3P1EA

Crystal structure of the bromodomain of human crebbp in complex with dimethyl sulfoxide (dmso)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
114
structure length
114
Chain Sequence
KIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords CREB-binding protein
publication title Crystal structure of the bromodomain of human CREBBP in complex with dimethyl sulfoxide (DMSO)
rcsb
source organism Homo sapiens
total genus 39
structure length 114
sequence length 114
chains with identical sequence B
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2010-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3p1eA00
4IOOA 5C7NA 4HXOA 5ENGA 2YQDA 1JM4B 5LJ0A 4Y03A 5F2PA 5DKDA 4XY9A 5L97A 4PCEA 4CUTA 3S92A 4NR7A 4WHUA 4CUPA 5HRWA 4O7CA 5CRZA 5E9VA 5FE3A 5I80A 5CFWA 2DVSA 2R0VA 3G0JA 3LJWA 4N4IA 4TZ8A 4HXMA 4UIVA 5FE0A 5D3HA 2MJVB 3U5PA 5DKCA 3IU5A 3MB3A 4TT2A 5EISA 3JVKA 3JVLA 4RVRA 5DBMA 2WP2A 5IGKA 5F5ZA 2YEKA 4UYFA 4XYAA 4UYEA 5FE2A 3JVJA 5A83A 4YYGA 5F60A 5E0RA 5CZGA 5C4QA 5F3AA 5I88A 2RI7A 4MR5A 5ETDA 4PTBA 5FDZA 3P1FA 2RFJA 5DW2A 5I89A 5CP5A 4A9MA 3QZVA 5A7CA 4A9JA 4Z6IA 4QSSA 3S91A 4LYIA 2R0SA 5F1HA 5IGLA 5HQ6A 5HQ5A 4NR8A 5HRXA 5IGNA 3O37A 5CQ6A 3G0LA 5CUEA 5H1VA 5EWHA 4NR4A 1E6IA 4FLPA 2RS9B 3AADA 5FE6A 2DKWA 5ACYA 5DX4A 5EWDA 3SVFA 5A81A 3UVYA 5E3GA 5ENCA 4Z93A 2YDWA 4QY4A 5HRVA 5H1TA 4BW4A 5DYCA 4YY4A 1X0JA 4HXKA 5F61A 5CPEA 4TT4A 5FH6A 2I7KA 4YABA 5EVAA 2NXBA 4A9IA 5D3TA 4X2IA 4HXRA 5HQ7A 2E3KA 3MB4A 3P1CA 4O76A 5H1UA 4UYFB 5L99A 5D3SA 4QEVA 5CUCA 5ENBA 4UITA 4O72A 4NR5A 4CURA 5E73A 2GRCA 1JSPB 5CQAA 4NUEA 3U5OA 4Z6HA 5EWCA 4QBMA 5FH8A 5EICA 4ZQLA 5LKTA 5FG6A 2I8NA 4Z1QA 4BW3A 5AD3A 1N72A 3LQHA 3LXJA 5KU3A 4LR6A 3HMEA 5E9MA 4UYGA 4CUSA 5CUBA 4QC1A 4NR6A 5FE5A 4NRBA 5D3NA 5FB0A 5CQ4A 4ALGA 3AQAA 4Q0OA 3MXFA 4J1PA 5H85A 5A5PA 3RCWA 4MENA 3UW9A 5C87A 5EGUA 3UVDA 4OGIA 2OO1A 5JI8A 4TTEA 5HCLA 4YYDA 4MR4A 4Q0NA 5EPRA 4QSWA 1WUGA 4A9NA 4C67A 4GPJA 5KTXA 5DKHA 5IIDA 4UIUA 4OGJA 3DAIA 4YC9A 5KTUA 4QEUA 5A82A 4LZ2A 5LKZA 2KTBB 5KTWA 4QC3A 4YYHA 3HMFA 4KV1A 3D7CA 2L85A 4O7AA 4N4FA 2R10A 4A9KA 5TB6A 4O71A 5I1QA 5I86A 5ENJA 4CUUA 4J3IA 4LYWA 4NRAA 2RO1A 5DYXA 3K2JA 5D0CA 5HELA 4MEQA 4KCXA 5CGPA 4QYDA 5AMFA 3LQJA 5C89A 5II1A 3UV4A 4XUAA 5LJ2A 4QEWA 5BT4A 5A5RA 3QZTA 3SVHA 5JWMA 5LVQA 4MEOA 3UVXA 4HBYA 5HLSA 5CQ7A 2DWWA 5C85A 5FB1A 5A85A 2R0YA 3O33A 4HXLA 3QZSA 4YBTA 2LSPB 4YYNA 5DFBA 5HFQA 4QUTA 4YADA 4YYJA 1WUMA 5BT3A 3UVWA 3UV5A 4O78A 4O7BA 5HM0A 4QSRA 4A9EA 5FE9A 4NYVA 4HBVA 3U5JA 4YYIA 2E7NA 5C8GA 4HXPA 5G4RA 5IG6A 5F62A 3U5KA 4NXJA 4A9HA 2D82A 5BT5A 2WP1A 5CTLA 4QR5A 5D3RA 5FFVA 5L8UA 4YH4A 5CRMA 5EU1A 3SVGA 5ENIA 5CUGA 5E3DA 2DVRA 4MR6A 4XY8A 5II2A 4NQMA 5CS8A 5EP7A 5J0DA 5FFWA 5E7DA 4PKLA 4A9FA 5D24A 5L98A 1F68A 4N4GA 5D3LA 5IBNA 4Z1SA 4E96A 5A5QA 5CQ5A 4YYMA 5CUAA 5EA1A 4QSTA 2RNYA 5D3JA 4UIWA 4TZ2A 5E9YA 5CUDA 4CFLA 4NYWA 5I29A 4LC2A 1EQFA 4LZRA 5A5OA 5HEMA 4O77A 2OSSA 4OUFA 3GG3A 5FE4A 4QB3A 4O7EA 5E74A 3Q2EA 4YYKA 4IORA 5DFDA 4HXNA 4A9LA 5EWWA 4QUUA 5G4SA 4KV4A 2RNXA 2RNWA 4O74A 4A9OA 5D7XA 4ZC9A 3MUKA 4XUBA 4F3IA 5CQ3A 5D26A 4YAXA 5L96A 2N9GA 5EV9A 5FE1A 4AKNA 4CL9A 4LZSA 3Q2FA 4ZW1A 4NYXA 5COIA 2DATA 4NUDA 3IU6A 4UIZA 4NR9A 5DYAA 5AD2A 2YELA 4NRCA 5LKXA 5D25A 4PCIA 5EK9A 4O7FA 5ENHA 4YATA 5DW1A 5EQ1A 4QR4A 4N3WA 4HBXA 5DLZA 4CFKA 3ONIA 3HMHA 5E9KA 4QSPA 5FH7A 3MQMA 3DWYA 4QSUA 2DVVA 2F6JA 4BW1A 4WIVA 4TT6A 5TCMA 5I83A 5F63A 3O34A 4ALHA 4TQNA 4CUQA 5HJCA 4NS5A 5DY7A 4WHWA 4TYLA 5CQTA 4LRGA 4IOQA 4HBWA 5HENA 4C66A 4IR4A 3JVMA 5FG5A 5KO4A 5ENFA 4IR6A 5E9LA 1ZS5A 3P1DA 3P5OA 4QSQA 5I7XA 5F25A 2FSAA 2L84A 5CQ8A 5DYUA 5KHMA 5EPBA 5FE8A 3UV2A 4MEPA 4N4HA 4IR5A 5HFRA 5EI4A 3TLPA 2YW5A 4TU4A 5FG4A 5ETBA 5FBXA 2YYNA 4QSVA 4HXSA 5EM3A 4NQNA 5E9IA 3ZYUA 4TS8A 4LYSA 5FFYA 2L5EA 5I7YA 4UIXA 5CU8A 4O75A 5F1LA 4J0SA 3U5LA 5FE7A 2DVQA 4BW2A 4UIYA 5LKUA 4YBMA 4YK0A 3O35A 5DLXA 5A5SA 4QNSA 4QSXA 5D3PA 5EPSA 4TU6A 5DFCA 4J0RA 4QYLA 4LDFA 4UYDA 5L8TA 4QR3A 4O70A 3LQIA 5LUUA 4BHWA 2H60A 3FKMX 2OUOA 3U5MA 4YBSA 5IGMA 5A5NA 3U5NA 5LJ1A 2E7OA 5F36A 4YY6A 5I40A 5LVRA 4UYHA 5CY9A 5K29A 2YEMA 4NUCA 3NXBA 4MR3A 4PS5A 4YH3A 3I3JA 3P1EA 5ENEA 4IR3A 4PY6A 2F6NA 5EWVA 2G4AA 3O36A 2D9EA 4BJXA 4DONA 3MULA 4QZSA 4CLBA 5AMEA
chains in the Genus database with same CATH superfamily
4IOOA 5C7NA 4HXOA 5ENGA 2YQDA 1JM4B 5LJ0A 4Y03A 5F2PA 5DKDA 4XY9A 5L97A 4PCEA 4CUTA 3S92A 4NR7A 4WHUA 4CUPA 5HRWA 4O7CA 5CRZA 5E9VA 5FE3A 5I80A 5CFWA 2DVSA 2R0VA 3G0JA 3LJWA 4N4IA 4TZ8A 4HXMA 4UIVA 5FE0A 5D3HA 2MJVB 3U5PA 5DKCA 3IU5A 3MB3A 4TT2A 5EISA 3JVKA 3JVLA 4RVRA 5DBMA 2WP2A 5IGKA 5F5ZA 2YEKA 4UYFA 4XYAA 4UYEA 5FE2A 3JVJA 5A83A 4YYGA 5F60A 5E0RA 5CZGA 5C4QA 5F3AA 5I88A 2RI7A 4MR5A 5ETDA 4PTBA 5FDZA 3P1FA 2RFJA 5DW2A 5I89A 5CP5A 4A9MA 3QZVA 5A7CA 4A9JA 4Z6IA 4QSSA 3S91A 4LYIA 2R0SA 5F1HA 5IGLA 5HQ6A 5HQ5A 4NR8A 5HRXA 5IGNA 3O37A 5CQ6A 3G0LA 5CUEA 5H1VA 5EWHA 4NR4A 1E6IA 4FLPA 2RS9B 3AADA 5FE6A 2DKWA 5ACYA 5DX4A 5EWDA 3SVFA 5A81A 2EJNA 3UVYA 5E3GA 5ENCA 2YDWA 4QY4A 4Z93A 5HRVA 5H1TA 4BW4A 5DYCA 4YY4A 1X0JA 4HXKA 5F61A 5CPEA 4TT4A 5FH6A 2I7KA 4YABA 5EVAA 2NXBA 4A9IA 5D3TA 4X2IA 4HXRA 5HQ7A 2E3KA 3MB4A 3P1CA 1PUOA 4O76A 5H1UA 4UYFB 5L99A 5D3SA 3VKGA 4QEVA 5CUCA 5ENBA 3D1BA 4UITA 4O72A 4NR5A 4CURA 5E73A 2GRCA 1JSPB 5CQAA 4NUEA 3U5OA 4Z6HA 5EWCA 4QBMA 5FH8A 5EICA 4ZQLA 5LKTA 5FG6A 2I8NA 4Z1QA 4BW3A 5AD3A 1N72A 3LQHA 3LXJA 5KU3A 4LR6A 3HMEA 5E9MA 4UYGA 4CUSA 5CUBA 4QC1A 4NR6A 5FE5A 4NRBA 5D3NA 5FB0A 5CQ4A 4ALGA 3AQAA 4Q0OA 3MXFA 4J1PA 5H85A 5A5PA 3RCWA 4MENA 3UW9A 5C87A 5EGUA 3UVDA 4OGIA 2OO1A 3ERRA 5JI8A 4TTEA 5HCLA 4YYDA 4MR4A 4Q0NA 5EPRA 4QSWA 1WUGA 4A9NA 4C67A 4GPJA 5KTXA 5DKHA 5IIDA 4UIUA 4OGJA 3DAIA 4YC9A 5KTUA 4QEUA 5A82A 4LZ2A 5LKZA 2KTBB 5KTWA 4QC3A 4YYHA 3HMFA 4KV1A 3D7CA 2L85A 4O7AA 4N4FA 2R10A 4A9KA 5TB6A 4O71A 5I1QA 5I86A 5ENJA 4CUUA 4J3IA 4LYWA 4NRAA 2RO1A 5DYXA 3K2JA 5D0CA 5HELA 4MEQA 4KCXA 5CGPA 4QYDA 5AMFA 3LQJA 5C89A 5II1A 3UV4A 4XUAA 5LJ2A 4QEWA 5BT4A 5A5RA 3QZTA 3SVHA 5JWMA 5LVQA 4MEOA 3UVXA 4HBYA 5HLSA 5CQ7A 2DWWA 5C85A 5FB1A 5A85A 2R0YA 3VKHA 3O33A 4HXLA 3QZSA 4YBTA 2LSPB 4YYNA 5DFBA 5HFQA 4QUTA 4YADA 4YYJA 1WUMA 5BT3A 3UVWA 3UV5A 4O78A 4O7BA 5HM0A 4QSRA 4A9EA 5FE9A 4NYVA 4HBVA 3U5JA 4YYIA 2E7NA 5C8GA 4HXPA 5G4RA 5IG6A 5F62A 3U5KA 4NXJA 4A9HA 2D82A 4AI6A 5BT5A 2WP1A 5CTLA 4QR5A 5D3RA 5FFVA 5L8UA 4AKGA 4YH4A 5CRMA 5EU1A 3SVGA 5ENIA 5CUGA 5E3DA 2DVRA 1ZKRA 4MR6A 4XY8A 5II2A 4NQMA 5CS8A 5EP7A 5J0DA 5FFWA 5E7DA 4PKLA 4A9FA 5D24A 5L98A 1F68A 4AKHA 4N4GA 5D3LA 5IBNA 4Z1SA 4E96A 5A5QA 5CQ5A 4YYMA 5CUAA 5EA1A 4QSTA 2RNYA 4AKIA 5D3JA 4UIWA 4TZ2A 5E9YA 5CUDA 4CFLA 4NYWA 5I29A 4LC2A 1EQFA 4LZRA 5A5OA 5HEMA 4O77A 2OSSA 4OUFA 3GG3A 5FE4A 4QB3A 4O7EA 5E74A 3Q2EA 4YYKA 4IORA 5DFDA 4HXNA 4A9LA 5EWWA 4QUUA 5G4SA 4KV4A 2RNXA 2RNWA 4O74A 4A9OA 5D7XA 4ZC9A 3MUKA 4XUBA 4F3IA 5CQ3A 5D26A 4YAXA 5L96A 2N9GA 5EV9A 5FE1A 4AKNA 4CL9A 4LZSA 3Q2FA 4ZW1A 4NYXA 5COIA 2DATA 4NUDA 3IU6A 4UIZA 4NR9A 5DYAA 5AD2A 2YELA 4NRCA 5LKXA 5D25A 4PCIA 5EK9A 4O7FA 5ENHA 4YATA 5DW1A 5EQ1A 4QR4A 4N3WA 4HBXA 5DLZA 4CFKA 3ONIA 3HMHA 5E9KA 4QSPA 5FH7A 3MQMA 3DWYA 4QSUA 2DVVA 2F6JA 4BW1A 4WIVA 4TT6A 5TCMA 5I83A 5F63A 3O34A 4ALHA 4TQNA 3D1DA 4CUQA 5HJCA 4NS5A 5DY7A 4WHWA 4TYLA 5CQTA 4LRGA 4IOQA 4HBWA 5HENA 4C66A 4IR4A 3JVMA 5FG5A 5KO4A 5ENFA 4IR6A 5E9LA 1ZS5A 3P1DA 3P5OA 4QSQA 5I7XA 5F25A 2FSAA 2L84A 5CQ8A 5DYUA 5KHMA 5EPBA 5FE8A 3UV2A 4MEPA 4N4HA 4IR5A 5HFRA 5EI4A 3TLPA 2YW5A 4TU4A 5FG4A 5ETBA 5FBXA 2YYNA 4QSVA 4HXSA 5EM3A 4NQNA 5E9IA 3ZYUA 4TS8A 4LYSA 5FFYA 2L5EA 5I7YA 4UIXA 5CU8A 4O75A 5F1LA 4J0SA 3U5LA 5FE7A 2DVQA 4BW2A 4UIYA 5LKUA 4YBMA 4YK0A 3O35A 5DLXA 5A5SA 4QNSA 4QSXA 5D3PA 5EPSA 4TU6A 5DFCA 4J0RA 4QYLA 4LDFA 4UYDA 5L8TA 4QR3A 4O70A 3LQIA 5LUUA 4BHWA 2H60A 3FKMX 2OUOA 3U5MA 4YBSA 5IGMA 5A5NA 3U5NA 5LJ1A 2E7OA 5F36A 4YY6A 5I40A 5LVRA 4UYHA 5CY9A 5K29A 2YEMA 4NUCA 3NXBA 4MR3A 4PS5A 4YH3A 3I3JA 3P1EA 5ENEA 4IR3A 4PY6A 2F6NA 5EWVA 2G4AA 3O36A 2D9EA 4BJXA 4DONA 3MULA 4QZSA 4CLBA 5AMEA
chains in the Genus database with same CATH topology
4IOOA 5C7NA 4HXOA 5ENGA 2YQDA 1JM4B 5LJ0A 4Y03A 5F2PA 5DKDA 4XY9A 5L97A 4PCEA 4CUTA 3S92A 4NR7A 4WHUA 4CUPA 5HRWA 4O7CA 5CRZA 5E9VA 5FE3A 5I80A 5CFWA 2DVSA 2R0VA 3G0JA 3LJWA 4N4IA 4TZ8A 4HXMA 4UIVA 5FE0A 5D3HA 2MJVB 3U5PA 5DKCA 3IU5A 3MB3A 4TT2A 5EISA 3JVKA 3JVLA 4RVRA 5DBMA 2WP2A 5IGKA 5F5ZA 2YEKA 4UYFA 4XYAA 4UYEA 5FE2A 3JVJA 5A83A 4YYGA 5F60A 5E0RA 5CZGA 5C4QA 5F3AA 5I88A 2RI7A 4MR5A 5ETDA 4PTBA 5FDZA 3P1FA 2RFJA 5DW2A 5I89A 5CP5A 4A9MA 3QZVA 5A7CA 4A9JA 4Z6IA 4QSSA 3S91A 4LYIA 2R0SA 5F1HA 5IGLA 5HQ6A 5HQ5A 4NR8A 5HRXA 5IGNA 3O37A 5CQ6A 3G0LA 5CUEA 5H1VA 5EWHA 4NR4A 1E6IA 4FLPA 2RS9B 3AADA 5FE6A 2DKWA 5ACYA 5DX4A 5EWDA 3SVFA 5A81A 3UVYA 5E3GA 5ENCA 4Z93A 2YDWA 4QY4A 5HRVA 5H1TA 4BW4A 5DYCA 4YY4A 1X0JA 4HXKA 5F61A 5CPEA 4TT4A 5FH6A 2I7KA 4YABA 5EVAA 2NXBA 4A9IA 5D3TA 4X2IA 4HXRA 5HQ7A 2E3KA 3MB4A 3P1CA 4O76A 5H1UA 4UYFB 5L99A 5D3SA 4QEVA 5CUCA 5ENBA 4UITA 4O72A 4NR5A 4CURA 5E73A 2GRCA 1JSPB 5CQAA 4NUEA 3U5OA 4Z6HA 5EWCA 4QBMA 5FH8A 5EICA 4ZQLA 5LKTA 5FG6A 2I8NA 4Z1QA 4BW3A 5AD3A 1N72A 3LQHA 3LXJA 5KU3A 4LR6A 3HMEA 5E9MA 4UYGA 4CUSA 5CUBA 4QC1A 4NR6A 5FE5A 4NRBA 5D3NA 5FB0A 5CQ4A 4ALGA 3AQAA 4Q0OA 3MXFA 4J1PA 5H85A 5A5PA 3RCWA 4MENA 3UW9A 5C87A 5EGUA 3UVDA 4OGIA 2OO1A 5JI8A 4TTEA 5HCLA 4YYDA 4MR4A 4Q0NA 5EPRA 4QSWA 1WUGA 4A9NA 4C67A 4GPJA 5KTXA 5DKHA 5IIDA 4UIUA 4OGJA 3DAIA 4YC9A 5KTUA 4QEUA 5A82A 4LZ2A 5LKZA 2KTBB 5KTWA 4QC3A 4YYHA 3HMFA 4KV1A 3D7CA 2L85A 4O7AA 4N4FA 2R10A 4A9KA 5TB6A 4O71A 5I1QA 5I86A 5ENJA 4CUUA 4J3IA 4LYWA 4NRAA 2RO1A 5DYXA 3K2JA 5D0CA 5HELA 4MEQA 4KCXA 5CGPA 4QYDA 5AMFA 3LQJA 5C89A 5II1A 3UV4A 4XUAA 5LJ2A 4QEWA 5BT4A 5A5RA 3QZTA 3SVHA 5JWMA 5LVQA 4MEOA 3UVXA 4HBYA 5HLSA 5CQ7A 2DWWA 5C85A 5FB1A 5A85A 2R0YA 3O33A 4HXLA 3QZSA 4YBTA 2LSPB 4YYNA 5DFBA 5HFQA 4QUTA 4YADA 4YYJA 1WUMA 5BT3A 3UVWA 3UV5A 4O78A 4O7BA 5HM0A 4QSRA 4A9EA 5FE9A 4NYVA 4HBVA 3U5JA 4YYIA 2E7NA 5C8GA 4HXPA 5G4RA 5IG6A 5F62A 3U5KA 4NXJA 4A9HA 2D82A 5BT5A 2WP1A 5CTLA 4QR5A 5D3RA 5FFVA 5L8UA 4YH4A 5CRMA 5EU1A 3SVGA 5ENIA 5CUGA 5E3DA 2DVRA 4MR6A 4XY8A 5II2A 4NQMA 5CS8A 5EP7A 5J0DA 5FFWA 5E7DA 4PKLA 4A9FA 5D24A 5L98A 1F68A 4N4GA 5D3LA 5IBNA 4Z1SA 4E96A 5A5QA 5CQ5A 4YYMA 5CUAA 5EA1A 4QSTA 2RNYA 5D3JA 4UIWA 4TZ2A 5E9YA 5CUDA 4CFLA 4NYWA 5I29A 4LC2A 1EQFA 4LZRA 5A5OA 5HEMA 4O77A 2OSSA 4OUFA 3GG3A 5FE4A 4QB3A 4O7EA 5E74A 3Q2EA 4YYKA 4IORA 5DFDA 4HXNA 4A9LA 5EWWA 4QUUA 5G4SA 4KV4A 2RNXA 2RNWA 4O74A 4A9OA 5D7XA 4ZC9A 3MUKA 4XUBA 4F3IA 5CQ3A 5D26A 4YAXA 5L96A 2N9GA 5EV9A 5FE1A 4AKNA 4CL9A 4LZSA 3Q2FA 4ZW1A 4NYXA 5COIA 2DATA 4NUDA 3IU6A 4UIZA 4NR9A 5DYAA 5AD2A 2YELA 4NRCA 5LKXA 5D25A 4PCIA 5EK9A 4O7FA 5ENHA 4YATA 5DW1A 5EQ1A 4QR4A 4N3WA 4HBXA 5DLZA 4CFKA 3ONIA 3HMHA 5E9KA 4QSPA 5FH7A 3MQMA 3DWYA 4QSUA 2DVVA 2F6JA 4BW1A 4WIVA 4TT6A 5TCMA 5I83A 5F63A 3O34A 4ALHA 4TQNA 4CUQA 5HJCA 4NS5A 5DY7A 4WHWA 4TYLA 5CQTA 4LRGA 4IOQA 4HBWA 5HENA 4C66A 4IR4A 3JVMA 5FG5A 5KO4A 5ENFA 4IR6A 5E9LA 1ZS5A 3P1DA 3P5OA 4QSQA 5I7XA 5F25A 2FSAA 2L84A 5CQ8A 5DYUA 5KHMA 5EPBA 5FE8A 3UV2A 4MEPA 4N4HA 4IR5A 5HFRA 5EI4A 3TLPA 2YW5A 4TU4A 5FG4A 5ETBA 5FBXA 2YYNA 4QSVA 4HXSA 5EM3A 4NQNA 5E9IA 3ZYUA 4TS8A 4LYSA 5FFYA 2L5EA 5I7YA 4UIXA 5CU8A 4O75A 5F1LA 4J0SA 3U5LA 5FE7A 2DVQA 4BW2A 4UIYA 5LKUA 4YBMA 4YK0A 3O35A 5DLXA 5A5SA 4QNSA 4QSXA 5D3PA 5EPSA 4TU6A 5DFCA 4J0RA 4QYLA 4LDFA 4UYDA 5L8TA 4QR3A 4O70A 3LQIA 5LUUA 4BHWA 2H60A 3FKMX 2OUOA 3U5MA 4YBSA 5IGMA 5A5NA 3U5NA 5LJ1A 2E7OA 5F36A 4YY6A 5I40A 5LVRA 4UYHA 5CY9A 5K29A 2YEMA 4NUCA 3NXBA 4MR3A 4PS5A 4YH3A 3I3JA 3P1EA 5ENEA 4IR3A 4PY6A 2F6NA 5EWVA 2G4AA 3O36A 2D9EA 4BJXA 4DONA 3MULA 4QZSA 4CLBA 5AMEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IOO A;  5C7N A;  4HXO A;  5ENG A;  2YQD A;  1JM4 B;  5LJ0 A;  4Y03 A;  5F2P A;  5DKD A;  4XY9 A;  5L97 A;  4PCE A;  4CUT A;  3S92 A;  4NR7 A;  4WHU A;  4CUP A;  5HRW A;  4O7C A;  5CRZ A;  5E9V A;  5FE3 A;  5I80 A;  5CFW A;  2DVS A;  2R0V A;  3G0J A;  3LJW A;  4N4I A;  4TZ8 A;  4HXM A;  4UIV A;  5FE0 A;  5D3H A;  2MJV B;  3U5P A;  5DKC A;  3IU5 A;  3MB3 A;  4TT2 A;  5EIS A;  3JVK A;  3JVL A;  4RVR A;  5DBM A;  2WP2 A;  5IGK A;  5F5Z A;  2YEK A;  4UYF A;  4XYA A;  4UYE A;  5FE2 A;  3JVJ A;  5A83 A;  4YYG A;  5F60 A;  5E0R A;  5CZG A;  5C4Q A;  5F3A A;  5I88 A;  2RI7 A;  4MR5 A;  5ETD A;  4PTB A;  5FDZ A;  3P1F A;  2RFJ A;  5DW2 A;  5I89 A;  5CP5 A;  4A9M A;  3QZV A;  5A7C A;  4A9J A;  4Z6I A;  4QSS A;  3S91 A;  4LYI A;  2R0S A;  5F1H A;  5IGL A;  5HQ6 A;  5HQ5 A;  4NR8 A;  5HRX A;  5IGN A;  3O37 A;  5CQ6 A;  3G0L A;  5CUE A;  5H1V A;  5EWH A;  4NR4 A;  1E6I A;  4FLP A;  2RS9 B;  3AAD A;  5FE6 A;  2DKW A;  5ACY A;  5DX4 A;  5EWD A;  3SVF A;  5A81 A;  3UVY A;  5E3G A;  5ENC A;  4Z93 A;  2YDW A;  4QY4 A;  5HRV A;  5H1T A;  4BW4 A;  5DYC A;  4YY4 A;  1X0J A;  4HXK A;  5F61 A;  5CPE A;  4TT4 A;  5FH6 A;  2I7K A;  4YAB A;  5EVA A;  2NXB A;  4A9I A;  5D3T A;  4X2I A;  4HXR A;  5HQ7 A;  2E3K A;  3MB4 A;  3P1C A;  4O76 A;  5H1U A;  4UYF B;  5L99 A;  5D3S A;  4QEV A;  5CUC A;  5ENB A;  4UIT A;  4O72 A;  4NR5 A;  4CUR A;  5E73 A;  2GRC A;  1JSP B;  5CQA A;  4NUE A;  3U5O A;  4Z6H A;  5EWC A;  4QBM A;  5FH8 A;  5EIC A;  4ZQL A;  5LKT A;  5FG6 A;  2I8N A;  4Z1Q A;  4BW3 A;  5AD3 A;  1N72 A;  3LQH A;  3LXJ A;  5KU3 A;  4LR6 A;  3HME A;  5E9M A;  4UYG A;  4CUS A;  5CUB A;  4QC1 A;  4NR6 A;  5FE5 A;  4NRB A;  5D3N A;  5FB0 A;  5CQ4 A;  4ALG A;  3AQA A;  4Q0O A;  3MXF A;  4J1P A;  5H85 A;  5A5P A;  3RCW A;  4MEN A;  3UW9 A;  5C87 A;  5EGU A;  3UVD A;  4OGI A;  2OO1 A;  5JI8 A;  4TTE A;  5HCL A;  4YYD A;  4MR4 A;  4Q0N A;  5EPR A;  4QSW A;  1WUG A;  4A9N A;  4C67 A;  4GPJ A;  5KTX A;  5DKH A;  5IID A;  4UIU A;  4OGJ A;  3DAI A;  4YC9 A;  5KTU A;  4QEU A;  5A82 A;  4LZ2 A;  5LKZ A;  2KTB B;  5KTW A;  4QC3 A;  4YYH A;  3HMF A;  4KV1 A;  3D7C A;  2L85 A;  4O7A A;  4N4F A;  2R10 A;  4A9K A;  5TB6 A;  4O71 A;  5I1Q A;  5I86 A;  5ENJ A;  4CUU A;  4J3I A;  4LYW A;  4NRA A;  2RO1 A;  5DYX A;  3K2J A;  5D0C A;  5HEL A;  4MEQ A;  4KCX A;  5CGP A;  4QYD A;  5AMF A;  3LQJ A;  5C89 A;  5II1 A;  3UV4 A;  4XUA A;  5LJ2 A;  4QEW A;  5BT4 A;  5A5R A;  3QZT A;  3SVH A;  5JWM A;  5LVQ A;  4MEO A;  3UVX A;  4HBY A;  5HLS A;  5CQ7 A;  2DWW A;  5C85 A;  5FB1 A;  5A85 A;  2R0Y A;  3O33 A;  4HXL A;  3QZS A;  4YBT A;  2LSP B;  4YYN A;  5DFB A;  5HFQ A;  4QUT A;  4YAD A;  4YYJ A;  1WUM A;  5BT3 A;  3UVW A;  3UV5 A;  4O78 A;  4O7B A;  5HM0 A;  4QSR A;  4A9E A;  5FE9 A;  4NYV A;  4HBV A;  3U5J A;  4YYI A;  2E7N A;  5C8G A;  4HXP A;  5G4R A;  5IG6 A;  5F62 A;  3U5K A;  4NXJ A;  4A9H A;  2D82 A;  5BT5 A;  2WP1 A;  5CTL A;  4QR5 A;  5D3R A;  5FFV A;  5L8U A;  4YH4 A;  5CRM A;  5EU1 A;  3SVG A;  5ENI A;  5CUG A;  5E3D A;  2DVR A;  4MR6 A;  4XY8 A;  5II2 A;  4NQM A;  5CS8 A;  5EP7 A;  5J0D A;  5FFW A;  5E7D A;  4PKL A;  4A9F A;  5D24 A;  5L98 A;  1F68 A;  4N4G A;  5D3L A;  5IBN A;  4Z1S A;  4E96 A;  5A5Q A;  5CQ5 A;  4YYM A;  5CUA A;  5EA1 A;  4QST A;  2RNY A;  5D3J A;  4UIW A;  4TZ2 A;  5E9Y A;  5CUD A;  4CFL A;  4NYW A;  5I29 A;  4LC2 A;  1EQF A;  4LZR A;  5A5O A;  5HEM A;  4O77 A;  2OSS A;  4OUF A;  3GG3 A;  5FE4 A;  4QB3 A;  4O7E A;  5E74 A;  3Q2E A;  4YYK A;  4IOR A;  5DFD A;  4HXN A;  4A9L A;  5EWW A;  4QUU A;  5G4S A;  4KV4 A;  2RNX A;  2RNW A;  4O74 A;  4A9O A;  5D7X A;  4ZC9 A;  3MUK A;  4XUB A;  4F3I A;  5CQ3 A;  5D26 A;  4YAX A;  5L96 A;  2N9G A;  5EV9 A;  5FE1 A;  4AKN A;  4CL9 A;  4LZS A;  3Q2F A;  4ZW1 A;  4NYX A;  5COI A;  2DAT A;  4NUD A;  3IU6 A;  4UIZ A;  4NR9 A;  5DYA A;  5AD2 A;  2YEL A;  4NRC A;  5LKX A;  5D25 A;  4PCI A;  5EK9 A;  4O7F A;  5ENH A;  4YAT A;  5DW1 A;  5EQ1 A;  4QR4 A;  4N3W A;  4HBX A;  5DLZ A;  4CFK A;  3ONI A;  3HMH A;  5E9K A;  4QSP A;  5FH7 A;  3MQM A;  3DWY A;  4QSU A;  2DVV A;  2F6J A;  4BW1 A;  4WIV A;  4TT6 A;  5TCM A;  5I83 A;  5F63 A;  3O34 A;  4ALH A;  4TQN A;  4CUQ A;  5HJC A;  4NS5 A;  5DY7 A;  4WHW A;  4TYL A;  5CQT A;  4LRG A;  4IOQ A;  4HBW A;  5HEN A;  4C66 A;  4IR4 A;  3JVM A;  5FG5 A;  5KO4 A;  5ENF A;  4IR6 A;  5E9L A;  1ZS5 A;  3P1D A;  3P5O A;  4QSQ A;  5I7X A;  5F25 A;  2FSA A;  2L84 A;  5CQ8 A;  5DYU A;  5KHM A;  5EPB A;  5FE8 A;  3UV2 A;  4MEP A;  4N4H A;  4IR5 A;  5HFR A;  5EI4 A;  3TLP A;  2YW5 A;  4TU4 A;  5FG4 A;  5ETB A;  5FBX A;  2YYN A;  4QSV A;  4HXS A;  5EM3 A;  4NQN A;  5E9I A;  3ZYU A;  4TS8 A;  4LYS A;  5FFY A;  2L5E A;  5I7Y A;  4UIX A;  5CU8 A;  4O75 A;  5F1L A;  4J0S A;  3U5L A;  5FE7 A;  2DVQ A;  4BW2 A;  4UIY A;  5LKU A;  4YBM A;  4YK0 A;  3O35 A;  5DLX A;  5A5S A;  4QNS A;  4QSX A;  5D3P A;  5EPS A;  4TU6 A;  5DFC A;  4J0R A;  4QYL A;  4LDF A;  4UYD A;  5L8T A;  4QR3 A;  4O70 A;  3LQI A;  5LUU A;  4BHW A;  2H60 A;  3FKM X;  2OUO A;  3U5M A;  4YBS A;  5IGM A;  5A5N A;  3U5N A;  5LJ1 A;  2E7O A;  5F36 A;  4YY6 A;  5I40 A;  5LVR A;  4UYH A;  5CY9 A;  5K29 A;  2YEM A;  4NUC A;  3NXB A;  4MR3 A;  4PS5 A;  4YH3 A;  3I3J A;  3P1E A;  5ENE A;  4IR3 A;  4PY6 A;  2F6N A;  5EWV A;  2G4A A;  3O36 A;  2D9E A;  4BJX A;  4DON A;  3MUL A;  4QZS A;  4CLB A;  5AME A; 
#chains in the Genus database with same CATH topology
 4IOO A;  5C7N A;  4HXO A;  5ENG A;  2YQD A;  1JM4 B;  5LJ0 A;  4Y03 A;  5F2P A;  5DKD A;  4XY9 A;  5L97 A;  4PCE A;  4CUT A;  3S92 A;  4NR7 A;  4WHU A;  4CUP A;  5HRW A;  4O7C A;  5CRZ A;  5E9V A;  5FE3 A;  5I80 A;  5CFW A;  2DVS A;  2R0V A;  3G0J A;  3LJW A;  4N4I A;  4TZ8 A;  4HXM A;  4UIV A;  5FE0 A;  5D3H A;  2MJV B;  3U5P A;  5DKC A;  3IU5 A;  3MB3 A;  4TT2 A;  5EIS A;  3JVK A;  3JVL A;  4RVR A;  5DBM A;  2WP2 A;  5IGK A;  5F5Z A;  2YEK A;  4UYF A;  4XYA A;  4UYE A;  5FE2 A;  3JVJ A;  5A83 A;  4YYG A;  5F60 A;  5E0R A;  5CZG A;  5C4Q A;  5F3A A;  5I88 A;  2RI7 A;  4MR5 A;  5ETD A;  4PTB A;  5FDZ A;  3P1F A;  2RFJ A;  5DW2 A;  5I89 A;  5CP5 A;  4A9M A;  3QZV A;  5A7C A;  4A9J A;  4Z6I A;  4QSS A;  3S91 A;  4LYI A;  2R0S A;  5F1H A;  5IGL A;  5HQ6 A;  5HQ5 A;  4NR8 A;  5HRX A;  5IGN A;  3O37 A;  5CQ6 A;  3G0L A;  5CUE A;  5H1V A;  5EWH A;  4NR4 A;  1E6I A;  4FLP A;  2RS9 B;  3AAD A;  5FE6 A;  2DKW A;  5ACY A;  5DX4 A;  5EWD A;  3SVF A;  5A81 A;  2EJN A;  3UVY A;  5E3G A;  5ENC A;  2YDW A;  4QY4 A;  4Z93 A;  5HRV A;  5H1T A;  4BW4 A;  5DYC A;  4YY4 A;  1X0J A;  4HXK A;  5F61 A;  5CPE A;  4TT4 A;  5FH6 A;  2I7K A;  4YAB A;  5EVA A;  2NXB A;  4A9I A;  5D3T A;  4X2I A;  4HXR A;  5HQ7 A;  2E3K A;  3MB4 A;  3P1C A;  1PUO A;  4O76 A;  5H1U A;  4UYF B;  5L99 A;  5D3S A;  3VKG A;  4QEV A;  5CUC A;  5ENB A;  3D1B A;  4UIT A;  4O72 A;  4NR5 A;  4CUR A;  5E73 A;  2GRC A;  1JSP B;  5CQA A;  4NUE A;  3U5O A;  4Z6H A;  5EWC A;  4QBM A;  5FH8 A;  5EIC A;  4ZQL A;  5LKT A;  5FG6 A;  2I8N A;  4Z1Q A;  4BW3 A;  5AD3 A;  1N72 A;  3LQH A;  3LXJ A;  5KU3 A;  4LR6 A;  3HME A;  5E9M A;  4UYG A;  4CUS A;  5CUB A;  4QC1 A;  4NR6 A;  5FE5 A;  4NRB A;  5D3N A;  5FB0 A;  5CQ4 A;  4ALG A;  3AQA A;  4Q0O A;  3MXF A;  4J1P A;  5H85 A;  5A5P A;  3RCW A;  4MEN A;  3UW9 A;  5C87 A;  5EGU A;  3UVD A;  4OGI A;  2OO1 A;  3ERR A;  5JI8 A;  4TTE A;  5HCL A;  4YYD A;  4MR4 A;  4Q0N A;  5EPR A;  4QSW A;  1WUG A;  4A9N A;  4C67 A;  4GPJ A;  5KTX A;  5DKH A;  5IID A;  4UIU A;  4OGJ A;  3DAI A;  4YC9 A;  5KTU A;  4QEU A;  5A82 A;  4LZ2 A;  5LKZ A;  2KTB B;  5KTW A;  4QC3 A;  4YYH A;  3HMF A;  4KV1 A;  3D7C A;  2L85 A;  4O7A A;  4N4F A;  2R10 A;  4A9K A;  5TB6 A;  4O71 A;  5I1Q A;  5I86 A;  5ENJ A;  4CUU A;  4J3I A;  4LYW A;  4NRA A;  2RO1 A;  5DYX A;  3K2J A;  5D0C A;  5HEL A;  4MEQ A;  4KCX A;  5CGP A;  4QYD A;  5AMF A;  3LQJ A;  5C89 A;  5II1 A;  3UV4 A;  4XUA A;  5LJ2 A;  4QEW A;  5BT4 A;  5A5R A;  3QZT A;  3SVH A;  5JWM A;  5LVQ A;  4MEO A;  3UVX A;  4HBY A;  5HLS A;  5CQ7 A;  2DWW A;  5C85 A;  5FB1 A;  5A85 A;  2R0Y A;  3VKH A;  3O33 A;  4HXL A;  3QZS A;  4YBT A;  2LSP B;  4YYN A;  5DFB A;  5HFQ A;  4QUT A;  4YAD A;  4YYJ A;  1WUM A;  5BT3 A;  3UVW A;  3UV5 A;  4O78 A;  4O7B A;  5HM0 A;  4QSR A;  4A9E A;  5FE9 A;  4NYV A;  4HBV A;  3U5J A;  4YYI A;  2E7N A;  5C8G A;  4HXP A;  5G4R A;  5IG6 A;  5F62 A;  3U5K A;  4NXJ A;  4A9H A;  2D82 A;  4AI6 A;  5BT5 A;  2WP1 A;  5CTL A;  4QR5 A;  5D3R A;  5FFV A;  5L8U A;  4AKG A;  4YH4 A;  5CRM A;  5EU1 A;  3SVG A;  5ENI A;  5CUG A;  5E3D A;  2DVR A;  1ZKR A;  4MR6 A;  4XY8 A;  5II2 A;  4NQM A;  5CS8 A;  5EP7 A;  5J0D A;  5FFW A;  5E7D A;  4PKL A;  4A9F A;  5D24 A;  5L98 A;  1F68 A;  4AKH A;  4N4G A;  5D3L A;  5IBN A;  4Z1S A;  4E96 A;  5A5Q A;  5CQ5 A;  4YYM A;  5CUA A;  5EA1 A;  4QST A;  2RNY A;  4AKI A;  5D3J A;  4UIW A;  4TZ2 A;  5E9Y A;  5CUD A;  4CFL A;  4NYW A;  5I29 A;  4LC2 A;  1EQF A;  4LZR A;  5A5O A;  5HEM A;  4O77 A;  2OSS A;  4OUF A;  3GG3 A;  5FE4 A;  4QB3 A;  4O7E A;  5E74 A;  3Q2E A;  4YYK A;  4IOR A;  5DFD A;  4HXN A;  4A9L A;  5EWW A;  4QUU A;  5G4S A;  4KV4 A;  2RNX A;  2RNW A;  4O74 A;  4A9O A;  5D7X A;  4ZC9 A;  3MUK A;  4XUB A;  4F3I A;  5CQ3 A;  5D26 A;  4YAX A;  5L96 A;  2N9G A;  5EV9 A;  5FE1 A;  4AKN A;  4CL9 A;  4LZS A;  3Q2F A;  4ZW1 A;  4NYX A;  5COI A;  2DAT A;  4NUD A;  3IU6 A;  4UIZ A;  4NR9 A;  5DYA A;  5AD2 A;  2YEL A;  4NRC A;  5LKX A;  5D25 A;  4PCI A;  5EK9 A;  4O7F A;  5ENH A;  4YAT A;  5DW1 A;  5EQ1 A;  4QR4 A;  4N3W A;  4HBX A;  5DLZ A;  4CFK A;  3ONI A;  3HMH A;  5E9K A;  4QSP A;  5FH7 A;  3MQM A;  3DWY A;  4QSU A;  2DVV A;  2F6J A;  4BW1 A;  4WIV A;  4TT6 A;  5TCM A;  5I83 A;  5F63 A;  3O34 A;  4ALH A;  4TQN A;  3D1D A;  4CUQ A;  5HJC A;  4NS5 A;  5DY7 A;  4WHW A;  4TYL A;  5CQT A;  4LRG A;  4IOQ A;  4HBW A;  5HEN A;  4C66 A;  4IR4 A;  3JVM A;  5FG5 A;  5KO4 A;  5ENF A;  4IR6 A;  5E9L A;  1ZS5 A;  3P1D A;  3P5O A;  4QSQ A;  5I7X A;  5F25 A;  2FSA A;  2L84 A;  5CQ8 A;  5DYU A;  5KHM A;  5EPB A;  5FE8 A;  3UV2 A;  4MEP A;  4N4H A;  4IR5 A;  5HFR A;  5EI4 A;  3TLP A;  2YW5 A;  4TU4 A;  5FG4 A;  5ETB A;  5FBX A;  2YYN A;  4QSV A;  4HXS A;  5EM3 A;  4NQN A;  5E9I A;  3ZYU A;  4TS8 A;  4LYS A;  5FFY A;  2L5E A;  5I7Y A;  4UIX A;  5CU8 A;  4O75 A;  5F1L A;  4J0S A;  3U5L A;  5FE7 A;  2DVQ A;  4BW2 A;  4UIY A;  5LKU A;  4YBM A;  4YK0 A;  3O35 A;  5DLX A;  5A5S A;  4QNS A;  4QSX A;  5D3P A;  5EPS A;  4TU6 A;  5DFC A;  4J0R A;  4QYL A;  4LDF A;  4UYD A;  5L8T A;  4QR3 A;  4O70 A;  3LQI A;  5LUU A;  4BHW A;  2H60 A;  3FKM X;  2OUO A;  3U5M A;  4YBS A;  5IGM A;  5A5N A;  3U5N A;  5LJ1 A;  2E7O A;  5F36 A;  4YY6 A;  5I40 A;  5LVR A;  4UYH A;  5CY9 A;  5K29 A;  2YEM A;  4NUC A;  3NXB A;  4MR3 A;  4PS5 A;  4YH3 A;  3I3J A;  3P1E A;  5ENE A;  4IR3 A;  4PY6 A;  2F6N A;  5EWV A;  2G4A A;  3O36 A;  2D9E A;  4BJX A;  4DON A;  3MUL A;  4QZS A;  4CLB A;  5AME A; 
#chains in the Genus database with same CATH homology
 4IOO A;  5C7N A;  4HXO A;  5ENG A;  2YQD A;  1JM4 B;  5LJ0 A;  4Y03 A;  5F2P A;  5DKD A;  4XY9 A;  5L97 A;  4PCE A;  4CUT A;  3S92 A;  4NR7 A;  4WHU A;  4CUP A;  5HRW A;  4O7C A;  5CRZ A;  5E9V A;  5FE3 A;  5I80 A;  5CFW A;  2DVS A;  2R0V A;  3G0J A;  3LJW A;  4N4I A;  4TZ8 A;  4HXM A;  4UIV A;  5FE0 A;  5D3H A;  2MJV B;  3U5P A;  5DKC A;  3IU5 A;  3MB3 A;  4TT2 A;  5EIS A;  3JVK A;  3JVL A;  4RVR A;  5DBM A;  2WP2 A;  5IGK A;  5F5Z A;  2YEK A;  4UYF A;  4XYA A;  4UYE A;  5FE2 A;  3JVJ A;  5A83 A;  4YYG A;  5F60 A;  5E0R A;  5CZG A;  5C4Q A;  5F3A A;  5I88 A;  2RI7 A;  4MR5 A;  5ETD A;  4PTB A;  5FDZ A;  3P1F A;  2RFJ A;  5DW2 A;  5I89 A;  5CP5 A;  4A9M A;  3QZV A;  5A7C A;  4A9J A;  4Z6I A;  4QSS A;  3S91 A;  4LYI A;  2R0S A;  5F1H A;  5IGL A;  5HQ6 A;  5HQ5 A;  4NR8 A;  5HRX A;  5IGN A;  3O37 A;  5CQ6 A;  3G0L A;  5CUE A;  5H1V A;  5EWH A;  4NR4 A;  1E6I A;  4FLP A;  2RS9 B;  3AAD A;  5FE6 A;  2DKW A;  5ACY A;  5DX4 A;  5EWD A;  3SVF A;  5A81 A;  3UVY A;  5E3G A;  5ENC A;  4Z93 A;  2YDW A;  4QY4 A;  5HRV A;  5H1T A;  4BW4 A;  5DYC A;  4YY4 A;  1X0J A;  4HXK A;  5F61 A;  5CPE A;  4TT4 A;  5FH6 A;  2I7K A;  4YAB A;  5EVA A;  2NXB A;  4A9I A;  5D3T A;  4X2I A;  4HXR A;  5HQ7 A;  2E3K A;  3MB4 A;  3P1C A;  4O76 A;  5H1U A;  4UYF B;  5L99 A;  5D3S A;  4QEV A;  5CUC A;  5ENB A;  4UIT A;  4O72 A;  4NR5 A;  4CUR A;  5E73 A;  2GRC A;  1JSP B;  5CQA A;  4NUE A;  3U5O A;  4Z6H A;  5EWC A;  4QBM A;  5FH8 A;  5EIC A;  4ZQL A;  5LKT A;  5FG6 A;  2I8N A;  4Z1Q A;  4BW3 A;  5AD3 A;  1N72 A;  3LQH A;  3LXJ A;  5KU3 A;  4LR6 A;  3HME A;  5E9M A;  4UYG A;  4CUS A;  5CUB A;  4QC1 A;  4NR6 A;  5FE5 A;  4NRB A;  5D3N A;  5FB0 A;  5CQ4 A;  4ALG A;  3AQA A;  4Q0O A;  3MXF A;  4J1P A;  5H85 A;  5A5P A;  3RCW A;  4MEN A;  3UW9 A;  5C87 A;  5EGU A;  3UVD A;  4OGI A;  2OO1 A;  5JI8 A;  4TTE A;  5HCL A;  4YYD A;  4MR4 A;  4Q0N A;  5EPR A;  4QSW A;  1WUG A;  4A9N A;  4C67 A;  4GPJ A;  5KTX A;  5DKH A;  5IID A;  4UIU A;  4OGJ A;  3DAI A;  4YC9 A;  5KTU A;  4QEU A;  5A82 A;  4LZ2 A;  5LKZ A;  2KTB B;  5KTW A;  4QC3 A;  4YYH A;  3HMF A;  4KV1 A;  3D7C A;  2L85 A;  4O7A A;  4N4F A;  2R10 A;  4A9K A;  5TB6 A;  4O71 A;  5I1Q A;  5I86 A;  5ENJ A;  4CUU A;  4J3I A;  4LYW A;  4NRA A;  2RO1 A;  5DYX A;  3K2J A;  5D0C A;  5HEL A;  4MEQ A;  4KCX A;  5CGP A;  4QYD A;  5AMF A;  3LQJ A;  5C89 A;  5II1 A;  3UV4 A;  4XUA A;  5LJ2 A;  4QEW A;  5BT4 A;  5A5R A;  3QZT A;  3SVH A;  5JWM A;  5LVQ A;  4MEO A;  3UVX A;  4HBY A;  5HLS A;  5CQ7 A;  2DWW A;  5C85 A;  5FB1 A;  5A85 A;  2R0Y A;  3O33 A;  4HXL A;  3QZS A;  4YBT A;  2LSP B;  4YYN A;  5DFB A;  5HFQ A;  4QUT A;  4YAD A;  4YYJ A;  1WUM A;  5BT3 A;  3UVW A;  3UV5 A;  4O78 A;  4O7B A;  5HM0 A;  4QSR A;  4A9E A;  5FE9 A;  4NYV A;  4HBV A;  3U5J A;  4YYI A;  2E7N A;  5C8G A;  4HXP A;  5G4R A;  5IG6 A;  5F62 A;  3U5K A;  4NXJ A;  4A9H A;  2D82 A;  5BT5 A;  2WP1 A;  5CTL A;  4QR5 A;  5D3R A;  5FFV A;  5L8U A;  4YH4 A;  5CRM A;  5EU1 A;  3SVG A;  5ENI A;  5CUG A;  5E3D A;  2DVR A;  4MR6 A;  4XY8 A;  5II2 A;  4NQM A;  5CS8 A;  5EP7 A;  5J0D A;  5FFW A;  5E7D A;  4PKL A;  4A9F A;  5D24 A;  5L98 A;  1F68 A;  4N4G A;  5D3L A;  5IBN A;  4Z1S A;  4E96 A;  5A5Q A;  5CQ5 A;  4YYM A;  5CUA A;  5EA1 A;  4QST A;  2RNY A;  5D3J A;  4UIW A;  4TZ2 A;  5E9Y A;  5CUD A;  4CFL A;  4NYW A;  5I29 A;  4LC2 A;  1EQF A;  4LZR A;  5A5O A;  5HEM A;  4O77 A;  2OSS A;  4OUF A;  3GG3 A;  5FE4 A;  4QB3 A;  4O7E A;  5E74 A;  3Q2E A;  4YYK A;  4IOR A;  5DFD A;  4HXN A;  4A9L A;  5EWW A;  4QUU A;  5G4S A;  4KV4 A;  2RNX A;  2RNW A;  4O74 A;  4A9O A;  5D7X A;  4ZC9 A;  3MUK A;  4XUB A;  4F3I A;  5CQ3 A;  5D26 A;  4YAX A;  5L96 A;  2N9G A;  5EV9 A;  5FE1 A;  4AKN A;  4CL9 A;  4LZS A;  3Q2F A;  4ZW1 A;  4NYX A;  5COI A;  2DAT A;  4NUD A;  3IU6 A;  4UIZ A;  4NR9 A;  5DYA A;  5AD2 A;  2YEL A;  4NRC A;  5LKX A;  5D25 A;  4PCI A;  5EK9 A;  4O7F A;  5ENH A;  4YAT A;  5DW1 A;  5EQ1 A;  4QR4 A;  4N3W A;  4HBX A;  5DLZ A;  4CFK A;  3ONI A;  3HMH A;  5E9K A;  4QSP A;  5FH7 A;  3MQM A;  3DWY A;  4QSU A;  2DVV A;  2F6J A;  4BW1 A;  4WIV A;  4TT6 A;  5TCM A;  5I83 A;  5F63 A;  3O34 A;  4ALH A;  4TQN A;  4CUQ A;  5HJC A;  4NS5 A;  5DY7 A;  4WHW A;  4TYL A;  5CQT A;  4LRG A;  4IOQ A;  4HBW A;  5HEN A;  4C66 A;  4IR4 A;  3JVM A;  5FG5 A;  5KO4 A;  5ENF A;  4IR6 A;  5E9L A;  1ZS5 A;  3P1D A;  3P5O A;  4QSQ A;  5I7X A;  5F25 A;  2FSA A;  2L84 A;  5CQ8 A;  5DYU A;  5KHM A;  5EPB A;  5FE8 A;  3UV2 A;  4MEP A;  4N4H A;  4IR5 A;  5HFR A;  5EI4 A;  3TLP A;  2YW5 A;  4TU4 A;  5FG4 A;  5ETB A;  5FBX A;  2YYN A;  4QSV A;  4HXS A;  5EM3 A;  4NQN A;  5E9I A;  3ZYU A;  4TS8 A;  4LYS A;  5FFY A;  2L5E A;  5I7Y A;  4UIX A;  5CU8 A;  4O75 A;  5F1L A;  4J0S A;  3U5L A;  5FE7 A;  2DVQ A;  4BW2 A;  4UIY A;  5LKU A;  4YBM A;  4YK0 A;  3O35 A;  5DLX A;  5A5S A;  4QNS A;  4QSX A;  5D3P A;  5EPS A;  4TU6 A;  5DFC A;  4J0R A;  4QYL A;  4LDF A;  4UYD A;  5L8T A;  4QR3 A;  4O70 A;  3LQI A;  5LUU A;  4BHW A;  2H60 A;  3FKM X;  2OUO A;  3U5M A;  4YBS A;  5IGM A;  5A5N A;  3U5N A;  5LJ1 A;  2E7O A;  5F36 A;  4YY6 A;  5I40 A;  5LVR A;  4UYH A;  5CY9 A;  5K29 A;  2YEM A;  4NUC A;  3NXB A;  4MR3 A;  4PS5 A;  4YH3 A;  3I3J A;  3P1E A;  5ENE A;  4IR3 A;  4PY6 A;  2F6N A;  5EWV A;  2G4A A;  3O36 A;  2D9E A;  4BJX A;  4DON A;  3MUL A;  4QZS A;  4CLB A;  5AME A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...