMA 5FG6A 4J0RA 5CFWA 5KTUA 4KV1A 4BW4A 5F61A 4YK0A 2RNYA 4LYWA 5HRXA 4YY4A 3QZSA 5FBXA 5ENBA 4O77A 3LQIA 4N4GA 3Q2EA 4QSXA 4NRAA 2RNWA 5H1VA 4OGJA 5FDZA 4NYWA 5E9MA 1JM4B 3O36A 5E74A 5ENJA 5A5QA 5EICA 5DYCA 3NXBA 2H60A 4O74A 4QEUA 4LZSA 4UIWA 4YBMA 3HMFA 4NYVA 4O7FA 4J1PA 5HLSA 5FFYA 4TT2A 5CQ3A 3HMHA 3IU6A 3AADA 5EA1A 5IG6A 3SVFA 5CQAA 3I3JA 5HEMA 5IGMA 4HXSA 3P1CA 4IR5A 3AQAA 4WHWA 2YELA 5EQ1A 4QBMA 5BT5A 2GRCA 2OO1A 4N4IA 3UVYA 5BT4A 5EWVA 5DYAA 4ALGA 5EPSA 5I86A 3U5PA 4HXPA 5J0DA 5C4QA 4A9FA 2DATA 4XY8A 5CY9A 4CUPA 3U5LA 5E9YA 5A85A 5C8GA 4YYDA 3IU5A 3U5MA 5AMEA 2LSPB 1ZS5A 2DVRA 2F6JA 4QSRA 4QSPA 2YYNA 5BT3A 4A9IA 2L85A 5F63A 4ZC9A 2DVSA 5CQTA 5I80A 4MENA 5ENCA 2FSAA 4TTEA 4O76A 5G4SA 5FE5A 5ENIA 5G4RA 4IR6A 5F60A 5LVRA 4NXJA 5CPEA 5D3RA 5FE9A 2L84A 5I7XA 5ACYA 5EPRA 1X0JA 2L5EA 2R10A 3O35A 4HXKA 4TS8A 4XUAA 4TZ2A 4O7CA 5L98A 4UIZA 5K29A 3JVKA 4Z93A 3JVMA 3MB4A 5FE4A 3FKMX 5DX4A 3TLPA 4Z1SA 3QZVA 5FE2A 3SVGA 5DW2A 4NRCA 5FG4A 4YYGA 3UVDA 2WP1A 4N4FA 5HFRA 4NS5A 5EU1A 2RS9B 4YAXA 3LJWA 4QR4A 4UYDA 4UIXA 2YW5A 3P1EA 2F6NA 4A9KA 5A7CA 4LC2A 4QC3A 5E9LA 4QEWA 4A9OA 4QYDA 5TB6A 5AD3A 3O33A 4TU6A 4LZ2A 3O34A 5JI8A 4YYJA 5TCMA 5LKUA 5II1A 4O70A 5H1UA 2E7OA 5ENFA 5F1LA 4Z6IA 4TQNA 3P1DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CQ5 A;  2R0V A;  3MUL A;  3P5O A;  5F3A A;  4LZR A;  4TT6 A;  3JVJ A;  3U5O A;  2I8N A;  4OGI A;  4WHU A;  5EWH A;  5LVQ A;  4ALH A;  4J0S A;  5H85 A;  5DFD A;  3G0J A;  4NR6 A;  2OSS A;  5JWM A;  5FB1 A;  4F3I A;  5EV9 A;  1N72 A;  5CQ7 A;  5IGN A;  4IOR A;  4MR6 A;  4CUQ A;  4QSQ A;  2MJV B;  4MR3 A;  5EPB A;  2DKW A;  3HME A;  5FE0 A;  4NUE A;  5LKT A;  3G0L A;  5FG5 A;  4QUT A;  4UIV A;  2KTB B;  4UYF A;  4CLB A;  4IOQ A;  5FFW A;  5DLX A;  4YH4 A;  4CUU A;  5FH6 A;  4C67 A;  2E7N A;  4RVR A;  2DVV A;  4QR5 A;  5CP5 A;  5I89 A;  5A5O A;  3P1F A;  4HXR A;  4A9E A;  4QEV A;  2DVQ A;  5KHM A;  5HQ6 A;  4YYI A;  4XYA A;  5EI4 A;  5FH8 A;  3ONI A;  4PCI A;  4CUS A;  4Z6H A;  4HBY A;  5I29 A;  5EM3 A;  5E3G A;  5C87 A;  4QSS A;  5ENH A;  5E9K A;  4BJX A;  5C7N A;  5II2 A;  4DON A;  5EP7 A;  2I7K A;  5ETB A;  4O7B A;  3U5K A;  5COI A;  5AD2 A;  5D3H A;  5IGL A;  4YYH A;  2OUO A;  4NUC A;  5KO4 A;  5I83 A;  5F5Z A;  5HEL A;  4Q0N A;  5A81 A;  4XY9 A;  5DKH A;  5LKX A;  5F25 A;  5CQ4 A;  5ENG A;  4YH3 A;  4QB3 A;  4QSW A;  4WIV A;  5DW1 A;  4NR5 A;  2G4A A;  3QZT A;  4AKN A;  3LQH A;  4LRG A;  5A5N A;  4YY6 A;  4QSU A;  5AMF A;  5LJ1 A;  4HXM A;  5IID A;  4UYH A;  4TZ8 A;  4E96 A;  5D3S A;  4A9N A;  5D7X A;  2E3K A;  4HBX A;  5LUU A;  5CUA A;  5DKC A;  4QY4 A;  5H1T A;  5FH7 A;  1EQF A;  5D3P A;  5CRM A;  4NRB A;  5I40 A;  5FE1 A;  1WUG A;  4HBW A;  5F62 A;  3Q2F A;  4YAT A;  5CUD A;  5E0R A;  5DKD A;  5D3N A;  5IBN A;  5A5R A;  4QYL A;  5CRZ A;  4CFK A;  2YQD A;  5A5S A;  3LXJ A;  5DY7 A;  3UV5 A;  4C66 A;  5CUB A;  5L96 A;  5HJC A;  5FE6 A;  4X2I A;  5I7Y A;  4YYM A;  2N9G A;  2NXB A;  4BW3 A;  5KTX A;  4O7E A;  4UIT A;  1E6I A;  4CUR A;  4QST A;  5HQ7 A;  4NR7 A;  4MEP A;  5FE7 A;  4MR5 A;  4MR4 A;  5L99 A;  5CQ8 A;  4LYS A;  4KCX A;  5EK9 A;  5EVA A;  5D26 A;  4NUD A;  5DLZ A;  5HEN A;  3LQJ A;  4QC1 A;  5CQ6 A;  5L97 A;  4FLP A;  3S91 A;  5EIS A;  5IGK A;  4HXN A;  4QZS A;  2D82 A;  3MQM A;  4LDF A;  3UVW A;  5HFQ A;  5E9V A;  5E7D A;  4HXO A;  5CUC A;  4QNS A;  4O71 A;  2YEK A;  1WUM A;  3ZYU A;  5D3T A;  5HCL A;  4PCE A;  2YEM A;  4ZQL A;  5C89 A;  5LJ0 A;  5FE8 A;  3RCW A;  5LJ2 A;  5EWW A;  1JSP B;  5F36 A;  4YAD A;  4NR4 A;  4LYI A;  5CTL A;  2RNX A;  5C85 A;  2RO1 A;  3O37 A;  4CL9 A;  5DFB A;  4TYL A;  5DYX A;  5EWC A;  4OUF A;  3DWY A;  4YBT A;  3MB3 A;  2R0S A;  3MXF A;  4N4H A;  1F68 A;  3S92 A;  4Q0O A;  4MEQ A;  5KTW A;  2R0Y A;  4BHW A;  4IR4 A;  4YYN A;  4A9L A;  3U5N A;  5EWD A;  2D9E A;  5CZG A;  5A83 A;  5D0C A;  4O72 A;  2YDW A;  5D24 A;  5F2P A;  5L8T A;  3UVX A;  5DYU A;  5HRW A;  5ENE A;  5HM0 A;  5CUG A;  5CGP A;  5I1Q A;  5D25 A;  4NR9 A;  4CUT A;  5FB0 A;  3JVL A;  4IR3 A;  4UYE A;  4N3W A;  5EGU A;  4A9H A;  4O75 A;  3UW9 A;  3SVH A;  5L8U A;  4O7A A;  4QR3 A;  5ETD A;  4HBV A;  3UV4 A;  5E9I A;  5KU3 A;  4TT4 A;  4QSV A;  4BW2 A;  5LKZ A;  4XUB A;  4NYX A;  4NR8 A;  4J3I A;  5FFV A;  2DWW A;  4YC9 A;  5CS8 A;  4ZW1 A;  4A9J A;  3GG3 A;  5E73 A;  5HQ5 A;  4GPJ A;  4YAB A;  4KV4 A;  5A5P A;  3K2J A;  4LR6 A;  5DBM A;  3DAI A;  4Z1Q A;  5CUE A;  5D3L A;  4YBS A;  5FE3 A;  5HRV A;  5DFC A;  4QUU A;  4BW1 A;  5CU8 A;  4A9M A;  3MUK A;  4PY6 A;  4UIU A;  4IOO A;  4O78 A;  4UYF B;  4CFL A;  3UV2 A;  4PKL A;  4YYK A;  4PS5 A;  4Y03 A;  5I88 A;  5F1H A;  5D3J A;  2RI7 A;  4TU4 A;  4MEO A;  3D7C A;  2RFJ A;  4NQN A;  5E3D A;  3U5J A;  5A82 A;  4UIY A;  4HXL A;  4PTB A;  4UYG A;  2WP2 A;  4NQM A;  5FG6 A;  4J0R A;  5CFW A;  5KTU A;  4KV1 A;  4BW4 A;  5F61 A;  4YK0 A;  2RNY A;  4LYW A;  5HRX A;  4YY4 A;  3QZS A;  5FBX A;  5ENB A;  4O77 A;  3LQI A;  4N4G A;  3Q2E A;  4QSX A;  4NRA A;  2RNW A;  5H1V A;  4OGJ A;  5FDZ A;  4NYW A;  5E9M A;  1JM4 B;  3O36 A;  5E74 A;  5ENJ A;  5A5Q A;  5EIC A;  5DYC A;  3NXB A;  2H60 A;  4O74 A;  4QEU A;  4LZS A;  4UIW A;  4YBM A;  3HMF A;  4NYV A;  4O7F A;  4J1P A;  5HLS A;  5FFY A;  4TT2 A;  5CQ3 A;  3HMH A;  3IU6 A;  3AAD A;  5EA1 A;  5IG6 A;  3SVF A;  5CQA A;  3I3J A;  5HEM A;  5IGM A;  4HXS A;  3P1C A;  4IR5 A;  3AQA A;  4WHW A;  2YEL A;  5EQ1 A;  4QBM A;  5BT5 A;  2GRC A;  2OO1 A;  4N4I A;  3UVY A;  5BT4 A;  5EWV A;  5DYA A;  4ALG A;  5EPS A;  5I86 A;  3U5P A;  4HXP A;  5J0D A;  5C4Q A;  4A9F A;  2DAT A;  4XY8 A;  5CY9 A;  4CUP A;  3U5L A;  5E9Y A;  5A85 A;  5C8G A;  4YYD A;  3IU5 A;  3U5M A;  5AME A;  2LSP B;  1ZS5 A;  2DVR A;  2F6J A;  4QSR A;  4QSP A;  2YYN A;  5BT3 A;  4A9I A;  2L85 A;  5F63 A;  4ZC9 A;  2DVS A;  5CQT A;  5I80 A;  4MEN A;  5ENC A;  2FSA A;  4TTE A;  4O76 A;  5G4S A;  5FE5 A;  5ENI A;  5G4R A;  4IR6 A;  5F60 A;  5LVR A;  4NXJ A;  5CPE A;  5D3R A;  5FE9 A;  2L84 A;  5I7X A;  5ACY A;  5EPR A;  1X0J A;  2L5E A;  2R10 A;  3O35 A;  4HXK A;  4TS8 A;  4XUA A;  4TZ2 A;  4O7C A;  5L98 A;  4UIZ A;  5K29 A;  3JVK A;  4Z93 A;  3JVM A;  3MB4 A;  5FE4 A;  3FKM X;  5DX4 A;  3TLP A;  4Z1S A;  3QZV A;  5FE2 A;  3SVG A;  5DW2 A;  4NRC A;  5FG4 A;  4YYG A;  3UVD A;  2WP1 A;  4N4F A;  5HFR A;  4NS5 A;  5EU1 A;  2RS9 B;  4YAX A;  3LJW A;  4QR4 A;  4UYD A;  4UIX A;  2YW5 A;  3P1E A;  2F6N A;  4A9K A;  5A7C A;  4LC2 A;  4QC3 A;  5E9L A;  4QEW A;  4A9O A;  4QYD A;  5TB6 A;  5AD3 A;  3O33 A;  4TU6 A;  4LZ2 A;  3O34 A;  5JI8 A;  4YYJ A;  5TCM A;  5LKU A;  5II1 A;  4O70 A;  5H1U A;  2E7O A;  5ENF A;  5F1L A;  4Z6I A;  4TQN A;  3P1D A; 
#chains in the Genus database with same CATH topology
 5CQ5 A;  2R0V A;  3MUL A;  3P5O A;  5F3A A;  4LZR A;  4TT6 A;  3JVJ A;  3U5O A;  2I8N A;  4AKI A;  3VKG A;  4OGI A;  4WHU A;  5EWH A;  5LVQ A;  4ALH A;  4J0S A;  5H85 A;  5DFD A;  3G0J A;  4NR6 A;  2OSS A;  5JWM A;  5FB1 A;  4F3I A;  5EV9 A;  1N72 A;  5CQ7 A;  5IGN A;  4IOR A;  4MR6 A;  4CUQ A;  4QSQ A;  2MJV B;  4MR3 A;  5EPB A;  2DKW A;  3HME A;  5FE0 A;  4NUE A;  5LKT A;  3G0L A;  5FG5 A;  4QUT A;  4UIV A;  2KTB B;  4UYF A;  4CLB A;  4IOQ A;  5FFW A;  5DLX A;  4YH4 A;  4CUU A;  5FH6 A;  4C67 A;  2E7N A;  4RVR A;  2DVV A;  4QR5 A;  5CP5 A;  5I89 A;  5A5O A;  3D1B A;  3P1F A;  4HXR A;  4A9E A;  4QEV A;  2DVQ A;  5KHM A;  5HQ6 A;  4YYI A;  4XYA A;  5EI4 A;  5FH8 A;  3ONI A;  4PCI A;  4CUS A;  4Z6H A;  4HBY A;  5I29 A;  5EM3 A;  5E3G A;  5C87 A;  4QSS A;  5ENH A;  5E9K A;  4BJX A;  5C7N A;  5II2 A;  4DON A;  5EP7 A;  2I7K A;  5ETB A;  4O7B A;  3U5K A;  5COI A;  5AD2 A;  5D3H A;  5IGL A;  4YYH A;  2OUO A;  4NUC A;  5KO4 A;  5I83 A;  5F5Z A;  5HEL A;  4Q0N A;  5A81 A;  4XY9 A;  5DKH A;  5LKX A;  5F25 A;  5CQ4 A;  5ENG A;  4YH3 A;  4QB3 A;  4QSW A;  4WIV A;  5DW1 A;  4NR5 A;  2G4A A;  3QZT A;  4AKN A;  3LQH A;  4LRG A;  5A5N A;  4YY6 A;  4QSU A;  5AMF A;  5LJ1 A;  4HXM A;  5IID A;  3D1D A;  4UYH A;  4TZ8 A;  4E96 A;  4AKH A;  5D3S A;  4A9N A;  5D7X A;  2E3K A;  4HBX A;  5LUU A;  5CUA A;  5DKC A;  4QY4 A;  5H1T A;  5FH7 A;  1EQF A;  5D3P A;  5CRM A;  4NRB A;  5I40 A;  5FE1 A;  1WUG A;  4HBW A;  5F62 A;  3Q2F A;  4YAT A;  5CUD A;  5E0R A;  5DKD A;  5D3N A;  5IBN A;  5A5R A;  4QYL A;  5CRZ A;  4CFK A;  2YQD A;  5A5S A;  3LXJ A;  5DY7 A;  3UV5 A;  4C66 A;  5CUB A;  5L96 A;  5HJC A;  5FE6 A;  4X2I A;  5I7Y A;  4YYM A;  1PUO A;  2N9G A;  2NXB A;  4BW3 A;  5KTX A;  4O7E A;  4UIT A;  1E6I A;  4CUR A;  4QST A;  5HQ7 A;  4NR7 A;  4MEP A;  5FE7 A;  4MR5 A;  4MR4 A;  5L99 A;  5CQ8 A;  4LYS A;  4KCX A;  5EK9 A;  5EVA A;  5D26 A;  4NUD A;  5DLZ A;  5HEN A;  3LQJ A;  4QC1 A;  5CQ6 A;  5L97 A;  4FLP A;  3S91 A;  5EIS A;  5IGK A;  4HXN A;  4QZS A;  2D82 A;  3MQM A;  4LDF A;  3UVW A;  5HFQ A;  5E9V A;  5E7D A;  4HXO A;  5CUC A;  4QNS A;  4O71 A;  2YEK A;  1WUM A;  3ZYU A;  5D3T A;  5HCL A;  4PCE A;  2YEM A;  4ZQL A;  5C89 A;  5LJ0 A;  5FE8 A;  3RCW A;  5LJ2 A;  5EWW A;  1JSP B;  5F36 A;  4YAD A;  4NR4 A;  4LYI A;  5CTL A;  2RNX A;  5C85 A;  2RO1 A;  3O37 A;  4CL9 A;  5DFB A;  4TYL A;  5DYX A;  5EWC A;  4OUF A;  3DWY A;  4YBT A;  3MB3 A;  2R0S A;  3MXF A;  4N4H A;  1F68 A;  3S92 A;  4Q0O A;  4MEQ A;  5KTW A;  2R0Y A;  4BHW A;  4IR4 A;  4YYN A;  4A9L A;  3U5N A;  5EWD A;  2D9E A;  5CZG A;  5A83 A;  5D0C A;  4O72 A;  2YDW A;  5D24 A;  5F2P A;  5L8T A;  3UVX A;  5DYU A;  5HRW A;  5ENE A;  5HM0 A;  5CUG A;  5CGP A;  5I1Q A;  5D25 A;  4NR9 A;  4CUT A;  5FB0 A;  3JVL A;  4IR3 A;  4UYE A;  4N3W A;  5EGU A;  4A9H A;  4O75 A;  3UW9 A;  3SVH A;  5L8U A;  4O7A A;  4QR3 A;  5ETD A;  4HBV A;  3UV4 A;  5E9I A;  5KU3 A;  4TT4 A;  4QSV A;  4BW2 A;  5LKZ A;  4XUB A;  4NYX A;  4NR8 A;  4J3I A;  5FFV A;  2DWW A;  4YC9 A;  5CS8 A;  4ZW1 A;  4A9J A;  3GG3 A;  5E73 A;  5HQ5 A;  4GPJ A;  4YAB A;  4KV4 A;  5A5P A;  3K2J A;  4LR6 A;  5DBM A;  3DAI A;  4Z1Q A;  5CUE A;  5D3L A;  4YBS A;  5FE3 A;  5HRV A;  5DFC A;  4QUU A;  4BW1 A;  5CU8 A;  4A9M A;  3MUK A;  4PY6 A;  4UIU A;  4IOO A;  4O78 A;  4UYF B;  4CFL A;  3UV2 A;  4PKL A;  4YYK A;  4PS5 A;  4Y03 A;  5I88 A;  5F1H A;  5D3J A;  2RI7 A;  4TU4 A;  4MEO A;  3D7C A;  2RFJ A;  4NQN A;  5E3D A;  3U5J A;  2EJN A;  5A82 A;  4UIY A;  4HXL A;  4PTB A;  4UYG A;  2WP2 A;  4NQM A;  5FG6 A;  4J0R A;  5CFW A;  5KTU A;  4KV1 A;  4BW4 A;  5F61 A;  4YK0 A;  2RNY A;  4LYW A;  5HRX A;  4YY4 A;  3QZS A;  5FBX A;  5ENB A;  4O77 A;  3LQI A;  4N4G A;  3Q2E A;  4QSX A;  4NRA A;  2RNW A;  5H1V A;  4OGJ A;  5FDZ A;  4NYW A;  5E9M A;  1JM4 B;  3O36 A;  5E74 A;  5ENJ A;  5A5Q A;  5EIC A;  5DYC A;  3NXB A;  2H60 A;  4O74 A;  4QEU A;  4LZS A;  4UIW A;  4YBM A;  3HMF A;  4NYV A;  4O7F A;  4J1P A;  5HLS A;  5FFY A;  4TT2 A;  5CQ3 A;  3HMH A;  3IU6 A;  3AAD A;  5EA1 A;  5IG6 A;  3SVF A;  5CQA A;  3I3J A;  5HEM A;  5IGM A;  4HXS A;  3P1C A;  4IR5 A;  3AQA A;  4WHW A;  2YEL A;  5EQ1 A;  4QBM A;  1ZKR A;  5BT5 A;  2GRC A;  2OO1 A;  4N4I A;  3UVY A;  5BT4 A;  5EWV A;  5DYA A;  4ALG A;  5EPS A;  5I86 A;  3U5P A;  3ERR A;  4HXP A;  5J0D A;  5C4Q A;  4A9F A;  2DAT A;  4XY8 A;  5CY9 A;  4CUP A;  3U5L A;  5E9Y A;  5A85 A;  5C8G A;  4YYD A;  3IU5 A;  3U5M A;  5AME A;  2LSP B;  1ZS5 A;  2DVR A;  2F6J A;  4QSR A;  4QSP A;  2YYN A;  5BT3 A;  4A9I A;  2L85 A;  5F63 A;  4ZC9 A;  2DVS A;  5CQT A;  5I80 A;  4AKG A;  4MEN A;  5ENC A;  2FSA A;  4TTE A;  4O76 A;  5G4S A;  5FE5 A;  5ENI A;  5G4R A;  4IR6 A;  5F60 A;  5LVR A;  4NXJ A;  5CPE A;  5D3R A;  5FE9 A;  2L84 A;  5I7X A;  5ACY A;  5EPR A;  1X0J A;  2L5E A;  2R10 A;  3O35 A;  4HXK A;  4TS8 A;  4XUA A;  4TZ2 A;  4O7C A;  5L98 A;  4UIZ A;  5K29 A;  3JVK A;  4Z93 A;  3JVM A;  3MB4 A;  5FE4 A;  3FKM X;  5DX4 A;  3TLP A;  4Z1S A;  3QZV A;  5FE2 A;  3SVG A;  5DW2 A;  4NRC A;  5FG4 A;  4YYG A;  3UVD A;  2WP1 A;  4N4F A;  5HFR A;  4NS5 A;  5EU1 A;  2RS9 B;  4YAX A;  3LJW A;  4QR4 A;  4UYD A;  4UIX A;  2YW5 A;  3P1E A;  2F6N A;  4A9K A;  5A7C A;  4LC2 A;  4QC3 A;  5E9L A;  4QEW A;  4A9O A;  4QYD A;  5TB6 A;  5AD3 A;  3VKH A;  3O33 A;  4TU6 A;  4LZ2 A;  3O34 A;  5JI8 A;  4YYJ A;  5TCM A;  5LKU A;  4AI6 A;  5II1 A;  4O70 A;  5H1U A;  2E7O A;  5ENF A;  5F1L A;  4Z6I A;  4TQN A;  3P1D A; 
#chains in the Genus database with same CATH homology
 5CQ5 A;  2R0V A;  3MUL A;  3P5O A;  5F3A A;  4LZR A;  4TT6 A;  3JVJ A;  3U5O A;  2I8N A;  4OGI A;  4WHU A;  5EWH A;  5LVQ A;  4ALH A;  4J0S A;  5H85 A;  5DFD A;  3G0J A;  4NR6 A;  2OSS A;  5JWM A;  5FB1 A;  4F3I A;  5EV9 A;  1N72 A;  5CQ7 A;  5IGN A;  4IOR A;  4MR6 A;  4CUQ A;  4QSQ A;  2MJV B;  4MR3 A;  5EPB A;  2DKW A;  3HME A;  5FE0 A;  4NUE A;  5LKT A;  3G0L A;  5FG5 A;  4QUT A;  4UIV A;  2KTB B;  4UYF A;  4CLB A;  4IOQ A;  5FFW A;  5DLX A;  4YH4 A;  4CUU A;  5FH6 A;  4C67 A;  2E7N A;  4RVR A;  2DVV A;  4QR5 A;  5CP5 A;  5I89 A;  5A5O A;  3P1F A;  4HXR A;  4A9E A;  4QEV A;  2DVQ A;  5KHM A;  5HQ6 A;  4YYI A;  4XYA A;  5EI4 A;  5FH8 A;  3ONI A;  4PCI A;  4CUS A;  4Z6H A;  4HBY A;  5I29 A;  5EM3 A;  5E3G A;  5C87 A;  4QSS A;  5ENH A;  5E9K A;  4BJX A;  5C7N A;  5II2 A;  4DON A;  5EP7 A;  2I7K A;  5ETB A;  4O7B A;  3U5K A;  5COI A;  5AD2 A;  5D3H A;  5IGL A;  4YYH A;  2OUO A;  4NUC A;  5KO4 A;  5I83 A;  5F5Z A;  5HEL A;  4Q0N A;  5A81 A;  4XY9 A;  5DKH A;  5LKX A;  5F25 A;  5CQ4 A;  5ENG A;  4YH3 A;  4QB3 A;  4QSW A;  4WIV A;  5DW1 A;  4NR5 A;  2G4A A;  3QZT A;  4AKN A;  3LQH A;  4LRG A;  5A5N A;  4YY6 A;  4QSU A;  5AMF A;  5LJ1 A;  4HXM A;  5IID A;  4UYH A;  4TZ8 A;  4E96 A;  5D3S A;  4A9N A;  5D7X A;  2E3K A;  4HBX A;  5LUU A;  5CUA A;  5DKC A;  4QY4 A;  5H1T A;  5FH7 A;  1EQF A;  5D3P A;  5CRM A;  4NRB A;  5I40 A;  5FE1 A;  1WUG A;  4HBW A;  5F62 A;  3Q2F A;  4YAT A;  5CUD A;  5E0R A;  5DKD A;  5D3N A;  5IBN A;  5A5R A;  4QYL A;  5CRZ A;  4CFK A;  2YQD A;  5A5S A;  3LXJ A;  5DY7 A;  3UV5 A;  4C66 A;  5CUB A;  5L96 A;  5HJC A;  5FE6 A;  4X2I A;  5I7Y A;  4YYM A;  2N9G A;  2NXB A;  4BW3 A;  5KTX A;  4O7E A;  4UIT A;  1E6I A;  4CUR A;  4QST A;  5HQ7 A;  4NR7 A;  4MEP A;  5FE7 A;  4MR5 A;  4MR4 A;  5L99 A;  5CQ8 A;  4LYS A;  4KCX A;  5EK9 A;  5EVA A;  5D26 A;  4NUD A;  5DLZ A;  5HEN A;  3LQJ A;  4QC1 A;  5CQ6 A;  5L97 A;  4FLP A;  3S91 A;  5EIS A;  5IGK A;  4HXN A;  4QZS A;  2D82 A;  3MQM A;  4LDF A;  3UVW A;  5HFQ A;  5E9V A;  5E7D A;  4HXO A;  5CUC A;  4QNS A;  4O71 A;  2YEK A;  1WUM A;  3ZYU A;  5D3T A;  5HCL A;  4PCE A;  2YEM A;  4ZQL A;  5C89 A;  5LJ0 A;  5FE8 A;  3RCW A;  5LJ2 A;  5EWW A;  1JSP B;  5F36 A;  4YAD A;  4NR4 A;  4LYI A;  5CTL A;  2RNX A;  5C85 A;  2RO1 A;  3O37 A;  4CL9 A;  5DFB A;  4TYL A;  5DYX A;  5EWC A;  4OUF A;  3DWY A;  4YBT A;  3MB3 A;  2R0S A;  3MXF A;  4N4H A;  1F68 A;  3S92 A;  4Q0O A;  4MEQ A;  5KTW A;  2R0Y A;  4BHW A;  4IR4 A;  4YYN A;  4A9L A;  3U5N A;  5EWD A;  2D9E A;  5CZG A;  5A83 A;  5D0C A;  4O72 A;  2YDW A;  5D24 A;  5F2P A;  5L8T A;  3UVX A;  5DYU A;  5HRW A;  5ENE A;  5HM0 A;  5CUG A;  5CGP A;  5I1Q A;  5D25 A;  4NR9 A;  4CUT A;  5FB0 A;  3JVL A;  4IR3 A;  4UYE A;  4N3W A;  5EGU A;  4A9H A;  4O75 A;  3UW9 A;  3SVH A;  5L8U A;  4O7A A;  4QR3 A;  5ETD A;  4HBV A;  3UV4 A;  5E9I A;  5KU3 A;  4TT4 A;  4QSV A;  4BW2 A;  5LKZ A;  4XUB A;  4NYX A;  4NR8 A;  4J3I A;  5FFV A;  2DWW A;  4YC9 A;  5CS8 A;  4ZW1 A;  4A9J A;  3GG3 A;  5E73 A;  5HQ5 A;  4GPJ A;  4YAB A;  4KV4 A;  5A5P A;  3K2J A;  4LR6 A;  5DBM A;  3DAI A;  4Z1Q A;  5CUE A;  5D3L A;  4YBS A;  5FE3 A;  5HRV A;  5DFC A;  4QUU A;  4BW1 A;  5CU8 A;  4A9M A;  3MUK A;  4PY6 A;  4UIU A;  4IOO A;  4O78 A;  4UYF B;  4CFL A;  3UV2 A;  4PKL A;  4YYK A;  4PS5 A;  4Y03 A;  5I88 A;  5F1H A;  5D3J A;  2RI7 A;  4TU4 A;  4MEO A;  3D7C A;  2RFJ A;  4NQN A;  5E3D A;  3U5J A;  5A82 A;  4UIY A;  4HXL A;  4PTB A;  4UYG A;  2WP2 A;  4NQM A;  5FG6 A;  4J0R A;  5CFW A;  5KTU A;  4KV1 A;  4BW4 A;  5F61 A;  4YK0 A;  2RNY A;  4LYW A;  5HRX A;  4YY4 A;  3QZS A;  5FBX A;  5ENB A;  4O77 A;  3LQI A;  4N4G A;  3Q2E A;  4QSX A;  4NRA A;  2RNW A;  5H1V A;  4OGJ A;  5FDZ A;  4NYW A;  5E9M A;  1JM4 B;  3O36 A;  5E74 A;  5ENJ A;  5A5Q A;  5EIC A;  5DYC A;  3NXB A;  2H60 A;  4O74 A;  4QEU A;  4LZS A;  4UIW A;  4YBM A;  3HMF A;  4NYV A;  4O7F A;  4J1P A;  5HLS A;  5FFY A;  4TT2 A;  5CQ3 A;  3HMH A;  3IU6 A;  3AAD A;  5EA1 A;  5IG6 A;  3SVF A;  5CQA A;  3I3J A;  5HEM A;  5IGM A;  4HXS A;  3P1C A;  4IR5 A;  3AQA A;  4WHW A;  2YEL A;  5EQ1 A;  4QBM A;  5BT5 A;  2GRC A;  2OO1 A;  4N4I A;  3UVY A;  5BT4 A;  5EWV A;  5DYA A;  4ALG A;  5EPS A;  5I86 A;  3U5P A;  4HXP A;  5J0D A;  5C4Q A;  4A9F A;  2DAT A;  4XY8 A;  5CY9 A;  4CUP A;  3U5L A;  5E9Y A;  5A85 A;  5C8G A;  4YYD A;  3IU5 A;  3U5M A;  5AME A;  2LSP B;  1ZS5 A;  2DVR A;  2F6J A;  4QSR A;  4QSP A;  2YYN A;  5BT3 A;  4A9I A;  2L85 A;  5F63 A;  4ZC9 A;  2DVS A;  5CQT A;  5I80 A;  4MEN A;  5ENC A;  2FSA A;  4TTE A;  4O76 A;  5G4S A;  5FE5 A;  5ENI A;  5G4R A;  4IR6 A;  5F60 A;  5LVR A;  4NXJ A;  5CPE A;  5D3R A;  5FE9 A;  2L84 A;  5I7X A;  5ACY A;  5EPR A;  1X0J A;  2L5E A;  2R10 A;  3O35 A;  4HXK A;  4TS8 A;  4XUA A;  4TZ2 A;  4O7C A;  5L98 A;  4UIZ A;  5K29 A;  3JVK A;  4Z93 A;  3JVM A;  3MB4 A;  5FE4 A;  3FKM X;  5DX4 A;  3TLP A;  4Z1S A;  3QZV A;  5FE2 A;  3SVG A;  5DW2 A;  4NRC A;  5FG4 A;  4YYG A;  3UVD A;  2WP1 A;  4N4F A;  5HFR A;  4NS5 A;  5EU1 A;  2RS9 B;  4YAX A;  3LJW A;  4QR4 A;  4UYD A;  4UIX A;  2YW5 A;  3P1E A;  2F6N A;  4A9K A;  5A7C A;  4LC2 A;  4QC3 A;  5E9L A;  4QEW A;  4A9O A;  4QYD A;  5TB6 A;  5AD3 A;  3O33 A;  4TU6 A;  4LZ2 A;  3O34 A;  5JI8 A;  4YYJ A;  5TCM A;  5LKU A;  5II1 A;  4O70 A;  5H1U A;  2E7O A;  5ENF A;  5F1L A;  4Z6I A;  4TQN A;  3P1D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...