5ENIA

Crystal structure of the second bromodomain of pleckstrin homology domain interacting protein (phip) in complex with compound-13 n11537 (sgc - diamond i04-1 fragment screening)
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
123
structure length
123
Chain Sequence
SMSYDIQAWKKQCEELLNLIFQCEDSEPFRQPVDLLEYPDYRDIIDTPMDFATVRETLEAGNYESPMELCKDVRLIFSNSKAYTPSKRSRIYSMSLRLSAFFEEHISSVLSDYKSALRFHKRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PH-interacting protein
publication title A poised fragment library enables rapid synthetic expansion yielding the first reported inhibitors of PHIP(2), an atypical bromodomain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 46
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2015-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5eniA00
5EM3A 3D7CA 3FKMX 5H1TA 4NUCA 4PS5A 4TU6A 4IOQA 5DBMA 4TZ2A 5AD2A 5HQ5A 5IGMA 2DVQA 4HBWA 5FB1A 5FB0A 5KTUA 4A9FA 4UIVA 3AADA 5F60A 5A7CA 4TQNA 5EA1A 4UYDA 2FSAA 4QY4A 5II2A 5KO4A 5CTLA 2I7KA 4BW1A 4NXJA 5CUDA 4NRCA 5CFWA 5FH6A 4PKLA 5E73A 5CGPA 5EPBA 4IR4A 2OUOA 5EWDA 4TT2A 5CU8A 5H85A 4O7EA 5H1UA 5HRVA 5CPEA 4LYIA 2RO1A 4NUEA 4YY6A 2DVRA 3UVYA 2WP2A 4HXMA 5ENJA 2R10A 4MEPA 4NR7A 3JVJA 5ENEA 5EQ1A 4PTBA 5D3JA 5HQ7A 4A9HA 5EP7A 2OSSA 5D7XA 5AMEA 4O74A 5FE9A 3UW9A 3MUKA 5FE5A 5ENFA 5F2PA 4A9NA 4J0SA 4TS8A 3GG3A 4NYWA 5EPRA 3I3JA 4O7FA 5CUEA 4LYWA 5DFDA 4A9JA 5E9YA 4QR3A 4BW2A 4NYXA 2KTBB 5HRXA 3SVFA 4O72A 3O37A 5EPSA 5F1HA 4CFLA 5LJ2A 5LUUA 4LZSA 4TT6A 5I83A 2L5EA 5C8GA 5D0CA 5D3RA 5D3HA 5JI8A 4OGIA 3HMHA 5CQ5A 2E7OA 4CUUA 5A5QA 4Z1QA 1WUGA 5F62A 4YADA 5E3DA 5EVAA 4MR5A 5DKDA 4PCIA 4ZW1A 5F3AA 5D3SA 4N3WA 4NR9A 4LR6A 4WHUA 5FE0A 4Y03A 5A5NA 4YYHA 3O33A 1E6IA 4LDFA 2RNXA 4IOOA 4N4HA 5CS8A 5A85A 3LQIA 3P1FA 4NQMA 4CL9A 5ENBA 4YYJA 4NQNA 4IR5A 4O7BA 4O7CA 3UVWA 4KCXA 5FG4A 2D82A 5LKTA 5L97A 2F6NA 3UV5A 5EV9A 5BT4A 5A83A 4XUBA 5DX4A 4UIYA 4QSSA 4PCEA 5IIDA 2YQDA 2DVSA 5LJ1A 5DFBA 1N72A 3Q2FA 4YBSA 5CZGA 4HXLA 4PY6A 5L8TA 4QUUA 5HJCA 5IGLA 3G0LA 4NR4A 3IU5A 5DLXA 5LKUA 4OGJA 3MB4A 4A9MA 5CQ6A 1JM4B 5I1QA 4YC9A 5FFVA 5ETDA 5CUAA 4IR3A 4O76A 4UYHA 5KHMA 5I80A 2G4AA 4QZSA 3QZVA 4YYIA 5IGNA 4N4FA 5I40A 2L84A 3QZTA 4A9LA 4YAXA 4TTEA 4C66A 4UIXA 4FLPA 4A9EA 4NR8A 5HLSA 4TYLA 5CUGA 5ENHA 4QSWA 5CUCA 5ENCA 4HBYA 5CQ4A 4GPJA 4X2IA 4TZ8A 3AQAA 3K2JA 1JSPB 2I8NA 4N4GA 4UITA 5HM0A 4YYDA 5E9KA 4UYFB 3JVKA 5ENGA 5E9MA 5C85A 4CLBA 5F1LA 4XYAA 4LC2A 5D25A 4QYDA 5IBNA 4QB3A 5E9IA 2D9EA 2E3KA 5II1A 2RS9B 4QSXA 2RNYA 4QR4A 2YYNA 4Q0NA 4NR5A 4ALGA 5I86A 3U5OA 5D3TA 5FG5A 3ZYUA 5KU3A 4TU4A 2RFJA 4YY4A 4XY8A 5C87A 3U5PA 4ZQLA 3LXJA 3S92A 4QSTA 5DYXA 4CFKA 5D3LA 3P1EA 5HELA 5CQ7A 3LJWA 4O70A 3P1CA 1F68A 5DW1A 5HFRA 3UV4A 2RNWA 5A5SA 5CRZA 5FG6A 4QC1A 4ALHA 5E0RA 4QR5A 5COIA 4O77A 5I88A 5G4SA 4HXOA 2OO1A 4XUAA 5ETBA 3DAIA 4MR3A 5E9LA 4LRGA 5HENA 1EQFA 2DATA 5I7XA 5A5RA 5AMFA 5CP5A 5LVRA 3U5LA 2N9GA 4DONA 4WIVA 5TB6A 4Z6HA 4NRBA 3P1DA 5CY9A 5DKCA 5EICA 3NXBA 4LYSA 5A5PA 4QEUA 5E9VA 5DFCA 4YYKA 3O35A 5L8UA 5F36A 4NYVA 4A9KA 4Z1SA 5F63A 2R0VA 5FE1A 4QC3A 3DWYA 4A9IA 4A9OA 4UYGA 2YEMA 5JWMA 5H1VA 5C4QA 5CQAA 5I7YA 3UV2A 2GRCA 3RCWA 5E74A 4HXNA 5HQ6A 4CUTA 1ZS5A 5FE4A 4CUPA 4QSVA 4UIWA 2E7NA 4HXKA 4LZRA 5FH7A 2R0YA 4YBMA 5KTWA 4NR6A 4O7AA 4Q0OA 5EWWA 3TLPA 4YH4A 4BJXA 5FE8A 5L98A 3LQHA 5D3PA 4YATA 3UVDA 4WHWA 5LKZA 4YK0A 5D26A 5CQ8A 5FH8A 5DW2A 5HEMA 5LVQA 4N4IA 4O75A 5FE7A 3SVHA 4QYLA 5DY7A 5DLZA 5E7DA 4UIZA 3MQMA 5HFQA 2YW5A 2NXBA 3MXFA 1WUMA 5F5ZA 5K29A 4YBTA 5ENIA 5E3GA 4QSRA 2H60A 4MR4A 3UVXA 5CQTA 4HBXA 4QEVA 5F61A 5IG6A 4BW3A 5DYUA 5DKHA 4QUTA 5AD3A 5EGUA 4IR6A 1X0JA 5FE3A 4QNSA 5A81A 5CQ3A 5C7NA 3MULA 3O36A 5ACYA 5BT3A 5EWVA 4LZ2A 5A5OA 3O34A 3U5KA 4UIUA 4CUSA 4QEWA 5FFWA 3ONIA 3U5NA 4CURA 4J0RA 4CUQA 3U5MA 2MJVB 4YYGA 5L99A 5I29A 5FE6A 2R0SA 2RI7A 5L96A 5IGKA 2DWWA 5DYAA 4HXSA 3SVGA 4QBMA 2YEKA 3P5OA 5KTXA 5I89A 4J1PA 2DKWA 4J3IA 5FBXA 4MEOA 2YDWA 5EI4A 2LSPB 4HXRA 5D3NA 4QSPA 5FE2A 5EISA 5BT5A 3HMFA 4XY9A 3Q2EA 4Z93A 5G4RA 5A82A 5TCMA 5LKXA 5CUBA 5C89A 4UYFA 5D24A 4C67A 2WP1A 4MR6A 4HXPA 5F25A 5FFYA 5J0DA 4QSQA 3QZSA 4TT4A 4YYNA 4QSUA 2L85A 4IORA 4KV1A 4AKNA 5DYCA 4RVRA 3MB3A 3U5JA 4NRAA 2YELA 5EU1A 4YABA 4F3IA 5HRWA 4UYEA 4BW4A 2F6JA 3JVLA 4E96A 5CRMA 3LQJA 4YH3A 4O71A 5FDZA 4NUDA 4HBVA 4OUFA 2DVVA 3JVMA 3G0JA 4KV4A 3S91A 5EK9A 4O78A 4Z6IA 4MEQA 3IU6A 5EWCA 4BHWA 5EWHA 4YYMA 5LJ0A 4NS5A 4MENA 5HCLA 4ZC9A 3HMEA
chains in the Genus database with same CATH superfamily
5EM3A 3D7CA 3FKMX 5H1TA 4NUCA 1ZKRA 4PS5A 4TU6A 4IOQA 5DBMA 4TZ2A 5AD2A 5HQ5A 5IGMA 2DVQA 4HBWA 5FB1A 5FB0A 5KTUA 4A9FA 4UIVA 3AADA 5F60A 5A7CA 4TQNA 5EA1A 4UYDA 2FSAA 4QY4A 5II2A 5KO4A 5CTLA 2I7KA 4BW1A 4NXJA 5CUDA 4NRCA 5CFWA 5FH6A 4PKLA 5E73A 5CGPA 5EPBA 4IR4A 2OUOA 5EWDA 4TT2A 5CU8A 5H85A 4O7EA 5H1UA 5HRVA 5CPEA 4LYIA 2RO1A 4NUEA 4YY6A 2DVRA 3UVYA 2WP2A 4HXMA 5ENJA 3ERRA 2R10A 4MEPA 4NR7A 3JVJA 5ENEA 5EQ1A 4PTBA 5D3JA 5HQ7A 4A9HA 5EP7A 2OSSA 5D7XA 5AMEA 4O74A 5FE9A 3UW9A 3MUKA 5FE5A 5ENFA 5F2PA 4A9NA 4J0SA 4TS8A 3GG3A 4NYWA 5EPRA 3I3JA 4O7FA 5CUEA 4LYWA 5DFDA 4A9JA 5E9YA 4QR3A 4BW2A 4NYXA 2KTBB 5HRXA 3SVFA 4O72A 3O37A 5EPSA 5F1HA 4CFLA 5LJ2A 5LUUA 4LZSA 4TT6A 5I83A 2L5EA 5C8GA 5D0CA 5D3RA 5D3HA 5JI8A 4OGIA 3HMHA 5CQ5A 2E7OA 4CUUA 5A5QA 4Z1QA 1WUGA 5F62A 4YADA 5E3DA 5EVAA 4MR5A 5DKDA 4PCIA 4ZW1A 5F3AA 3VKGA 5D3SA 4N3WA 4NR9A 4LR6A 4WHUA 5FE0A 4Y03A 5A5NA 4YYHA 3O33A 1E6IA 4LDFA 4AI6A 2RNXA 4IOOA 4N4HA 5CS8A 5A85A 3LQIA 3P1FA 4NQMA 4CL9A 5ENBA 4YYJA 4NQNA 4IR5A 4O7BA 4O7CA 3UVWA 4KCXA 5FG4A 2D82A 5LKTA 5L97A 2F6NA 3UV5A 5EV9A 5BT4A 5A83A 4XUBA 5DX4A 4UIYA 4QSSA 4PCEA 5IIDA 2YQDA 2DVSA 5LJ1A 5DFBA 1N72A 3Q2FA 4YBSA 5CZGA 4HXLA 4PY6A 5L8TA 4QUUA 5HJCA 5IGLA 3G0LA 4NR4A 3IU5A 5DLXA 5LKUA 4OGJA 3MB4A 4A9MA 5CQ6A 1JM4B 4AKGA 5I1QA 4YC9A 5FFVA 5ETDA 5CUAA 4IR3A 4O76A 4UYHA 5KHMA 5I80A 2G4AA 4QZSA 3QZVA 4YYIA 5IGNA 4N4FA 5I40A 2L84A 3QZTA 4A9LA 4YAXA 4TTEA 4C66A 4UIXA 4FLPA 4A9EA 4NR8A 5HLSA 4TYLA 5CUGA 5ENHA 4QSWA 5CUCA 5ENCA 4HBYA 5CQ4A 4GPJA 4X2IA 4TZ8A 3AQAA 3K2JA 1JSPB 2I8NA 4N4GA 4UITA 5HM0A 4AKIA 4YYDA 5E9KA 4UYFB 3JVKA 5ENGA 5E9MA 5C85A 4CLBA 5F1LA 4XYAA 4LC2A 5D25A 4QYDA 5IBNA 4QB3A 5E9IA 2D9EA 2E3KA 5II1A 2RS9B 4QSXA 2RNYA 4QR4A 2YYNA 4Q0NA 4NR5A 4ALGA 3D1BA 5I86A 3U5OA 5D3TA 5FG5A 3ZYUA 5KU3A 4TU4A 2RFJA 4YY4A 4XY8A 5C87A 3U5PA 4ZQLA 3LXJA 3S92A 4QSTA 5DYXA 4CFKA 5D3LA 3P1EA 5HELA 5CQ7A 3LJWA 4O70A 3P1CA 1F68A 5DW1A 5HFRA 3UV4A 2RNWA 5A5SA 5CRZA 5FG6A 4QC1A 4ALHA 5E0RA 4QR5A 5COIA 4O77A 5I88A 5G4SA 4HXOA 2OO1A 4XUAA 5ETBA 3DAIA 4MR3A 5E9LA 4LRGA 5HENA 1EQFA 2DATA 5I7XA 5A5RA 5AMFA 5CP5A 5LVRA 3U5LA 2N9GA 4DONA 4WIVA 5TB6A 4Z6HA 4NRBA 3P1DA 5CY9A 5DKCA 5EICA 3NXBA 4LYSA 5A5PA 4QEUA 5E9VA 5DFCA 4YYKA 3O35A 5L8UA 5F36A 4NYVA 4A9KA 4Z1SA 5F63A 2R0VA 5FE1A 4QC3A 3DWYA 4A9IA 4A9OA 4UYGA 2YEMA 5JWMA 5H1VA 5C4QA 5CQAA 5I7YA 3UV2A 2GRCA 3RCWA 5E74A 4HXNA 5HQ6A 4CUTA 1ZS5A 5FE4A 4CUPA 4QSVA 4UIWA 2E7NA 4HXKA 4LZRA 5FH7A 2R0YA 4YBMA 5KTWA 4NR6A 4O7AA 4Q0OA 5EWWA 3TLPA 4YH4A 4BJXA 5FE8A 5L98A 3LQHA 5D3PA 4YATA 3UVDA 4WHWA 5LKZA 4YK0A 5D26A 5CQ8A 5FH8A 1PUOA 5DW2A 5HEMA 5LVQA 4N4IA 4O75A 5FE7A 3SVHA 4QYLA 5DY7A 5DLZA 5E7DA 4UIZA 3MQMA 5HFQA 2YW5A 2NXBA 3MXFA 1WUMA 5F5ZA 5K29A 4YBTA 5ENIA 5E3GA 4QSRA 2H60A 4MR4A 3UVXA 5CQTA 4HBXA 4QEVA 5F61A 3D1DA 5IG6A 4BW3A 5DYUA 5DKHA 4QUTA 5AD3A 5EGUA 4IR6A 1X0JA 5FE3A 4QNSA 5A81A 5CQ3A 5C7NA 3MULA 3O36A 5ACYA 5BT3A 5EWVA 4LZ2A 5A5OA 3O34A 3U5KA 4UIUA 4CUSA 4QEWA 5FFWA 3ONIA 3U5NA 4CURA 4J0RA 4CUQA 3U5MA 2MJVB 4YYGA 5L99A 5I29A 5FE6A 2R0SA 2RI7A 5L96A 5IGKA 2DWWA 5DYAA 4HXSA 3SVGA 4QBMA 2YEKA 3P5OA 5KTXA 5I89A 4J1PA 2DKWA 4J3IA 5FBXA 4MEOA 2YDWA 5EI4A 2LSPB 4HXRA 5D3NA 4QSPA 5FE2A 5EISA 5BT5A 3HMFA 4XY9A 3Q2EA 4Z93A 5G4RA 5A82A 2EJNA 5TCMA 5LKXA 3VKHA 5CUBA 5C89A 4UYFA 5D24A 4C67A 2WP1A 4MR6A 4HXPA 5F25A 5FFYA 5J0DA 4QSQA 3QZSA 4TT4A 4YYNA 4QSUA 2L85A 4IORA 4KV1A 4AKNA 5DYCA 4RVRA 3MB3A 3U5JA 4NRAA 2YELA 5EU1A 4YABA 4F3IA 5HRWA 4UYEA 4BW4A 2F6JA 3JVLA 4E96A 5CRMA 3LQJA 4YH3A 4O71A 5FDZA 4NUDA 4HBVA 4OUFA 2DVVA 3JVMA 3G0JA 4KV4A 3S91A 5EK9A 4O78A 4Z6IA 4MEQA 3IU6A 5EWCA 4BHWA 5EWHA 4YYMA 5LJ0A 4NS5A 4AKHA 4MENA 5HCLA 4ZC9A 3HMEA
chains in the Genus database with same CATH topology
5EM3A 3D7CA 3FKMX 5H1TA 4NUCA 4PS5A 4TU6A 4IOQA 5DBMA 4TZ2A 5AD2A 5HQ5A 5IGMA 2DVQA 4HBWA 5FB1A 5FB0A 5KTUA 4A9FA 4UIVA 3AADA 5F60A 5A7CA 4TQNA 5EA1A 4UYDA 2FSAA 4QY4A 5II2A 5KO4A 5CTLA 2I7KA 4BW1A 4NXJA 5CUDA 4NRCA 5CFWA 5FH6A 4PKLA 5E73A 5CGPA 5EPBA 4IR4A 2OUOA 5EWDA 4TT2A 5CU8A 5H85A 4O7EA 5H1UA 5HRVA 5CPEA 4LYIA 2RO1A 4NUEA 4YY6A 2DVRA 3UVYA 2WP2A 4HXMA 5ENJA 2R10A 4MEPA 4NR7A 3JVJA 5ENEA 5EQ1A 4PTBA 5D3JA 5HQ7A 4A9HA 5EP7A 2OSSA 5D7XA 5AMEA 4O74A 5FE9A 3UW9A 3MUKA 5FE5A 5ENFA 5F2PA 4A9NA 4J0SA 4TS8A 3GG3A 4NYWA 5EPRA 3I3JA 4O7FA 5CUEA 4LYWA 5DFDA 4A9JA 5E9YA 4QR3A 4BW2A 4NYXA 2KTBB 5HRXA 3SVFA 4O72A 3O37A 5EPSA 5F1HA 4CFLA 5LJ2A 5LUUA 4LZSA 4TT6A 5I83A 2L5EA 5C8GA 5D0CA 5D3RA 5D3HA 5JI8A 4OGIA 3HMHA 5CQ5A 2E7OA 4CUUA 5A5QA 4Z1QA 1WUGA 5F62A 4YADA 5E3DA 5EVAA 4MR5A 5DKDA 4PCIA 4ZW1A 5F3AA 5D3SA 4N3WA 4NR9A 4LR6A 4WHUA 5FE0A 4Y03A 5A5NA 4YYHA 3O33A 1E6IA 4LDFA 2RNXA 4IOOA 4N4HA 5CS8A 5A85A 3LQIA 3P1FA 4NQMA 4CL9A 5ENBA 4YYJA 4NQNA 4IR5A 4O7BA 4O7CA 3UVWA 4KCXA 5FG4A 2D82A 5LKTA 5L97A 2F6NA 3UV5A 5EV9A 5BT4A 5A83A 4XUBA 5DX4A 4UIYA 4QSSA 4PCEA 5IIDA 2YQDA 2DVSA 5LJ1A 5DFBA 1N72A 3Q2FA 4YBSA 5CZGA 4HXLA 4PY6A 5L8TA 4QUUA 5HJCA 5IGLA 3G0LA 4NR4A 3IU5A 5DLXA 5LKUA 4OGJA 3MB4A 4A9MA 5CQ6A 1JM4B 5I1QA 4YC9A 5FFVA 5ETDA 5CUAA 4IR3A 4O76A 4UYHA 5KHMA 5I80A 2G4AA 4QZSA 3QZVA 4YYIA 5IGNA 4N4FA 5I40A 2L84A 3QZTA 4A9LA 4YAXA 4TTEA 4C66A 4UIXA 4FLPA 4A9EA 4NR8A 5HLSA 4TYLA 5CUGA 5ENHA 4QSWA 5CUCA 5ENCA 4HBYA 5CQ4A 4GPJA 4X2IA 4TZ8A 3AQAA 3K2JA 1JSPB 2I8NA 4N4GA 4UITA 5HM0A 4YYDA 5E9KA 4UYFB 3JVKA 5ENGA 5E9MA 5C85A 4CLBA 5F1LA 4XYAA 4LC2A 5D25A 4QYDA 5IBNA 4QB3A 5E9IA 2D9EA 2E3KA 5II1A 2RS9B 4QSXA 2RNYA 4QR4A 2YYNA 4Q0NA 4NR5A 4ALGA 5I86A 3U5OA 5D3TA 5FG5A 3ZYUA 5KU3A 4TU4A 2RFJA 4YY4A 4XY8A 5C87A 3U5PA 4ZQLA 3LXJA 3S92A 4QSTA 5DYXA 4CFKA 5D3LA 3P1EA 5HELA 5CQ7A 3LJWA 4O70A 3P1CA 1F68A 5DW1A 5HFRA 3UV4A 2RNWA 5A5SA 5CRZA 5FG6A 4QC1A 4ALHA 5E0RA 4QR5A 5COIA 4O77A 5I88A 5G4SA 4HXOA 2OO1A 4XUAA 5ETBA 3DAIA 4MR3A 5E9LA 4LRGA 5HENA 1EQFA 2DATA 5I7XA 5A5RA 5AMFA 5CP5A 5LVRA 3U5LA 2N9GA 4DONA 4WIVA 5TB6A 4Z6HA 4NRBA 3P1DA 5CY9A 5DKCA 5EICA 3NXBA 4LYSA 5A5PA 4QEUA 5E9VA 5DFCA 4YYKA 3O35A 5L8UA 5F36A 4NYVA 4A9KA 4Z1SA 5F63A 2R0VA 5FE1A 4QC3A 3DWYA 4A9IA 4A9OA 4UYGA 2YEMA 5JWMA 5H1VA 5C4QA 5CQAA 5I7YA 3UV2A 2GRCA 3RCWA 5E74A 4HXNA 5HQ6A 4CUTA 1ZS5A 5FE4A 4CUPA 4QSVA 4UIWA 2E7NA 4HXKA 4LZRA 5FH7A 2R0YA 4YBMA 5KTWA 4NR6A 4O7AA 4Q0OA 5EWWA 3TLPA 4YH4A 4BJXA 5FE8A 5L98A 3LQHA 5D3PA 4YATA 3UVDA 4WHWA 5LKZA 4YK0A 5D26A 5CQ8A 5FH8A 5DW2A 5HEMA 5LVQA 4N4IA 4O75A 5FE7A 3SVHA 4QYLA 5DY7A 5DLZA 5E7DA 4UIZA 3MQMA 5HFQA 2YW5A 2NXBA 3MXFA 1WUMA 5F5ZA 5K29A 4YBTA 5ENIA 5E3GA 4QSRA 2H60A 4MR4A 3UVXA 5CQTA 4HBXA 4QEVA 5F61A 5IG6A 4BW3A 5DYUA 5DKHA 4QUTA 5AD3A 5EGUA 4IR6A 1X0JA 5FE3A 4QNSA 5A81A 5CQ3A 5C7NA 3MULA 3O36A 5ACYA 5BT3A 5EWVA 4LZ2A 5A5OA 3O34A 3U5KA 4UIUA 4CUSA 4QEWA 5FFWA 3ONIA 3U5NA 4CURA 4J0RA 4CUQA 3U5MA 2MJVB 4YYGA 5L99A 5I29A 5FE6A 2R0SA 2RI7A 5L96A 5IGKA 2DWWA 5DYAA 4HXSA 3SVGA 4QBMA 2YEKA 3P5OA 5KTXA 5I89A 4J1PA 2DKWA 4J3IA 5FBXA 4MEOA 2YDWA 5EI4A 2LSPB 4HXRA 5D3NA 4QSPA 5FE2A 5EISA 5BT5A 3HMFA 4XY9A 3Q2EA 4Z93A 5G4RA 5A82A 5TCMA 5LKXA 5CUBA 5C89A 4UYFA 5D24A 4C67A 2WP1A 4MR6A 4HXPA 5F25A 5FFYA 5J0DA 4QSQA 3QZSA 4TT4A 4YYNA 4QSUA 2L85A 4IORA 4KV1A 4AKNA 5DYCA 4RVRA 3MB3A 3U5JA 4NRAA 2YELA 5EU1A 4YABA 4F3IA 5HRWA 4UYEA 4BW4A 2F6JA 3JVLA 4E96A 5CRMA 3LQJA 4YH3A 4O71A 5FDZA 4NUDA 4HBVA 4OUFA 2DVVA 3JVMA 3G0JA 4KV4A 3S91A 5EK9A 4O78A 4Z6IA 4MEQA 3IU6A 5EWCA 4BHWA 5EWHA 4YYMA 5LJ0A 4NS5A 4MENA 5HCLA 4ZC9A 3HMEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EM3 A;  3D7C A;  3FKM X;  5H1T A;  4NUC A;  4PS5 A;  4TU6 A;  4IOQ A;  5DBM A;  4TZ2 A;  5AD2 A;  5HQ5 A;  5IGM A;  2DVQ A;  4HBW A;  5FB1 A;  5FB0 A;  5KTU A;  4A9F A;  4UIV A;  3AAD A;  5F60 A;  5A7C A;  4TQN A;  5EA1 A;  4UYD A;  2FSA A;  4QY4 A;  5II2 A;  5KO4 A;  5CTL A;  2I7K A;  4BW1 A;  4NXJ A;  5CUD A;  4NRC A;  5CFW A;  5FH6 A;  4PKL A;  5E73 A;  5CGP A;  5EPB A;  4IR4 A;  2OUO A;  5EWD A;  4TT2 A;  5CU8 A;  5H85 A;  4O7E A;  5H1U A;  5HRV A;  5CPE A;  4LYI A;  2RO1 A;  4NUE A;  4YY6 A;  2DVR A;  3UVY A;  2WP2 A;  4HXM A;  5ENJ A;  2R10 A;  4MEP A;  4NR7 A;  3JVJ A;  5ENE A;  5EQ1 A;  4PTB A;  5D3J A;  5HQ7 A;  4A9H A;  5EP7 A;  2OSS A;  5D7X A;  5AME A;  4O74 A;  5FE9 A;  3UW9 A;  3MUK A;  5FE5 A;  5ENF A;  5F2P A;  4A9N A;  4J0S A;  4TS8 A;  3GG3 A;  4NYW A;  5EPR A;  3I3J A;  4O7F A;  5CUE A;  4LYW A;  5DFD A;  4A9J A;  5E9Y A;  4QR3 A;  4BW2 A;  4NYX A;  2KTB B;  5HRX A;  3SVF A;  4O72 A;  3O37 A;  5EPS A;  5F1H A;  4CFL A;  5LJ2 A;  5LUU A;  4LZS A;  4TT6 A;  5I83 A;  2L5E A;  5C8G A;  5D0C A;  5D3R A;  5D3H A;  5JI8 A;  4OGI A;  3HMH A;  5CQ5 A;  2E7O A;  4CUU A;  5A5Q A;  4Z1Q A;  1WUG A;  5F62 A;  4YAD A;  5E3D A;  5EVA A;  4MR5 A;  5DKD A;  4PCI A;  4ZW1 A;  5F3A A;  5D3S A;  4N3W A;  4NR9 A;  4LR6 A;  4WHU A;  5FE0 A;  4Y03 A;  5A5N A;  4YYH A;  3O33 A;  1E6I A;  4LDF A;  2RNX A;  4IOO A;  4N4H A;  5CS8 A;  5A85 A;  3LQI A;  3P1F A;  4NQM A;  4CL9 A;  5ENB A;  4YYJ A;  4NQN A;  4IR5 A;  4O7B A;  4O7C A;  3UVW A;  4KCX A;  5FG4 A;  2D82 A;  5LKT A;  5L97 A;  2F6N A;  3UV5 A;  5EV9 A;  5BT4 A;  5A83 A;  4XUB A;  5DX4 A;  4UIY A;  4QSS A;  4PCE A;  5IID A;  2YQD A;  2DVS A;  5LJ1 A;  5DFB A;  1N72 A;  3Q2F A;  4YBS A;  5CZG A;  4HXL A;  4PY6 A;  5L8T A;  4QUU A;  5HJC A;  5IGL A;  3G0L A;  4NR4 A;  3IU5 A;  5DLX A;  5LKU A;  4OGJ A;  3MB4 A;  4A9M A;  5CQ6 A;  1JM4 B;  5I1Q A;  4YC9 A;  5FFV A;  5ETD A;  5CUA A;  4IR3 A;  4O76 A;  4UYH A;  5KHM A;  5I80 A;  2G4A A;  4QZS A;  3QZV A;  4YYI A;  5IGN A;  4N4F A;  5I40 A;  2L84 A;  3QZT A;  4A9L A;  4YAX A;  4TTE A;  4C66 A;  4UIX A;  4FLP A;  4A9E A;  4NR8 A;  5HLS A;  4TYL A;  5CUG A;  5ENH A;  4QSW A;  5CUC A;  5ENC A;  4HBY A;  5CQ4 A;  4GPJ A;  4X2I A;  4TZ8 A;  3AQA A;  3K2J A;  1JSP B;  2I8N A;  4N4G A;  4UIT A;  5HM0 A;  4YYD A;  5E9K A;  4UYF B;  3JVK A;  5ENG A;  5E9M A;  5C85 A;  4CLB A;  5F1L A;  4XYA A;  4LC2 A;  5D25 A;  4QYD A;  5IBN A;  4QB3 A;  5E9I A;  2D9E A;  2E3K A;  5II1 A;  2RS9 B;  4QSX A;  2RNY A;  4QR4 A;  2YYN A;  4Q0N A;  4NR5 A;  4ALG A;  5I86 A;  3U5O A;  5D3T A;  5FG5 A;  3ZYU A;  5KU3 A;  4TU4 A;  2RFJ A;  4YY4 A;  4XY8 A;  5C87 A;  3U5P A;  4ZQL A;  3LXJ A;  3S92 A;  4QST A;  5DYX A;  4CFK A;  5D3L A;  3P1E A;  5HEL A;  5CQ7 A;  3LJW A;  4O70 A;  3P1C A;  1F68 A;  5DW1 A;  5HFR A;  3UV4 A;  2RNW A;  5A5S A;  5CRZ A;  5FG6 A;  4QC1 A;  4ALH A;  5E0R A;  4QR5 A;  5COI A;  4O77 A;  5I88 A;  5G4S A;  4HXO A;  2OO1 A;  4XUA A;  5ETB A;  3DAI A;  4MR3 A;  5E9L A;  4LRG A;  5HEN A;  1EQF A;  2DAT A;  5I7X A;  5A5R A;  5AMF A;  5CP5 A;  5LVR A;  3U5L A;  2N9G A;  4DON A;  4WIV A;  5TB6 A;  4Z6H A;  4NRB A;  3P1D A;  5CY9 A;  5DKC A;  5EIC A;  3NXB A;  4LYS A;  5A5P A;  4QEU A;  5E9V A;  5DFC A;  4YYK A;  3O35 A;  5L8U A;  5F36 A;  4NYV A;  4A9K A;  4Z1S A;  5F63 A;  2R0V A;  5FE1 A;  4QC3 A;  3DWY A;  4A9I A;  4A9O A;  4UYG A;  2YEM A;  5JWM A;  5H1V A;  5C4Q A;  5CQA A;  5I7Y A;  3UV2 A;  2GRC A;  3RCW A;  5E74 A;  4HXN A;  5HQ6 A;  4CUT A;  1ZS5 A;  5FE4 A;  4CUP A;  4QSV A;  4UIW A;  2E7N A;  4HXK A;  4LZR A;  5FH7 A;  2R0Y A;  4YBM A;  5KTW A;  4NR6 A;  4O7A A;  4Q0O A;  5EWW A;  3TLP A;  4YH4 A;  4BJX A;  5FE8 A;  5L98 A;  3LQH A;  5D3P A;  4YAT A;  3UVD A;  4WHW A;  5LKZ A;  4YK0 A;  5D26 A;  5CQ8 A;  5FH8 A;  5DW2 A;  5HEM A;  5LVQ A;  4N4I A;  4O75 A;  5FE7 A;  3SVH A;  4QYL A;  5DY7 A;  5DLZ A;  5E7D A;  4UIZ A;  3MQM A;  5HFQ A;  2YW5 A;  2NXB A;  3MXF A;  1WUM A;  5F5Z A;  5K29 A;  4YBT A;  5ENI A;  5E3G A;  4QSR A;  2H60 A;  4MR4 A;  3UVX A;  5CQT A;  4HBX A;  4QEV A;  5F61 A;  5IG6 A;  4BW3 A;  5DYU A;  5DKH A;  4QUT A;  5AD3 A;  5EGU A;  4IR6 A;  1X0J A;  5FE3 A;  4QNS A;  5A81 A;  5CQ3 A;  5C7N A;  3MUL A;  3O36 A;  5ACY A;  5BT3 A;  5EWV A;  4LZ2 A;  5A5O A;  3O34 A;  3U5K A;  4UIU A;  4CUS A;  4QEW A;  5FFW A;  3ONI A;  3U5N A;  4CUR A;  4J0R A;  4CUQ A;  3U5M A;  2MJV B;  4YYG A;  5L99 A;  5I29 A;  5FE6 A;  2R0S A;  2RI7 A;  5L96 A;  5IGK A;  2DWW A;  5DYA A;  4HXS A;  3SVG A;  4QBM A;  2YEK A;  3P5O A;  5KTX A;  5I89 A;  4J1P A;  2DKW A;  4J3I A;  5FBX A;  4MEO A;  2YDW A;  5EI4 A;  2LSP B;  4HXR A;  5D3N A;  4QSP A;  5FE2 A;  5EIS A;  5BT5 A;  3HMF A;  4XY9 A;  3Q2E A;  4Z93 A;  5G4R A;  5A82 A;  5TCM A;  5LKX A;  5CUB A;  5C89 A;  4UYF A;  5D24 A;  4C67 A;  2WP1 A;  4MR6 A;  4HXP A;  5F25 A;  5FFY A;  5J0D A;  4QSQ A;  3QZS A;  4TT4 A;  4YYN A;  4QSU A;  2L85 A;  4IOR A;  4KV1 A;  4AKN A;  5DYC A;  4RVR A;  3MB3 A;  3U5J A;  4NRA A;  2YEL A;  5EU1 A;  4YAB A;  4F3I A;  5HRW A;  4UYE A;  4BW4 A;  2F6J A;  3JVL A;  4E96 A;  5CRM A;  3LQJ A;  4YH3 A;  4O71 A;  5FDZ A;  4NUD A;  4HBV A;  4OUF A;  2DVV A;  3JVM A;  3G0J A;  4KV4 A;  3S91 A;  5EK9 A;  4O78 A;  4Z6I A;  4MEQ A;  3IU6 A;  5EWC A;  4BHW A;  5EWH A;  4YYM A;  5LJ0 A;  4NS5 A;  4MEN A;  5HCL A;  4ZC9 A;  3HME A; 
#chains in the Genus database with same CATH topology
 5EM3 A;  3D7C A;  3FKM X;  5H1T A;  4NUC A;  1ZKR A;  4PS5 A;  4TU6 A;  4IOQ A;  5DBM A;  4TZ2 A;  5AD2 A;  5HQ5 A;  5IGM A;  2DVQ A;  4HBW A;  5FB1 A;  5FB0 A;  5KTU A;  4A9F A;  4UIV A;  3AAD A;  5F60 A;  5A7C A;  4TQN A;  5EA1 A;  4UYD A;  2FSA A;  4QY4 A;  5II2 A;  5KO4 A;  5CTL A;  2I7K A;  4BW1 A;  4NXJ A;  5CUD A;  4NRC A;  5CFW A;  5FH6 A;  4PKL A;  5E73 A;  5CGP A;  5EPB A;  4IR4 A;  2OUO A;  5EWD A;  4TT2 A;  5CU8 A;  5H85 A;  4O7E A;  5H1U A;  5HRV A;  5CPE A;  4LYI A;  2RO1 A;  4NUE A;  4YY6 A;  2DVR A;  3UVY A;  2WP2 A;  4HXM A;  5ENJ A;  3ERR A;  2R10 A;  4MEP A;  4NR7 A;  3JVJ A;  5ENE A;  5EQ1 A;  4PTB A;  5D3J A;  5HQ7 A;  4A9H A;  5EP7 A;  2OSS A;  5D7X A;  5AME A;  4O74 A;  5FE9 A;  3UW9 A;  3MUK A;  5FE5 A;  5ENF A;  5F2P A;  4A9N A;  4J0S A;  4TS8 A;  3GG3 A;  4NYW A;  5EPR A;  3I3J A;  4O7F A;  5CUE A;  4LYW A;  5DFD A;  4A9J A;  5E9Y A;  4QR3 A;  4BW2 A;  4NYX A;  2KTB B;  5HRX A;  3SVF A;  4O72 A;  3O37 A;  5EPS A;  5F1H A;  4CFL A;  5LJ2 A;  5LUU A;  4LZS A;  4TT6 A;  5I83 A;  2L5E A;  5C8G A;  5D0C A;  5D3R A;  5D3H A;  5JI8 A;  4OGI A;  3HMH A;  5CQ5 A;  2E7O A;  4CUU A;  5A5Q A;  4Z1Q A;  1WUG A;  5F62 A;  4YAD A;  5E3D A;  5EVA A;  4MR5 A;  5DKD A;  4PCI A;  4ZW1 A;  5F3A A;  3VKG A;  5D3S A;  4N3W A;  4NR9 A;  4LR6 A;  4WHU A;  5FE0 A;  4Y03 A;  5A5N A;  4YYH A;  3O33 A;  1E6I A;  4LDF A;  4AI6 A;  2RNX A;  4IOO A;  4N4H A;  5CS8 A;  5A85 A;  3LQI A;  3P1F A;  4NQM A;  4CL9 A;  5ENB A;  4YYJ A;  4NQN A;  4IR5 A;  4O7B A;  4O7C A;  3UVW A;  4KCX A;  5FG4 A;  2D82 A;  5LKT A;  5L97 A;  2F6N A;  3UV5 A;  5EV9 A;  5BT4 A;  5A83 A;  4XUB A;  5DX4 A;  4UIY A;  4QSS A;  4PCE A;  5IID A;  2YQD A;  2DVS A;  5LJ1 A;  5DFB A;  1N72 A;  3Q2F A;  4YBS A;  5CZG A;  4HXL A;  4PY6 A;  5L8T A;  4QUU A;  5HJC A;  5IGL A;  3G0L A;  4NR4 A;  3IU5 A;  5DLX A;  5LKU A;  4OGJ A;  3MB4 A;  4A9M A;  5CQ6 A;  1JM4 B;  4AKG A;  5I1Q A;  4YC9 A;  5FFV A;  5ETD A;  5CUA A;  4IR3 A;  4O76 A;  4UYH A;  5KHM A;  5I80 A;  2G4A A;  4QZS A;  3QZV A;  4YYI A;  5IGN A;  4N4F A;  5I40 A;  2L84 A;  3QZT A;  4A9L A;  4YAX A;  4TTE A;  4C66 A;  4UIX A;  4FLP A;  4A9E A;  4NR8 A;  5HLS A;  4TYL A;  5CUG A;  5ENH A;  4QSW A;  5CUC A;  5ENC A;  4HBY A;  5CQ4 A;  4GPJ A;  4X2I A;  4TZ8 A;  3AQA A;  3K2J A;  1JSP B;  2I8N A;  4N4G A;  4UIT A;  5HM0 A;  4AKI A;  4YYD A;  5E9K A;  4UYF B;  3JVK A;  5ENG A;  5E9M A;  5C85 A;  4CLB A;  5F1L A;  4XYA A;  4LC2 A;  5D25 A;  4QYD A;  5IBN A;  4QB3 A;  5E9I A;  2D9E A;  2E3K A;  5II1 A;  2RS9 B;  4QSX A;  2RNY A;  4QR4 A;  2YYN A;  4Q0N A;  4NR5 A;  4ALG A;  3D1B A;  5I86 A;  3U5O A;  5D3T A;  5FG5 A;  3ZYU A;  5KU3 A;  4TU4 A;  2RFJ A;  4YY4 A;  4XY8 A;  5C87 A;  3U5P A;  4ZQL A;  3LXJ A;  3S92 A;  4QST A;  5DYX A;  4CFK A;  5D3L A;  3P1E A;  5HEL A;  5CQ7 A;  3LJW A;  4O70 A;  3P1C A;  1F68 A;  5DW1 A;  5HFR A;  3UV4 A;  2RNW A;  5A5S A;  5CRZ A;  5FG6 A;  4QC1 A;  4ALH A;  5E0R A;  4QR5 A;  5COI A;  4O77 A;  5I88 A;  5G4S A;  4HXO A;  2OO1 A;  4XUA A;  5ETB A;  3DAI A;  4MR3 A;  5E9L A;  4LRG A;  5HEN A;  1EQF A;  2DAT A;  5I7X A;  5A5R A;  5AMF A;  5CP5 A;  5LVR A;  3U5L A;  2N9G A;  4DON A;  4WIV A;  5TB6 A;  4Z6H A;  4NRB A;  3P1D A;  5CY9 A;  5DKC A;  5EIC A;  3NXB A;  4LYS A;  5A5P A;  4QEU A;  5E9V A;  5DFC A;  4YYK A;  3O35 A;  5L8U A;  5F36 A;  4NYV A;  4A9K A;  4Z1S A;  5F63 A;  2R0V A;  5FE1 A;  4QC3 A;  3DWY A;  4A9I A;  4A9O A;  4UYG A;  2YEM A;  5JWM A;  5H1V A;  5C4Q A;  5CQA A;  5I7Y A;  3UV2 A;  2GRC A;  3RCW A;  5E74 A;  4HXN A;  5HQ6 A;  4CUT A;  1ZS5 A;  5FE4 A;  4CUP A;  4QSV A;  4UIW A;  2E7N A;  4HXK A;  4LZR A;  5FH7 A;  2R0Y A;  4YBM A;  5KTW A;  4NR6 A;  4O7A A;  4Q0O A;  5EWW A;  3TLP A;  4YH4 A;  4BJX A;  5FE8 A;  5L98 A;  3LQH A;  5D3P A;  4YAT A;  3UVD A;  4WHW A;  5LKZ A;  4YK0 A;  5D26 A;  5CQ8 A;  5FH8 A;  1PUO A;  5DW2 A;  5HEM A;  5LVQ A;  4N4I A;  4O75 A;  5FE7 A;  3SVH A;  4QYL A;  5DY7 A;  5DLZ A;  5E7D A;  4UIZ A;  3MQM A;  5HFQ A;  2YW5 A;  2NXB A;  3MXF A;  1WUM A;  5F5Z A;  5K29 A;  4YBT A;  5ENI A;  5E3G A;  4QSR A;  2H60 A;  4MR4 A;  3UVX A;  5CQT A;  4HBX A;  4QEV A;  5F61 A;  3D1D A;  5IG6 A;  4BW3 A;  5DYU A;  5DKH A;  4QUT A;  5AD3 A;  5EGU A;  4IR6 A;  1X0J A;  5FE3 A;  4QNS A;  5A81 A;  5CQ3 A;  5C7N A;  3MUL A;  3O36 A;  5ACY A;  5BT3 A;  5EWV A;  4LZ2 A;  5A5O A;  3O34 A;  3U5K A;  4UIU A;  4CUS A;  4QEW A;  5FFW A;  3ONI A;  3U5N A;  4CUR A;  4J0R A;  4CUQ A;  3U5M A;  2MJV B;  4YYG A;  5L99 A;  5I29 A;  5FE6 A;  2R0S A;  2RI7 A;  5L96 A;  5IGK A;  2DWW A;  5DYA A;  4HXS A;  3SVG A;  4QBM A;  2YEK A;  3P5O A;  5KTX A;  5I89 A;  4J1P A;  2DKW A;  4J3I A;  5FBX A;  4MEO A;  2YDW A;  5EI4 A;  2LSP B;  4HXR A;  5D3N A;  4QSP A;  5FE2 A;  5EIS A;  5BT5 A;  3HMF A;  4XY9 A;  3Q2E A;  4Z93 A;  5G4R A;  5A82 A;  2EJN A;  5TCM A;  5LKX A;  3VKH A;  5CUB A;  5C89 A;  4UYF A;  5D24 A;  4C67 A;  2WP1 A;  4MR6 A;  4HXP A;  5F25 A;  5FFY A;  5J0D A;  4QSQ A;  3QZS A;  4TT4 A;  4YYN A;  4QSU A;  2L85 A;  4IOR A;  4KV1 A;  4AKN A;  5DYC A;  4RVR A;  3MB3 A;  3U5J A;  4NRA A;  2YEL A;  5EU1 A;  4YAB A;  4F3I A;  5HRW A;  4UYE A;  4BW4 A;  2F6J A;  3JVL A;  4E96 A;  5CRM A;  3LQJ A;  4YH3 A;  4O71 A;  5FDZ A;  4NUD A;  4HBV A;  4OUF A;  2DVV A;  3JVM A;  3G0J A;  4KV4 A;  3S91 A;  5EK9 A;  4O78 A;  4Z6I A;  4MEQ A;  3IU6 A;  5EWC A;  4BHW A;  5EWH A;  4YYM A;  5LJ0 A;  4NS5 A;  4AKH A;  4MEN A;  5HCL A;  4ZC9 A;  3HME A; 
#chains in the Genus database with same CATH homology
 5EM3 A;  3D7C A;  3FKM X;  5H1T A;  4NUC A;  4PS5 A;  4TU6 A;  4IOQ A;  5DBM A;  4TZ2 A;  5AD2 A;  5HQ5 A;  5IGM A;  2DVQ A;  4HBW A;  5FB1 A;  5FB0 A;  5KTU A;  4A9F A;  4UIV A;  3AAD A;  5F60 A;  5A7C A;  4TQN A;  5EA1 A;  4UYD A;  2FSA A;  4QY4 A;  5II2 A;  5KO4 A;  5CTL A;  2I7K A;  4BW1 A;  4NXJ A;  5CUD A;  4NRC A;  5CFW A;  5FH6 A;  4PKL A;  5E73 A;  5CGP A;  5EPB A;  4IR4 A;  2OUO A;  5EWD A;  4TT2 A;  5CU8 A;  5H85 A;  4O7E A;  5H1U A;  5HRV A;  5CPE A;  4LYI A;  2RO1 A;  4NUE A;  4YY6 A;  2DVR A;  3UVY A;  2WP2 A;  4HXM A;  5ENJ A;  2R10 A;  4MEP A;  4NR7 A;  3JVJ A;  5ENE A;  5EQ1 A;  4PTB A;  5D3J A;  5HQ7 A;  4A9H A;  5EP7 A;  2OSS A;  5D7X A;  5AME A;  4O74 A;  5FE9 A;  3UW9 A;  3MUK A;  5FE5 A;  5ENF A;  5F2P A;  4A9N A;  4J0S A;  4TS8 A;  3GG3 A;  4NYW A;  5EPR A;  3I3J A;  4O7F A;  5CUE A;  4LYW A;  5DFD A;  4A9J A;  5E9Y A;  4QR3 A;  4BW2 A;  4NYX A;  2KTB B;  5HRX A;  3SVF A;  4O72 A;  3O37 A;  5EPS A;  5F1H A;  4CFL A;  5LJ2 A;  5LUU A;  4LZS A;  4TT6 A;  5I83 A;  2L5E A;  5C8G A;  5D0C A;  5D3R A;  5D3H A;  5JI8 A;  4OGI A;  3HMH A;  5CQ5 A;  2E7O A;  4CUU A;  5A5Q A;  4Z1Q A;  1WUG A;  5F62 A;  4YAD A;  5E3D A;  5EVA A;  4MR5 A;  5DKD A;  4PCI A;  4ZW1 A;  5F3A A;  5D3S A;  4N3W A;  4NR9 A;  4LR6 A;  4WHU A;  5FE0 A;  4Y03 A;  5A5N A;  4YYH A;  3O33 A;  1E6I A;  4LDF A;  2RNX A;  4IOO A;  4N4H A;  5CS8 A;  5A85 A;  3LQI A;  3P1F A;  4NQM A;  4CL9 A;  5ENB A;  4YYJ A;  4NQN A;  4IR5 A;  4O7B A;  4O7C A;  3UVW A;  4KCX A;  5FG4 A;  2D82 A;  5LKT A;  5L97 A;  2F6N A;  3UV5 A;  5EV9 A;  5BT4 A;  5A83 A;  4XUB A;  5DX4 A;  4UIY A;  4QSS A;  4PCE A;  5IID A;  2YQD A;  2DVS A;  5LJ1 A;  5DFB A;  1N72 A;  3Q2F A;  4YBS A;  5CZG A;  4HXL A;  4PY6 A;  5L8T A;  4QUU A;  5HJC A;  5IGL A;  3G0L A;  4NR4 A;  3IU5 A;  5DLX A;  5LKU A;  4OGJ A;  3MB4 A;  4A9M A;  5CQ6 A;  1JM4 B;  5I1Q A;  4YC9 A;  5FFV A;  5ETD A;  5CUA A;  4IR3 A;  4O76 A;  4UYH A;  5KHM A;  5I80 A;  2G4A A;  4QZS A;  3QZV A;  4YYI A;  5IGN A;  4N4F A;  5I40 A;  2L84 A;  3QZT A;  4A9L A;  4YAX A;  4TTE A;  4C66 A;  4UIX A;  4FLP A;  4A9E A;  4NR8 A;  5HLS A;  4TYL A;  5CUG A;  5ENH A;  4QSW A;  5CUC A;  5ENC A;  4HBY A;  5CQ4 A;  4GPJ A;  4X2I A;  4TZ8 A;  3AQA A;  3K2J A;  1JSP B;  2I8N A;  4N4G A;  4UIT A;  5HM0 A;  4YYD A;  5E9K A;  4UYF B;  3JVK A;  5ENG A;  5E9M A;  5C85 A;  4CLB A;  5F1L A;  4XYA A;  4LC2 A;  5D25 A;  4QYD A;  5IBN A;  4QB3 A;  5E9I A;  2D9E A;  2E3K A;  5II1 A;  2RS9 B;  4QSX A;  2RNY A;  4QR4 A;  2YYN A;  4Q0N A;  4NR5 A;  4ALG A;  5I86 A;  3U5O A;  5D3T A;  5FG5 A;  3ZYU A;  5KU3 A;  4TU4 A;  2RFJ A;  4YY4 A;  4XY8 A;  5C87 A;  3U5P A;  4ZQL A;  3LXJ A;  3S92 A;  4QST A;  5DYX A;  4CFK A;  5D3L A;  3P1E A;  5HEL A;  5CQ7 A;  3LJW A;  4O70 A;  3P1C A;  1F68 A;  5DW1 A;  5HFR A;  3UV4 A;  2RNW A;  5A5S A;  5CRZ A;  5FG6 A;  4QC1 A;  4ALH A;  5E0R A;  4QR5 A;  5COI A;  4O77 A;  5I88 A;  5G4S A;  4HXO A;  2OO1 A;  4XUA A;  5ETB A;  3DAI A;  4MR3 A;  5E9L A;  4LRG A;  5HEN A;  1EQF A;  2DAT A;  5I7X A;  5A5R A;  5AMF A;  5CP5 A;  5LVR A;  3U5L A;  2N9G A;  4DON A;  4WIV A;  5TB6 A;  4Z6H A;  4NRB A;  3P1D A;  5CY9 A;  5DKC A;  5EIC A;  3NXB A;  4LYS A;  5A5P A;  4QEU A;  5E9V A;  5DFC A;  4YYK A;  3O35 A;  5L8U A;  5F36 A;  4NYV A;  4A9K A;  4Z1S A;  5F63 A;  2R0V A;  5FE1 A;  4QC3 A;  3DWY A;  4A9I A;  4A9O A;  4UYG A;  2YEM A;  5JWM A;  5H1V A;  5C4Q A;  5CQA A;  5I7Y A;  3UV2 A;  2GRC A;  3RCW A;  5E74 A;  4HXN A;  5HQ6 A;  4CUT A;  1ZS5 A;  5FE4 A;  4CUP A;  4QSV A;  4UIW A;  2E7N A;  4HXK A;  4LZR A;  5FH7 A;  2R0Y A;  4YBM A;  5KTW A;  4NR6 A;  4O7A A;  4Q0O A;  5EWW A;  3TLP A;  4YH4 A;  4BJX A;  5FE8 A;  5L98 A;  3LQH A;  5D3P A;  4YAT A;  3UVD A;  4WHW A;  5LKZ A;  4YK0 A;  5D26 A;  5CQ8 A;  5FH8 A;  5DW2 A;  5HEM A;  5LVQ A;  4N4I A;  4O75 A;  5FE7 A;  3SVH A;  4QYL A;  5DY7 A;  5DLZ A;  5E7D A;  4UIZ A;  3MQM A;  5HFQ A;  2YW5 A;  2NXB A;  3MXF A;  1WUM A;  5F5Z A;  5K29 A;  4YBT A;  5ENI A;  5E3G A;  4QSR A;  2H60 A;  4MR4 A;  3UVX A;  5CQT A;  4HBX A;  4QEV A;  5F61 A;  5IG6 A;  4BW3 A;  5DYU A;  5DKH A;  4QUT A;  5AD3 A;  5EGU A;  4IR6 A;  1X0J A;  5FE3 A;  4QNS A;  5A81 A;  5CQ3 A;  5C7N A;  3MUL A;  3O36 A;  5ACY A;  5BT3 A;  5EWV A;  4LZ2 A;  5A5O A;  3O34 A;  3U5K A;  4UIU A;  4CUS A;  4QEW A;  5FFW A;  3ONI A;  3U5N A;  4CUR A;  4J0R A;  4CUQ A;  3U5M A;  2MJV B;  4YYG A;  5L99 A;  5I29 A;  5FE6 A;  2R0S A;  2RI7 A;  5L96 A;  5IGK A;  2DWW A;  5DYA A;  4HXS A;  3SVG A;  4QBM A;  2YEK A;  3P5O A;  5KTX A;  5I89 A;  4J1P A;  2DKW A;  4J3I A;  5FBX A;  4MEO A;  2YDW A;  5EI4 A;  2LSP B;  4HXR A;  5D3N A;  4QSP A;  5FE2 A;  5EIS A;  5BT5 A;  3HMF A;  4XY9 A;  3Q2E A;  4Z93 A;  5G4R A;  5A82 A;  5TCM A;  5LKX A;  5CUB A;  5C89 A;  4UYF A;  5D24 A;  4C67 A;  2WP1 A;  4MR6 A;  4HXP A;  5F25 A;  5FFY A;  5J0D A;  4QSQ A;  3QZS A;  4TT4 A;  4YYN A;  4QSU A;  2L85 A;  4IOR A;  4KV1 A;  4AKN A;  5DYC A;  4RVR A;  3MB3 A;  3U5J A;  4NRA A;  2YEL A;  5EU1 A;  4YAB A;  4F3I A;  5HRW A;  4UYE A;  4BW4 A;  2F6J A;  3JVL A;  4E96 A;  5CRM A;  3LQJ A;  4YH3 A;  4O71 A;  5FDZ A;  4NUD A;  4HBV A;  4OUF A;  2DVV A;  3JVM A;  3G0J A;  4KV4 A;  3S91 A;  5EK9 A;  4O78 A;  4Z6I A;  4MEQ A;  3IU6 A;  5EWC A;  4BHW A;  5EWH A;  4YYM A;  5LJ0 A;  4NS5 A;  4MEN A;  5HCL A;  4ZC9 A;  3HME A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...