5F25A

Crystal structure of the brd9 bromodomain in complex with compound 4.
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
113
structure length
113
Chain Sequence
STPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDFGTMKDKIVANEYKSVTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMSKERLLALKRSMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BRD9
publication title Structure-Based Design of an in Vivo Active Selective BRD9 Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 41
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5f25A00
5F3AA 5G4RA 5E74A 3UV2A 5LJ1A 5I86A 5E7DA 2OO1A 4YYKA 5ENFA 5AD2A 5EVAA 5E0RA 5A5RA 4QSXA 4XUBA 5DYAA 3P1CA 4LYWA 2DVRA 4A9LA 4CUUA 4CFKA 5CQAA 4Z6HA 5FE9A 4O7BA 4ZQLA 2YQDA 4UYGA 5J0DA 5K29A 4YYDA 4NR5A 4QEWA 4TU4A 3SVGA 5TB6A 5D24A 2RNYA 5F63A 4N4FA 5LKTA 3D7CA 4NR9A 5FFWA 5FE5A 4NR7A 5I7XA 4LZ2A 5A5QA 4MR4A 5F5ZA 1F68A 5L99A 5CUGA 5D7XA 3DWYA 4Z1QA 4QSTA 5KTWA 5D3SA 5ENCA 3IU5A 4YABA 4NR4A 5F61A 1N72A 4IOOA 4O75A 5JI8A 3O34A 3UV4A 5KTXA 5HRVA 4O7CA 5BT3A 5JWMA 5A83A 5H1TA 4RVRA 2GRCA 2WP1A 3MB3A 5COIA 2RNXA 5EU1A 4MR5A 4QC3A 5AD3A 4YBSA 4ALGA 3O33A 5FE6A 5LVRA 3U5PA 4XY9A 4UIVA 5HCLA 5ENIA 2YEMA 5CQTA 4NR6A 2RO1A 5CQ5A 2E7OA 5E3DA 5CQ8A 5DKDA 3I3JA 3U5JA 5D3HA 4QEVA 4LDFA 4O7FA 3MQMA 4MEQA 4QYLA 2YYNA 4QYDA 5CUEA 5DFBA 5H1VA 5DYXA 5HQ6A 5LKXA 4HBXA 5DY7A 5KU3A 5CQ7A 5ENHA 3P1DA 4HXNA 3IU6A 5ENBA 5H1UA 4FLPA 5HEMA 5DKCA 5BT5A 2WP2A 5CFWA 4PCEA 4A9IA 4NYXA 5EWVA 4DONA 5A82A 5F1HA 4QSVA 5F1LA 5CGPA 3U5OA 4NRAA 5CP5A 4O76A 2OSSA 4QUUA 4CUSA 5D0CA 2R0YA 5D3RA 3SVHA 4J1PA 5I83A 4A9MA 3QZVA 5FH7A 4HXKA 5IGLA 4KCXA 3Q2EA 5AMEA 5TCMA 4IR4A 5HLSA 4TS8A 5ENJA 5CQ4A 5I7YA 4NS5A 4UYHA 3UW9A 5DYUA 4YY4A 5F2PA 5DYCA 5KTUA 4J0SA 5E9LA 3DAIA 2R0SA 5L97A 3MULA 4O77A 5BT4A 5HQ5A 3P5OA 5HM0A 4MENA 4Z1SA 5EWCA 4BW4A 5EICA 4UYEA 4HBYA 5FFVA 5C87A 2FSAA 5EA1A 3AADA 5FH8A 5DBMA 3S92A 5FG5A 3P1FA 4NYVA 3S91A 3U5NA 4C66A 1ZS5A 4Q0OA 5DLZA 5F25A 2R0VA 4QSQA 4ALHA 4J0RA 4J3IA 5FH6A 4YBMA 5C8GA 1JSPB 4Z93A 4TYLA 4CL9A 4XYAA 5E9IA 5L8TA 5A81A 4PKLA 5I1QA 4CFLA 5FG4A 3LJWA 5E3GA 4MR3A 4QB3A 5D26A 3U5KA 5LKZA 3O36A 5EISA 4O72A 5EWWA 5IG6A 4YYMA 2DWWA 4TQNA 2L84A 5D3TA 2DVSA 5E9KA 3Q2FA 4HXMA 4UIWA 5E73A 4BW3A 4YATA 5C89A 5HELA 4BW2A 4NQNA 3UVDA 4O7AA 4NUDA 5HENA 5EM3A 4YYIA 4NR8A 5EQ1A 2N9GA 4N3WA 5CQ6A 4C67A 5HJCA 2LSPB 4IORA 4CLBA 4E96A 4PTBA 5A5PA 4YK0A 5LKUA 4WIVA 4O7EA 5A85A 5L96A 4QC1A 5C85A 4UYDA 5HFRA 3AQAA 2RI7A 3U5LA 4WHUA 4QR5A 4IR6A 3ONIA 4BJXA 3HMHA 1WUGA 4AKNA 4IR3A 5FE8A 5A7CA 5CZGA 5IBNA 5C7NA 4A9JA 5LJ2A 5CQ3A 5L98A 3O35A 4NYWA 5G4SA 3UV5A 4UIUA 5DFDA 4O71A 5FE4A 2I8NA 4QR4A 5CUAA 4O70A 5LVQA 5DKHA 5CY9A 2YELA 2H60A 4MR6A 4TZ2A 5IGMA 5CRZA 2YEKA 3P1EA 3UVYA 5DW2A 5I40A 4QEUA 5EPRA 4XY8A 5KHMA 4UYFA 5CRMA 5ETBA 4HXPA 5FBXA 5IGKA 5II2A 3QZTA 3NXBA 5HRXA 4YY6A 3MXFA 4QUTA 4LZSA 5FE1A 4YYHA 5E9YA 4HXRA 5FE7A 4ZW1A 5D3PA 5E9VA 5HFQA 5EPBA 4LZRA 5I88A 3JVMA 5D3LA 5EWDA 3TLPA 4NRCA 4PS5A 3MB4A 2F6JA 5ACYA 4NUEA 4TT2A 3ZYUA 5FB0A 4YYNA 5EGUA 5F36A 4CURA 2G4AA 5CUDA 4N4GA 4CUTA 5HRWA 4CUPA 5HQ7A 2YDWA 2DKWA 2YW5A 4HXSA 3UVXA 1EQFA 4ZC9A 3G0LA 4Y03A 5FE0A 4OGJA 5C4QA 3RCWA 2RNWA 3JVLA 4QSWA 2R10A 4N4HA 5L8UA 4UYFB 4TU6A 4A9KA 5ENEA 5ETDA 4GPJA 4QY4A 4UIZA 5LJ0A 3LQHA 2OUOA 4HXOA 4YBTA 4A9HA 4LC2A 4A9NA 2DATA 3FKMX 5FFYA 4YYGA 1X0JA 4LYSA 4YC9A 5DFCA 4HXLA 2DVVA 5DX4A 5A5OA 3LQIA 4YYJA 5IIDA 4BHWA 5D25A 4NUCA 5EI4A 5EWHA 5AMFA 4HBWA 4TT6A 5ENGA 4F3IA 4IOQA 4KV1A 4LR6A 1WUMA 4IR5A 5A5SA 5FE2A 4KV4A 5CUBA 2MJVB 5CS8A 3HMEA 3JVKA 5II1A 4Q0NA 2NXBA 2RFJA 5D3NA 3HMFA 5F60A 3LXJA 5EP7A 4UIXA 5I89A 4YH4A 2DVQA 4LRGA 4QSPA 2E3KA 5DW1A 5FDZA 4QNSA 2E7NA 5DLXA 5H85A 4Z6IA 2L85A 3JVJA 1E6IA 4YH3A 4XUAA 4QSRA 4TZ8A 2D9EA 2RS9B 5KO4A 2D82A 3QZSA 3K2JA 4OGIA 5D3JA 4X2IA 4O74A 4O78A 5EPSA 4QSSA 4UIYA 4BW1A 5CUCA 4HBVA 4YAXA 5LUUA 2F6NA 4WHWA 5EK9A 4LYIA 4PCIA 5EV9A 3U5MA 5I29A 5CPEA 5F62A 4TT4A 3O37A 4N4IA 4MEOA 4TTEA 5FE3A 4QSUA 3UVWA 4A9OA 4A9FA 4QBMA 4YADA 4QZSA 5FB1A 5I80A 4NQMA 4QR3A 2I7KA 4MEPA 5E9MA 2L5EA 3SVFA 4NRBA 5A5NA 5IGNA 1JM4B 4CUQA 4A9EA 4OUFA 4NXJA 3LQJA 3MUKA 3G0JA 4UITA 5CTLA 5CU8A 2KTBB 3GG3A 5FG6A 4PY6A
chains in the Genus database with same CATH superfamily
5F3AA 5G4RA 5E74A 3UV2A 5LJ1A 5I86A 5E7DA 2OO1A 4YYKA 2EJNA 5ENFA 5AD2A 5EVAA 5E0RA 5A5RA 4QSXA 4XUBA 5DYAA 3P1CA 1ZKRA 4LYWA 2DVRA 4A9LA 4CUUA 4CFKA 5CQAA 4Z6HA 5FE9A 4O7BA 4ZQLA 4AKHA 2YQDA 4UYGA 5J0DA 5K29A 4YYDA 4NR5A 4QEWA 4TU4A 3SVGA 5TB6A 5D24A 2RNYA 5F63A 4N4FA 5LKTA 3D7CA 4NR9A 5FFWA 5FE5A 4NR7A 5I7XA 4LZ2A 5A5QA 4MR4A 5F5ZA 1F68A 5L99A 5CUGA 5D7XA 3DWYA 4Z1QA 4QSTA 5KTWA 5D3SA 5ENCA 3IU5A 4YABA 4NR4A 3D1DA 5F61A 1N72A 4IOOA 4O75A 5JI8A 3O34A 3UV4A 5KTXA 5HRVA 4O7CA 5BT3A 5JWMA 5A83A 5H1TA 4RVRA 2GRCA 2WP1A 3MB3A 5COIA 2RNXA 5EU1A 4MR5A 4QC3A 5AD3A 4YBSA 4ALGA 3O33A 5FE6A 5LVRA 3U5PA 4XY9A 4UIVA 5HCLA 5ENIA 2YEMA 5CQTA 4NR6A 2RO1A 5CQ5A 2E7OA 5E3DA 5CQ8A 5DKDA 3I3JA 3U5JA 5D3HA 4QEVA 4LDFA 4O7FA 3MQMA 4MEQA 4QYLA 2YYNA 4QYDA 5CUEA 5DFBA 5H1VA 5DYXA 5HQ6A 5LKXA 4HBXA 5DY7A 5KU3A 5CQ7A 5ENHA 3P1DA 4HXNA 3IU6A 5ENBA 5H1UA 4FLPA 5HEMA 5DKCA 4AI6A 5BT5A 3D1BA 2WP2A 5CFWA 4PCEA 4A9IA 4NYXA 5EWVA 4DONA 5A82A 5F1HA 4QSVA 5F1LA 5CGPA 3U5OA 4NRAA 5CP5A 4O76A 2OSSA 4QUUA 4CUSA 5D0CA 2R0YA 5D3RA 3SVHA 4J1PA 5I83A 4A9MA 3QZVA 5FH7A 4HXKA 5IGLA 4KCXA 3Q2EA 5AMEA 5TCMA 4IR4A 5HLSA 4TS8A 5ENJA 5CQ4A 5I7YA 4NS5A 4UYHA 3UW9A 5DYUA 4YY4A 5F2PA 5DYCA 4AKGA 5KTUA 4J0SA 5E9LA 3DAIA 2R0SA 5L97A 3MULA 4O77A 5BT4A 4AKIA 5HQ5A 3P5OA 5HM0A 4MENA 4Z1SA 5EWCA 4BW4A 5EICA 4UYEA 4HBYA 5FFVA 5C87A 2FSAA 5EA1A 3AADA 3VKGA 5FH8A 5DBMA 3S92A 5FG5A 3P1FA 4NYVA 3S91A 3U5NA 4C66A 1ZS5A 4Q0OA 5DLZA 5F25A 2R0VA 4QSQA 4ALHA 4J0RA 4J3IA 5FH6A 4YBMA 5C8GA 1JSPB 4Z93A 4TYLA 4CL9A 4XYAA 5E9IA 5L8TA 5A81A 4PKLA 5I1QA 4CFLA 3ERRA 5FG4A 3LJWA 5E3GA 4MR3A 4QB3A 5D26A 3U5KA 5LKZA 3O36A 5EISA 4O72A 5EWWA 5IG6A 4YYMA 2DWWA 4TQNA 2L84A 5D3TA 2DVSA 5E9KA 3Q2FA 4HXMA 4UIWA 5E73A 4BW3A 4YATA 5C89A 5HELA 4BW2A 4NQNA 3UVDA 4O7AA 4NUDA 5HENA 5EM3A 4YYIA 4NR8A 5EQ1A 2N9GA 4N3WA 5CQ6A 4C67A 5HJCA 2LSPB 4IORA 4CLBA 4E96A 4PTBA 5A5PA 4YK0A 5LKUA 4WIVA 4O7EA 5A85A 5L96A 4QC1A 5C85A 4UYDA 5HFRA 3AQAA 2RI7A 3U5LA 4WHUA 4QR5A 4IR6A 3ONIA 4BJXA 3HMHA 1WUGA 4AKNA 4IR3A 5FE8A 5A7CA 5CZGA 5IBNA 5C7NA 4A9JA 5LJ2A 5CQ3A 5L98A 3O35A 4NYWA 5G4SA 3UV5A 4UIUA 5DFDA 4O71A 5FE4A 2I8NA 4QR4A 5CUAA 4O70A 5LVQA 5DKHA 5CY9A 2YELA 2H60A 4MR6A 4TZ2A 5IGMA 5CRZA 2YEKA 3P1EA 3UVYA 5DW2A 5I40A 4QEUA 5EPRA 4XY8A 5KHMA 4UYFA 5CRMA 5ETBA 4HXPA 5FBXA 5IGKA 5II2A 3QZTA 3NXBA 5HRXA 4YY6A 3MXFA 4QUTA 4LZSA 5FE1A 4YYHA 5E9YA 4HXRA 5FE7A 4ZW1A 5D3PA 5E9VA 5HFQA 5EPBA 4LZRA 5I88A 3JVMA 5D3LA 5EWDA 3TLPA 3VKHA 4NRCA 4PS5A 3MB4A 2F6JA 5ACYA 4NUEA 4TT2A 3ZYUA 5FB0A 4YYNA 5EGUA 5F36A 4CURA 2G4AA 5CUDA 4N4GA 4CUTA 5HRWA 4CUPA 5HQ7A 2YDWA 2DKWA 2YW5A 4HXSA 3UVXA 1EQFA 4ZC9A 3G0LA 4Y03A 5FE0A 4OGJA 5C4QA 3RCWA 2RNWA 3JVLA 4QSWA 2R10A 4N4HA 5L8UA 4UYFB 4TU6A 4A9KA 5ENEA 5ETDA 4GPJA 4QY4A 4UIZA 5LJ0A 3LQHA 2OUOA 4HXOA 4YBTA 4A9HA 4LC2A 4A9NA 2DATA 3FKMX 5FFYA 4YYGA 1X0JA 4LYSA 4YC9A 5DFCA 4HXLA 2DVVA 5DX4A 5A5OA 3LQIA 4YYJA 5IIDA 4BHWA 5D25A 4NUCA 5EI4A 5EWHA 5AMFA 4HBWA 4TT6A 5ENGA 4F3IA 4IOQA 4KV1A 4LR6A 1WUMA 4IR5A 5A5SA 5FE2A 4KV4A 5CUBA 2MJVB 5CS8A 3HMEA 3JVKA 5II1A 4Q0NA 2NXBA 2RFJA 5D3NA 3HMFA 5F60A 3LXJA 5EP7A 4UIXA 5I89A 4YH4A 2DVQA 4LRGA 4QSPA 2E3KA 5DW1A 1PUOA 5FDZA 4QNSA 2E7NA 5DLXA 5H85A 4Z6IA 2L85A 3JVJA 1E6IA 4YH3A 4XUAA 4QSRA 4TZ8A 2D9EA 2RS9B 5KO4A 2D82A 3QZSA 3K2JA 4OGIA 5D3JA 4X2IA 4O74A 4O78A 5EPSA 4QSSA 4UIYA 4BW1A 5CUCA 4HBVA 4YAXA 5LUUA 2F6NA 4WHWA 5EK9A 4LYIA 4PCIA 5EV9A 3U5MA 5I29A 5CPEA 5F62A 4TT4A 3O37A 4N4IA 4MEOA 4TTEA 5FE3A 4QSUA 3UVWA 4A9OA 4A9FA 4QBMA 4YADA 4QZSA 5FB1A 5I80A 4NQMA 4QR3A 2I7KA 4MEPA 5E9MA 2L5EA 3SVFA 4NRBA 5A5NA 5IGNA 1JM4B 4CUQA 4A9EA 4OUFA 4NXJA 3LQJA 3MUKA 3G0JA 4UITA 5CTLA 5CU8A 2KTBB 3GG3A 5FG6A 4PY6A
chains in the Genus database with same CATH topology
5F3AA 5G4RA 5E74A 3UV2A 5LJ1A 5I86A 5E7DA 2OO1A 4YYKA 5ENFA 5AD2A 5EVAA 5E0RA 5A5RA 4QSXA 4XUBA 5DYAA 3P1CA 4LYWA 2DVRA 4A9LA 4CUUA 4CFKA 5CQAA 4Z6HA 5FE9A 4O7BA 4ZQLA 2YQDA 4UYGA 5J0DA 5K29A 4YYDA 4NR5A 4QEWA 4TU4A 3SVGA 5TB6A 5D24A 2RNYA 5F63A 4N4FA 5LKTA 3D7CA 4NR9A 5FFWA 5FE5A 4NR7A 5I7XA 4LZ2A 5A5QA 4MR4A 5F5ZA 1F68A 5L99A 5CUGA 5D7XA 3DWYA 4Z1QA 4QSTA 5KTWA 5D3SA 5ENCA 3IU5A 4YABA 4NR4A 5F61A 1N72A 4IOOA 4O75A 5JI8A 3O34A 3UV4A 5KTXA 5HRVA 4O7CA 5BT3A 5JWMA 5A83A 5H1TA 4RVRA 2GRCA 2WP1A 3MB3A 5COIA 2RNXA 5EU1A 4MR5A 4QC3A 5AD3A 4YBSA 4ALGA 3O33A 5FE6A 5LVRA 3U5PA 4XY9A 4UIVA 5HCLA 5ENIA 2YEMA 5CQTA 4NR6A 2RO1A 5CQ5A 2E7OA 5E3DA 5CQ8A 5DKDA 3I3JA 3U5JA 5D3HA 4QEVA 4LDFA 4O7FA 3MQMA 4MEQA 4QYLA 2YYNA 4QYDA 5CUEA 5DFBA 5H1VA 5DYXA 5HQ6A 5LKXA 4HBXA 5DY7A 5KU3A 5CQ7A 5ENHA 3P1DA 4HXNA 3IU6A 5ENBA 5H1UA 4FLPA 5HEMA 5DKCA 5BT5A 2WP2A 5CFWA 4PCEA 4A9IA 4NYXA 5EWVA 4DONA 5A82A 5F1HA 4QSVA 5F1LA 5CGPA 3U5OA 4NRAA 5CP5A 4O76A 2OSSA 4QUUA 4CUSA 5D0CA 2R0YA 5D3RA 3SVHA 4J1PA 5I83A 4A9MA 3QZVA 5FH7A 4HXKA 5IGLA 4KCXA 3Q2EA 5AMEA 5TCMA 4IR4A 5HLSA 4TS8A 5ENJA 5CQ4A 5I7YA 4NS5A 4UYHA 3UW9A 5DYUA 4YY4A 5F2PA 5DYCA 5KTUA 4J0SA 5E9LA 3DAIA 2R0SA 5L97A 3MULA 4O77A 5BT4A 5HQ5A 3P5OA 5HM0A 4MENA 4Z1SA 5EWCA 4BW4A 5EICA 4UYEA 4HBYA 5FFVA 5C87A 2FSAA 5EA1A 3AADA 5FH8A 5DBMA 3S92A 5FG5A 3P1FA 4NYVA 3S91A 3U5NA 4C66A 1ZS5A 4Q0OA 5DLZA 5F25A 2R0VA 4QSQA 4ALHA 4J0RA 4J3IA 5FH6A 4YBMA 5C8GA 1JSPB 4Z93A 4TYLA 4CL9A 4XYAA 5E9IA 5L8TA 5A81A 4PKLA 5I1QA 4CFLA 5FG4A 3LJWA 5E3GA 4MR3A 4QB3A 5D26A 3U5KA 5LKZA 3O36A 5EISA 4O72A 5EWWA 5IG6A 4YYMA 2DWWA 4TQNA 2L84A 5D3TA 2DVSA 5E9KA 3Q2FA 4HXMA 4UIWA 5E73A 4BW3A 4YATA 5C89A 5HELA 4BW2A 4NQNA 3UVDA 4O7AA 4NUDA 5HENA 5EM3A 4YYIA 4NR8A 5EQ1A 2N9GA 4N3WA 5CQ6A 4C67A 5HJCA 2LSPB 4IORA 4CLBA 4E96A 4PTBA 5A5PA 4YK0A 5LKUA 4WIVA 4O7EA 5A85A 5L96A 4QC1A 5C85A 4UYDA 5HFRA 3AQAA 2RI7A 3U5LA 4WHUA 4QR5A 4IR6A 3ONIA 4BJXA 3HMHA 1WUGA 4AKNA 4IR3A 5FE8A 5A7CA 5CZGA 5IBNA 5C7NA 4A9JA 5LJ2A 5CQ3A 5L98A 3O35A 4NYWA 5G4SA 3UV5A 4UIUA 5DFDA 4O71A 5FE4A 2I8NA 4QR4A 5CUAA 4O70A 5LVQA 5DKHA 5CY9A 2YELA 2H60A 4MR6A 4TZ2A 5IGMA 5CRZA 2YEKA 3P1EA 3UVYA 5DW2A 5I40A 4QEUA 5EPRA 4XY8A 5KHMA 4UYFA 5CRMA 5ETBA 4HXPA 5FBXA 5IGKA 5II2A 3QZTA 3NXBA 5HRXA 4YY6A 3MXFA 4QUTA 4LZSA 5FE1A 4YYHA 5E9YA 4HXRA 5FE7A 4ZW1A 5D3PA 5E9VA 5HFQA 5EPBA 4LZRA 5I88A 3JVMA 5D3LA 5EWDA 3TLPA 4NRCA 4PS5A 3MB4A 2F6JA 5ACYA 4NUEA 4TT2A 3ZYUA 5FB0A 4YYNA 5EGUA 5F36A 4CURA 2G4AA 5CUDA 4N4GA 4CUTA 5HRWA 4CUPA 5HQ7A 2YDWA 2DKWA 2YW5A 4HXSA 3UVXA 1EQFA 4ZC9A 3G0LA 4Y03A 5FE0A 4OGJA 5C4QA 3RCWA 2RNWA 3JVLA 4QSWA 2R10A 4N4HA 5L8UA 4UYFB 4TU6A 4A9KA 5ENEA 5ETDA 4GPJA 4QY4A 4UIZA 5LJ0A 3LQHA 2OUOA 4HXOA 4YBTA 4A9HA 4LC2A 4A9NA 2DATA 3FKMX 5FFYA 4YYGA 1X0JA 4LYSA 4YC9A 5DFCA 4HXLA 2DVVA 5DX4A 5A5OA 3LQIA 4YYJA 5IIDA 4BHWA 5D25A 4NUCA 5EI4A 5EWHA 5AMFA 4HBWA 4TT6A 5ENGA 4F3IA 4IOQA 4KV1A 4LR6A 1WUMA 4IR5A 5A5SA 5FE2A 4KV4A 5CUBA 2MJVB 5CS8A 3HMEA 3JVKA 5II1A 4Q0NA 2NXBA 2RFJA 5D3NA 3HMFA 5F60A 3LXJA 5EP7A 4UIXA 5I89A 4YH4A 2DVQA 4LRGA 4QSPA 2E3KA 5DW1A 5FDZA 4QNSA 2E7NA 5DLXA 5H85A 4Z6IA 2L85A 3JVJA 1E6IA 4YH3A 4XUAA 4QSRA 4TZ8A 2D9EA 2RS9B 5KO4A 2D82A 3QZSA 3K2JA 4OGIA 5D3JA 4X2IA 4O74A 4O78A 5EPSA 4QSSA 4UIYA 4BW1A 5CUCA 4HBVA 4YAXA 5LUUA 2F6NA 4WHWA 5EK9A 4LYIA 4PCIA 5EV9A 3U5MA 5I29A 5CPEA 5F62A 4TT4A 3O37A 4N4IA 4MEOA 4TTEA 5FE3A 4QSUA 3UVWA 4A9OA 4A9FA 4QBMA 4YADA 4QZSA 5FB1A 5I80A 4NQMA 4QR3A 2I7KA 4MEPA 5E9MA 2L5EA 3SVFA 4NRBA 5A5NA 5IGNA 1JM4B 4CUQA 4A9EA 4OUFA 4NXJA 3LQJA 3MUKA 3G0JA 4UITA 5CTLA 5CU8A 2KTBB 3GG3A 5FG6A 4PY6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F3A A;  5G4R A;  5E74 A;  3UV2 A;  5LJ1 A;  5I86 A;  5E7D A;  2OO1 A;  4YYK A;  5ENF A;  5AD2 A;  5EVA A;  5E0R A;  5A5R A;  4QSX A;  4XUB A;  5DYA A;  3P1C A;  4LYW A;  2DVR A;  4A9L A;  4CUU A;  4CFK A;  5CQA A;  4Z6H A;  5FE9 A;  4O7B A;  4ZQL A;  2YQD A;  4UYG A;  5J0D A;  5K29 A;  4YYD A;  4NR5 A;  4QEW A;  4TU4 A;  3SVG A;  5TB6 A;  5D24 A;  2RNY A;  5F63 A;  4N4F A;  5LKT A;  3D7C A;  4NR9 A;  5FFW A;  5FE5 A;  4NR7 A;  5I7X A;  4LZ2 A;  5A5Q A;  4MR4 A;  5F5Z A;  1F68 A;  5L99 A;  5CUG A;  5D7X A;  3DWY A;  4Z1Q A;  4QST A;  5KTW A;  5D3S A;  5ENC A;  3IU5 A;  4YAB A;  4NR4 A;  5F61 A;  1N72 A;  4IOO A;  4O75 A;  5JI8 A;  3O34 A;  3UV4 A;  5KTX A;  5HRV A;  4O7C A;  5BT3 A;  5JWM A;  5A83 A;  5H1T A;  4RVR A;  2GRC A;  2WP1 A;  3MB3 A;  5COI A;  2RNX A;  5EU1 A;  4MR5 A;  4QC3 A;  5AD3 A;  4YBS A;  4ALG A;  3O33 A;  5FE6 A;  5LVR A;  3U5P A;  4XY9 A;  4UIV A;  5HCL A;  5ENI A;  2YEM A;  5CQT A;  4NR6 A;  2RO1 A;  5CQ5 A;  2E7O A;  5E3D A;  5CQ8 A;  5DKD A;  3I3J A;  3U5J A;  5D3H A;  4QEV A;  4LDF A;  4O7F A;  3MQM A;  4MEQ A;  4QYL A;  2YYN A;  4QYD A;  5CUE A;  5DFB A;  5H1V A;  5DYX A;  5HQ6 A;  5LKX A;  4HBX A;  5DY7 A;  5KU3 A;  5CQ7 A;  5ENH A;  3P1D A;  4HXN A;  3IU6 A;  5ENB A;  5H1U A;  4FLP A;  5HEM A;  5DKC A;  5BT5 A;  2WP2 A;  5CFW A;  4PCE A;  4A9I A;  4NYX A;  5EWV A;  4DON A;  5A82 A;  5F1H A;  4QSV A;  5F1L A;  5CGP A;  3U5O A;  4NRA A;  5CP5 A;  4O76 A;  2OSS A;  4QUU A;  4CUS A;  5D0C A;  2R0Y A;  5D3R A;  3SVH A;  4J1P A;  5I83 A;  4A9M A;  3QZV A;  5FH7 A;  4HXK A;  5IGL A;  4KCX A;  3Q2E A;  5AME A;  5TCM A;  4IR4 A;  5HLS A;  4TS8 A;  5ENJ A;  5CQ4 A;  5I7Y A;  4NS5 A;  4UYH A;  3UW9 A;  5DYU A;  4YY4 A;  5F2P A;  5DYC A;  5KTU A;  4J0S A;  5E9L A;  3DAI A;  2R0S A;  5L97 A;  3MUL A;  4O77 A;  5BT4 A;  5HQ5 A;  3P5O A;  5HM0 A;  4MEN A;  4Z1S A;  5EWC A;  4BW4 A;  5EIC A;  4UYE A;  4HBY A;  5FFV A;  5C87 A;  2FSA A;  5EA1 A;  3AAD A;  5FH8 A;  5DBM A;  3S92 A;  5FG5 A;  3P1F A;  4NYV A;  3S91 A;  3U5N A;  4C66 A;  1ZS5 A;  4Q0O A;  5DLZ A;  5F25 A;  2R0V A;  4QSQ A;  4ALH A;  4J0R A;  4J3I A;  5FH6 A;  4YBM A;  5C8G A;  1JSP B;  4Z93 A;  4TYL A;  4CL9 A;  4XYA A;  5E9I A;  5L8T A;  5A81 A;  4PKL A;  5I1Q A;  4CFL A;  5FG4 A;  3LJW A;  5E3G A;  4MR3 A;  4QB3 A;  5D26 A;  3U5K A;  5LKZ A;  3O36 A;  5EIS A;  4O72 A;  5EWW A;  5IG6 A;  4YYM A;  2DWW A;  4TQN A;  2L84 A;  5D3T A;  2DVS A;  5E9K A;  3Q2F A;  4HXM A;  4UIW A;  5E73 A;  4BW3 A;  4YAT A;  5C89 A;  5HEL A;  4BW2 A;  4NQN A;  3UVD A;  4O7A A;  4NUD A;  5HEN A;  5EM3 A;  4YYI A;  4NR8 A;  5EQ1 A;  2N9G A;  4N3W A;  5CQ6 A;  4C67 A;  5HJC A;  2LSP B;  4IOR A;  4CLB A;  4E96 A;  4PTB A;  5A5P A;  4YK0 A;  5LKU A;  4WIV A;  4O7E A;  5A85 A;  5L96 A;  4QC1 A;  5C85 A;  4UYD A;  5HFR A;  3AQA A;  2RI7 A;  3U5L A;  4WHU A;  4QR5 A;  4IR6 A;  3ONI A;  4BJX A;  3HMH A;  1WUG A;  4AKN A;  4IR3 A;  5FE8 A;  5A7C A;  5CZG A;  5IBN A;  5C7N A;  4A9J A;  5LJ2 A;  5CQ3 A;  5L98 A;  3O35 A;  4NYW A;  5G4S A;  3UV5 A;  4UIU A;  5DFD A;  4O71 A;  5FE4 A;  2I8N A;  4QR4 A;  5CUA A;  4O70 A;  5LVQ A;  5DKH A;  5CY9 A;  2YEL A;  2H60 A;  4MR6 A;  4TZ2 A;  5IGM A;  5CRZ A;  2YEK A;  3P1E A;  3UVY A;  5DW2 A;  5I40 A;  4QEU A;  5EPR A;  4XY8 A;  5KHM A;  4UYF A;  5CRM A;  5ETB A;  4HXP A;  5FBX A;  5IGK A;  5II2 A;  3QZT A;  3NXB A;  5HRX A;  4YY6 A;  3MXF A;  4QUT A;  4LZS A;  5FE1 A;  4YYH A;  5E9Y A;  4HXR A;  5FE7 A;  4ZW1 A;  5D3P A;  5E9V A;  5HFQ A;  5EPB A;  4LZR A;  5I88 A;  3JVM A;  5D3L A;  5EWD A;  3TLP A;  4NRC A;  4PS5 A;  3MB4 A;  2F6J A;  5ACY A;  4NUE A;  4TT2 A;  3ZYU A;  5FB0 A;  4YYN A;  5EGU A;  5F36 A;  4CUR A;  2G4A A;  5CUD A;  4N4G A;  4CUT A;  5HRW A;  4CUP A;  5HQ7 A;  2YDW A;  2DKW A;  2YW5 A;  4HXS A;  3UVX A;  1EQF A;  4ZC9 A;  3G0L A;  4Y03 A;  5FE0 A;  4OGJ A;  5C4Q A;  3RCW A;  2RNW A;  3JVL A;  4QSW A;  2R10 A;  4N4H A;  5L8U A;  4UYF B;  4TU6 A;  4A9K A;  5ENE A;  5ETD A;  4GPJ A;  4QY4 A;  4UIZ A;  5LJ0 A;  3LQH A;  2OUO A;  4HXO A;  4YBT A;  4A9H A;  4LC2 A;  4A9N A;  2DAT A;  3FKM X;  5FFY A;  4YYG A;  1X0J A;  4LYS A;  4YC9 A;  5DFC A;  4HXL A;  2DVV A;  5DX4 A;  5A5O A;  3LQI A;  4YYJ A;  5IID A;  4BHW A;  5D25 A;  4NUC A;  5EI4 A;  5EWH A;  5AMF A;  4HBW A;  4TT6 A;  5ENG A;  4F3I A;  4IOQ A;  4KV1 A;  4LR6 A;  1WUM A;  4IR5 A;  5A5S A;  5FE2 A;  4KV4 A;  5CUB A;  2MJV B;  5CS8 A;  3HME A;  3JVK A;  5II1 A;  4Q0N A;  2NXB A;  2RFJ A;  5D3N A;  3HMF A;  5F60 A;  3LXJ A;  5EP7 A;  4UIX A;  5I89 A;  4YH4 A;  2DVQ A;  4LRG A;  4QSP A;  2E3K A;  5DW1 A;  5FDZ A;  4QNS A;  2E7N A;  5DLX A;  5H85 A;  4Z6I A;  2L85 A;  3JVJ A;  1E6I A;  4YH3 A;  4XUA A;  4QSR A;  4TZ8 A;  2D9E A;  2RS9 B;  5KO4 A;  2D82 A;  3QZS A;  3K2J A;  4OGI A;  5D3J A;  4X2I A;  4O74 A;  4O78 A;  5EPS A;  4QSS A;  4UIY A;  4BW1 A;  5CUC A;  4HBV A;  4YAX A;  5LUU A;  2F6N A;  4WHW A;  5EK9 A;  4LYI A;  4PCI A;  5EV9 A;  3U5M A;  5I29 A;  5CPE A;  5F62 A;  4TT4 A;  3O37 A;  4N4I A;  4MEO A;  4TTE A;  5FE3 A;  4QSU A;  3UVW A;  4A9O A;  4A9F A;  4QBM A;  4YAD A;  4QZS A;  5FB1 A;  5I80 A;  4NQM A;  4QR3 A;  2I7K A;  4MEP A;  5E9M A;  2L5E A;  3SVF A;  4NRB A;  5A5N A;  5IGN A;  1JM4 B;  4CUQ A;  4A9E A;  4OUF A;  4NXJ A;  3LQJ A;  3MUK A;  3G0J A;  4UIT A;  5CTL A;  5CU8 A;  2KTB B;  3GG3 A;  5FG6 A;  4PY6 A; 
#chains in the Genus database with same CATH topology
 5F3A A;  5G4R A;  5E74 A;  3UV2 A;  5LJ1 A;  5I86 A;  5E7D A;  2OO1 A;  4YYK A;  2EJN A;  5ENF A;  5AD2 A;  5EVA A;  5E0R A;  5A5R A;  4QSX A;  4XUB A;  5DYA A;  3P1C A;  1ZKR A;  4LYW A;  2DVR A;  4A9L A;  4CUU A;  4CFK A;  5CQA A;  4Z6H A;  5FE9 A;  4O7B A;  4ZQL A;  4AKH A;  2YQD A;  4UYG A;  5J0D A;  5K29 A;  4YYD A;  4NR5 A;  4QEW A;  4TU4 A;  3SVG A;  5TB6 A;  5D24 A;  2RNY A;  5F63 A;  4N4F A;  5LKT A;  3D7C A;  4NR9 A;  5FFW A;  5FE5 A;  4NR7 A;  5I7X A;  4LZ2 A;  5A5Q A;  4MR4 A;  5F5Z A;  1F68 A;  5L99 A;  5CUG A;  5D7X A;  3DWY A;  4Z1Q A;  4QST A;  5KTW A;  5D3S A;  5ENC A;  3IU5 A;  4YAB A;  4NR4 A;  3D1D A;  5F61 A;  1N72 A;  4IOO A;  4O75 A;  5JI8 A;  3O34 A;  3UV4 A;  5KTX A;  5HRV A;  4O7C A;  5BT3 A;  5JWM A;  5A83 A;  5H1T A;  4RVR A;  2GRC A;  2WP1 A;  3MB3 A;  5COI A;  2RNX A;  5EU1 A;  4MR5 A;  4QC3 A;  5AD3 A;  4YBS A;  4ALG A;  3O33 A;  5FE6 A;  5LVR A;  3U5P A;  4XY9 A;  4UIV A;  5HCL A;  5ENI A;  2YEM A;  5CQT A;  4NR6 A;  2RO1 A;  5CQ5 A;  2E7O A;  5E3D A;  5CQ8 A;  5DKD A;  3I3J A;  3U5J A;  5D3H A;  4QEV A;  4LDF A;  4O7F A;  3MQM A;  4MEQ A;  4QYL A;  2YYN A;  4QYD A;  5CUE A;  5DFB A;  5H1V A;  5DYX A;  5HQ6 A;  5LKX A;  4HBX A;  5DY7 A;  5KU3 A;  5CQ7 A;  5ENH A;  3P1D A;  4HXN A;  3IU6 A;  5ENB A;  5H1U A;  4FLP A;  5HEM A;  5DKC A;  4AI6 A;  5BT5 A;  3D1B A;  2WP2 A;  5CFW A;  4PCE A;  4A9I A;  4NYX A;  5EWV A;  4DON A;  5A82 A;  5F1H A;  4QSV A;  5F1L A;  5CGP A;  3U5O A;  4NRA A;  5CP5 A;  4O76 A;  2OSS A;  4QUU A;  4CUS A;  5D0C A;  2R0Y A;  5D3R A;  3SVH A;  4J1P A;  5I83 A;  4A9M A;  3QZV A;  5FH7 A;  4HXK A;  5IGL A;  4KCX A;  3Q2E A;  5AME A;  5TCM A;  4IR4 A;  5HLS A;  4TS8 A;  5ENJ A;  5CQ4 A;  5I7Y A;  4NS5 A;  4UYH A;  3UW9 A;  5DYU A;  4YY4 A;  5F2P A;  5DYC A;  4AKG A;  5KTU A;  4J0S A;  5E9L A;  3DAI A;  2R0S A;  5L97 A;  3MUL A;  4O77 A;  5BT4 A;  4AKI A;  5HQ5 A;  3P5O A;  5HM0 A;  4MEN A;  4Z1S A;  5EWC A;  4BW4 A;  5EIC A;  4UYE A;  4HBY A;  5FFV A;  5C87 A;  2FSA A;  5EA1 A;  3AAD A;  3VKG A;  5FH8 A;  5DBM A;  3S92 A;  5FG5 A;  3P1F A;  4NYV A;  3S91 A;  3U5N A;  4C66 A;  1ZS5 A;  4Q0O A;  5DLZ A;  5F25 A;  2R0V A;  4QSQ A;  4ALH A;  4J0R A;  4J3I A;  5FH6 A;  4YBM A;  5C8G A;  1JSP B;  4Z93 A;  4TYL A;  4CL9 A;  4XYA A;  5E9I A;  5L8T A;  5A81 A;  4PKL A;  5I1Q A;  4CFL A;  3ERR A;  5FG4 A;  3LJW A;  5E3G A;  4MR3 A;  4QB3 A;  5D26 A;  3U5K A;  5LKZ A;  3O36 A;  5EIS A;  4O72 A;  5EWW A;  5IG6 A;  4YYM A;  2DWW A;  4TQN A;  2L84 A;  5D3T A;  2DVS A;  5E9K A;  3Q2F A;  4HXM A;  4UIW A;  5E73 A;  4BW3 A;  4YAT A;  5C89 A;  5HEL A;  4BW2 A;  4NQN A;  3UVD A;  4O7A A;  4NUD A;  5HEN A;  5EM3 A;  4YYI A;  4NR8 A;  5EQ1 A;  2N9G A;  4N3W A;  5CQ6 A;  4C67 A;  5HJC A;  2LSP B;  4IOR A;  4CLB A;  4E96 A;  4PTB A;  5A5P A;  4YK0 A;  5LKU A;  4WIV A;  4O7E A;  5A85 A;  5L96 A;  4QC1 A;  5C85 A;  4UYD A;  5HFR A;  3AQA A;  2RI7 A;  3U5L A;  4WHU A;  4QR5 A;  4IR6 A;  3ONI A;  4BJX A;  3HMH A;  1WUG A;  4AKN A;  4IR3 A;  5FE8 A;  5A7C A;  5CZG A;  5IBN A;  5C7N A;  4A9J A;  5LJ2 A;  5CQ3 A;  5L98 A;  3O35 A;  4NYW A;  5G4S A;  3UV5 A;  4UIU A;  5DFD A;  4O71 A;  5FE4 A;  2I8N A;  4QR4 A;  5CUA A;  4O70 A;  5LVQ A;  5DKH A;  5CY9 A;  2YEL A;  2H60 A;  4MR6 A;  4TZ2 A;  5IGM A;  5CRZ A;  2YEK A;  3P1E A;  3UVY A;  5DW2 A;  5I40 A;  4QEU A;  5EPR A;  4XY8 A;  5KHM A;  4UYF A;  5CRM A;  5ETB A;  4HXP A;  5FBX A;  5IGK A;  5II2 A;  3QZT A;  3NXB A;  5HRX A;  4YY6 A;  3MXF A;  4QUT A;  4LZS A;  5FE1 A;  4YYH A;  5E9Y A;  4HXR A;  5FE7 A;  4ZW1 A;  5D3P A;  5E9V A;  5HFQ A;  5EPB A;  4LZR A;  5I88 A;  3JVM A;  5D3L A;  5EWD A;  3TLP A;  3VKH A;  4NRC A;  4PS5 A;  3MB4 A;  2F6J A;  5ACY A;  4NUE A;  4TT2 A;  3ZYU A;  5FB0 A;  4YYN A;  5EGU A;  5F36 A;  4CUR A;  2G4A A;  5CUD A;  4N4G A;  4CUT A;  5HRW A;  4CUP A;  5HQ7 A;  2YDW A;  2DKW A;  2YW5 A;  4HXS A;  3UVX A;  1EQF A;  4ZC9 A;  3G0L A;  4Y03 A;  5FE0 A;  4OGJ A;  5C4Q A;  3RCW A;  2RNW A;  3JVL A;  4QSW A;  2R10 A;  4N4H A;  5L8U A;  4UYF B;  4TU6 A;  4A9K A;  5ENE A;  5ETD A;  4GPJ A;  4QY4 A;  4UIZ A;  5LJ0 A;  3LQH A;  2OUO A;  4HXO A;  4YBT A;  4A9H A;  4LC2 A;  4A9N A;  2DAT A;  3FKM X;  5FFY A;  4YYG A;  1X0J A;  4LYS A;  4YC9 A;  5DFC A;  4HXL A;  2DVV A;  5DX4 A;  5A5O A;  3LQI A;  4YYJ A;  5IID A;  4BHW A;  5D25 A;  4NUC A;  5EI4 A;  5EWH A;  5AMF A;  4HBW A;  4TT6 A;  5ENG A;  4F3I A;  4IOQ A;  4KV1 A;  4LR6 A;  1WUM A;  4IR5 A;  5A5S A;  5FE2 A;  4KV4 A;  5CUB A;  2MJV B;  5CS8 A;  3HME A;  3JVK A;  5II1 A;  4Q0N A;  2NXB A;  2RFJ A;  5D3N A;  3HMF A;  5F60 A;  3LXJ A;  5EP7 A;  4UIX A;  5I89 A;  4YH4 A;  2DVQ A;  4LRG A;  4QSP A;  2E3K A;  5DW1 A;  1PUO A;  5FDZ A;  4QNS A;  2E7N A;  5DLX A;  5H85 A;  4Z6I A;  2L85 A;  3JVJ A;  1E6I A;  4YH3 A;  4XUA A;  4QSR A;  4TZ8 A;  2D9E A;  2RS9 B;  5KO4 A;  2D82 A;  3QZS A;  3K2J A;  4OGI A;  5D3J A;  4X2I A;  4O74 A;  4O78 A;  5EPS A;  4QSS A;  4UIY A;  4BW1 A;  5CUC A;  4HBV A;  4YAX A;  5LUU A;  2F6N A;  4WHW A;  5EK9 A;  4LYI A;  4PCI A;  5EV9 A;  3U5M A;  5I29 A;  5CPE A;  5F62 A;  4TT4 A;  3O37 A;  4N4I A;  4MEO A;  4TTE A;  5FE3 A;  4QSU A;  3UVW A;  4A9O A;  4A9F A;  4QBM A;  4YAD A;  4QZS A;  5FB1 A;  5I80 A;  4NQM A;  4QR3 A;  2I7K A;  4MEP A;  5E9M A;  2L5E A;  3SVF A;  4NRB A;  5A5N A;  5IGN A;  1JM4 B;  4CUQ A;  4A9E A;  4OUF A;  4NXJ A;  3LQJ A;  3MUK A;  3G0J A;  4UIT A;  5CTL A;  5CU8 A;  2KTB B;  3GG3 A;  5FG6 A;  4PY6 A; 
#chains in the Genus database with same CATH homology
 5F3A A;  5G4R A;  5E74 A;  3UV2 A;  5LJ1 A;  5I86 A;  5E7D A;  2OO1 A;  4YYK A;  5ENF A;  5AD2 A;  5EVA A;  5E0R A;  5A5R A;  4QSX A;  4XUB A;  5DYA A;  3P1C A;  4LYW A;  2DVR A;  4A9L A;  4CUU A;  4CFK A;  5CQA A;  4Z6H A;  5FE9 A;  4O7B A;  4ZQL A;  2YQD A;  4UYG A;  5J0D A;  5K29 A;  4YYD A;  4NR5 A;  4QEW A;  4TU4 A;  3SVG A;  5TB6 A;  5D24 A;  2RNY A;  5F63 A;  4N4F A;  5LKT A;  3D7C A;  4NR9 A;  5FFW A;  5FE5 A;  4NR7 A;  5I7X A;  4LZ2 A;  5A5Q A;  4MR4 A;  5F5Z A;  1F68 A;  5L99 A;  5CUG A;  5D7X A;  3DWY A;  4Z1Q A;  4QST A;  5KTW A;  5D3S A;  5ENC A;  3IU5 A;  4YAB A;  4NR4 A;  5F61 A;  1N72 A;  4IOO A;  4O75 A;  5JI8 A;  3O34 A;  3UV4 A;  5KTX A;  5HRV A;  4O7C A;  5BT3 A;  5JWM A;  5A83 A;  5H1T A;  4RVR A;  2GRC A;  2WP1 A;  3MB3 A;  5COI A;  2RNX A;  5EU1 A;  4MR5 A;  4QC3 A;  5AD3 A;  4YBS A;  4ALG A;  3O33 A;  5FE6 A;  5LVR A;  3U5P A;  4XY9 A;  4UIV A;  5HCL A;  5ENI A;  2YEM A;  5CQT A;  4NR6 A;  2RO1 A;  5CQ5 A;  2E7O A;  5E3D A;  5CQ8 A;  5DKD A;  3I3J A;  3U5J A;  5D3H A;  4QEV A;  4LDF A;  4O7F A;  3MQM A;  4MEQ A;  4QYL A;  2YYN A;  4QYD A;  5CUE A;  5DFB A;  5H1V A;  5DYX A;  5HQ6 A;  5LKX A;  4HBX A;  5DY7 A;  5KU3 A;  5CQ7 A;  5ENH A;  3P1D A;  4HXN A;  3IU6 A;  5ENB A;  5H1U A;  4FLP A;  5HEM A;  5DKC A;  5BT5 A;  2WP2 A;  5CFW A;  4PCE A;  4A9I A;  4NYX A;  5EWV A;  4DON A;  5A82 A;  5F1H A;  4QSV A;  5F1L A;  5CGP A;  3U5O A;  4NRA A;  5CP5 A;  4O76 A;  2OSS A;  4QUU A;  4CUS A;  5D0C A;  2R0Y A;  5D3R A;  3SVH A;  4J1P A;  5I83 A;  4A9M A;  3QZV A;  5FH7 A;  4HXK A;  5IGL A;  4KCX A;  3Q2E A;  5AME A;  5TCM A;  4IR4 A;  5HLS A;  4TS8 A;  5ENJ A;  5CQ4 A;  5I7Y A;  4NS5 A;  4UYH A;  3UW9 A;  5DYU A;  4YY4 A;  5F2P A;  5DYC A;  5KTU A;  4J0S A;  5E9L A;  3DAI A;  2R0S A;  5L97 A;  3MUL A;  4O77 A;  5BT4 A;  5HQ5 A;  3P5O A;  5HM0 A;  4MEN A;  4Z1S A;  5EWC A;  4BW4 A;  5EIC A;  4UYE A;  4HBY A;  5FFV A;  5C87 A;  2FSA A;  5EA1 A;  3AAD A;  5FH8 A;  5DBM A;  3S92 A;  5FG5 A;  3P1F A;  4NYV A;  3S91 A;  3U5N A;  4C66 A;  1ZS5 A;  4Q0O A;  5DLZ A;  5F25 A;  2R0V A;  4QSQ A;  4ALH A;  4J0R A;  4J3I A;  5FH6 A;  4YBM A;  5C8G A;  1JSP B;  4Z93 A;  4TYL A;  4CL9 A;  4XYA A;  5E9I A;  5L8T A;  5A81 A;  4PKL A;  5I1Q A;  4CFL A;  5FG4 A;  3LJW A;  5E3G A;  4MR3 A;  4QB3 A;  5D26 A;  3U5K A;  5LKZ A;  3O36 A;  5EIS A;  4O72 A;  5EWW A;  5IG6 A;  4YYM A;  2DWW A;  4TQN A;  2L84 A;  5D3T A;  2DVS A;  5E9K A;  3Q2F A;  4HXM A;  4UIW A;  5E73 A;  4BW3 A;  4YAT A;  5C89 A;  5HEL A;  4BW2 A;  4NQN A;  3UVD A;  4O7A A;  4NUD A;  5HEN A;  5EM3 A;  4YYI A;  4NR8 A;  5EQ1 A;  2N9G A;  4N3W A;  5CQ6 A;  4C67 A;  5HJC A;  2LSP B;  4IOR A;  4CLB A;  4E96 A;  4PTB A;  5A5P A;  4YK0 A;  5LKU A;  4WIV A;  4O7E A;  5A85 A;  5L96 A;  4QC1 A;  5C85 A;  4UYD A;  5HFR A;  3AQA A;  2RI7 A;  3U5L A;  4WHU A;  4QR5 A;  4IR6 A;  3ONI A;  4BJX A;  3HMH A;  1WUG A;  4AKN A;  4IR3 A;  5FE8 A;  5A7C A;  5CZG A;  5IBN A;  5C7N A;  4A9J A;  5LJ2 A;  5CQ3 A;  5L98 A;  3O35 A;  4NYW A;  5G4S A;  3UV5 A;  4UIU A;  5DFD A;  4O71 A;  5FE4 A;  2I8N A;  4QR4 A;  5CUA A;  4O70 A;  5LVQ A;  5DKH A;  5CY9 A;  2YEL A;  2H60 A;  4MR6 A;  4TZ2 A;  5IGM A;  5CRZ A;  2YEK A;  3P1E A;  3UVY A;  5DW2 A;  5I40 A;  4QEU A;  5EPR A;  4XY8 A;  5KHM A;  4UYF A;  5CRM A;  5ETB A;  4HXP A;  5FBX A;  5IGK A;  5II2 A;  3QZT A;  3NXB A;  5HRX A;  4YY6 A;  3MXF A;  4QUT A;  4LZS A;  5FE1 A;  4YYH A;  5E9Y A;  4HXR A;  5FE7 A;  4ZW1 A;  5D3P A;  5E9V A;  5HFQ A;  5EPB A;  4LZR A;  5I88 A;  3JVM A;  5D3L A;  5EWD A;  3TLP A;  4NRC A;  4PS5 A;  3MB4 A;  2F6J A;  5ACY A;  4NUE A;  4TT2 A;  3ZYU A;  5FB0 A;  4YYN A;  5EGU A;  5F36 A;  4CUR A;  2G4A A;  5CUD A;  4N4G A;  4CUT A;  5HRW A;  4CUP A;  5HQ7 A;  2YDW A;  2DKW A;  2YW5 A;  4HXS A;  3UVX A;  1EQF A;  4ZC9 A;  3G0L A;  4Y03 A;  5FE0 A;  4OGJ A;  5C4Q A;  3RCW A;  2RNW A;  3JVL A;  4QSW A;  2R10 A;  4N4H A;  5L8U A;  4UYF B;  4TU6 A;  4A9K A;  5ENE A;  5ETD A;  4GPJ A;  4QY4 A;  4UIZ A;  5LJ0 A;  3LQH A;  2OUO A;  4HXO A;  4YBT A;  4A9H A;  4LC2 A;  4A9N A;  2DAT A;  3FKM X;  5FFY A;  4YYG A;  1X0J A;  4LYS A;  4YC9 A;  5DFC A;  4HXL A;  2DVV A;  5DX4 A;  5A5O A;  3LQI A;  4YYJ A;  5IID A;  4BHW A;  5D25 A;  4NUC A;  5EI4 A;  5EWH A;  5AMF A;  4HBW A;  4TT6 A;  5ENG A;  4F3I A;  4IOQ A;  4KV1 A;  4LR6 A;  1WUM A;  4IR5 A;  5A5S A;  5FE2 A;  4KV4 A;  5CUB A;  2MJV B;  5CS8 A;  3HME A;  3JVK A;  5II1 A;  4Q0N A;  2NXB A;  2RFJ A;  5D3N A;  3HMF A;  5F60 A;  3LXJ A;  5EP7 A;  4UIX A;  5I89 A;  4YH4 A;  2DVQ A;  4LRG A;  4QSP A;  2E3K A;  5DW1 A;  5FDZ A;  4QNS A;  2E7N A;  5DLX A;  5H85 A;  4Z6I A;  2L85 A;  3JVJ A;  1E6I A;  4YH3 A;  4XUA A;  4QSR A;  4TZ8 A;  2D9E A;  2RS9 B;  5KO4 A;  2D82 A;  3QZS A;  3K2J A;  4OGI A;  5D3J A;  4X2I A;  4O74 A;  4O78 A;  5EPS A;  4QSS A;  4UIY A;  4BW1 A;  5CUC A;  4HBV A;  4YAX A;  5LUU A;  2F6N A;  4WHW A;  5EK9 A;  4LYI A;  4PCI A;  5EV9 A;  3U5M A;  5I29 A;  5CPE A;  5F62 A;  4TT4 A;  3O37 A;  4N4I A;  4MEO A;  4TTE A;  5FE3 A;  4QSU A;  3UVW A;  4A9O A;  4A9F A;  4QBM A;  4YAD A;  4QZS A;  5FB1 A;  5I80 A;  4NQM A;  4QR3 A;  2I7K A;  4MEP A;  5E9M A;  2L5E A;  3SVF A;  4NRB A;  5A5N A;  5IGN A;  1JM4 B;  4CUQ A;  4A9E A;  4OUF A;  4NXJ A;  3LQJ A;  3MUK A;  3G0J A;  4UIT A;  5CTL A;  5CU8 A;  2KTB B;  3GG3 A;  5FG6 A;  4PY6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...