5A81A

Crystal structure of human atad2 bromodomain in complex with 8-(3r,4r) -3-(cyclohexylmethoxy)piperidin-4-yl-amino-3-methyl-1,2-dihydro-1,7- naphthyridin-2-one
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
130
structure length
130
Chain Sequence
SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICSNALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ATPASE FAMILY AAA DOMAIN-CONTAINING PROTEIN 2
publication title Structure-Based Optimization of Naphthyridones Into Potent Atad2 Bromodomain Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 55
structure length 130
sequence length 130
ec nomenclature ec 3.6.1.3: Adenosinetriphosphatase.
pdb deposition date 2015-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5a81A00
3IU5A 5IGNA 2E7OA 4MR3A 4O7CA 5A5RA 4J0RA 4NRBA 4YATA 5LKUA 5C4QA 5F3AA 4QB3A 4IR4A 3LXJA 5E73A 1ZS5A 4MR6A 3O36A 2N9GA 5IIDA 3AADA 5FE2A 4HXLA 4QEUA 5LJ1A 2LSPB 4YBMA 4YBSA 5HJCA 4A9EA 5I86A 4QR5A 4N4FA 5E9YA 3IU6A 5HFQA 4CL9A 5L8UA 5ENEA 5HRXA 4A9KA 3ONIA 4IR5A 5F63A 2WP2A 5H1UA 2YDWA 4LDFA 1F68A 2YEKA 4PCIA 1WUGA 4TS8A 4O70A 5FE4A 5EISA 3LQJA 2D82A 5TCMA 5ENIA 5DY7A 5HM0A 5KTXA 5DFDA 4BJXA 3Q2EA 4OGIA 5CUAA 2L85A 5EK9A 4UYDA 4HXNA 4E96A 4MR5A 2RS9B 4QSPA 3UV5A 5F25A 4NUEA 4QR3A 5CUDA 2DVRA 5BT3A 5IGLA 2L84A 5DKHA 5FE5A 3HMHA 4QY4A 3UV4A 5BT4A 5A85A 4O78A 3U5MA 4Z93A 5HEMA 4YABA 5II2A 3O37A 3LJWA 3LQHA 5C7NA 4LRGA 3UV2A 5EWHA 5A5PA 4NUCA 3AQAA 5FDZA 4OUFA 5A5SA 4PTBA 2YYNA 4DONA 4YYIA 4NR9A 5DX4A 3UW9A 5HLSA 5DW1A 5DFCA 5L99A 4Q0NA 4QSWA 5CQ6A 5E9KA 3SVGA 4MEPA 2E7NA 4UIUA 3JVKA 5FH6A 5EP7A 5F60A 3U5JA 5D3JA 4WHWA 5FB0A 5CQ8A 2F6NA 5EPRA 4XYAA 4LYIA 4QSQA 5CRMA 5FE0A 5FE6A 2DATA 5CZGA 3UVDA 5CTLA 4O7AA 2DVSA 3I3JA 4LC2A 5HCLA 3D7CA 4N4IA 4TZ2A 5EQ1A 5F1LA 4NUDA 4QEVA 4HXRA 4RVRA 3DWYA 4XY8A 4QBMA 4BW1A 4YYMA 4N4GA 3MB3A 4WHUA 4IOOA 5BT5A 3U5LA 5LJ0A 4UIYA 3P1FA 4UIXA 4CUQA 4TU6A 5D3PA 4YY4A 5CGPA 5FFYA 5FE7A 2RNXA 4YYJA 4NR8A 5DLZA 5ETDA 4Z6HA 5FE8A 5COIA 2R0SA 5F5ZA 4Z1QA 4UIZA 5EICA 4QUTA 2RO1A 4YC9A 5CUEA 4J3IA 4XY9A 3QZSA 5E3GA 2I7KA 4NS5A 4IORA 5IGMA 5IGKA 4YADA 5EVAA 4A9LA 4F3IA 5CY9A 5A5NA 4QSXA 5E74A 4GPJA 4BHWA 4A9JA 4BW4A 4CUSA 4QSSA 5CRZA 4LZSA 4LYWA 4LZRA 5FE1A 2DKWA 4CUTA 4NQNA 4YYKA 4ALGA 2YQDA 2R0YA 4NYXA 5CU8A 4HXMA 4TYLA 5EWDA 5HQ7A 4UYEA 3S92A 3GG3A 5D25A 5JWMA 4QC3A 4TT6A 5CQ5A 4A9MA 3G0JA 4QNSA 5CS8A 4PS5A 5EWWA 3O33A 4UYGA 5A5QA 4QSUA 4NR4A 1EQFA 4FLPA 2GRCA 4BW2A 4AKNA 4NR7A 5I88A 5DYCA 2R0VA 4CUUA 5E9MA 5H1TA 3NXBA 5KO4A 5FH7A 5F1HA 4QSRA 4YK0A 3O34A 5A83A 2I8NA 5KTUA 2DVQA 5ENGA 5FH8A 2R10A 2YW5A 3MXFA 4QZSA 4UITA 5F2PA 3QZVA 5I1QA 4O7EA 4YYNA 2NXBA 3MUKA 4HBXA 5CP5A 5AMFA 4A9NA 4ZW1A 5D0CA 5CQ4A 4IOQA 5CPEA 5LJ2A 4YY6A 5EPBA 5HRVA 3U5PA 5A81A 4YYGA 4QYLA 4XUAA 3U5OA 5E0RA 5D26A 5ENBA 4NR5A 4C67A 2OUOA 4WIVA 4TZ8A 4PY6A 5EU1A 4YAXA 4ZQLA 1E6IA 3UVYA 4IR6A 4LYSA 4N3WA 5I89A 5FG6A 5TB6A 4MEOA 3P1EA 4UYHA 4J0SA 5DW2A 4A9HA 3QZTA 4HBWA 3U5KA 5LUUA 4XUBA 2YEMA 4KV4A 4QSTA 4O75A 5ENHA 4PKLA 4UIVA 4YYHA 5G4SA 2OSSA 3LQIA 5AMEA 5EGUA 4A9FA 4YYDA 4CURA 4MENA 2D9EA 2RNYA 2FSAA 4O76A 5CUBA 5I40A 2MJVB 5A82A 5H1VA 2DVVA 2E3KA 5CQAA 5C89A 5I7YA 3JVMA 5LVQA 4KV1A 5I80A 5E9IA 5LVRA 5I29A 4Y03A 4HXKA 5CQ3A 3P5OA 5EWCA 5D3HA 5E9LA 4CLBA 3S91A 2DWWA 3RCWA 3SVHA 4O74A 5DYAA 4X2IA 4YH4A 2L5EA 5CQ7A 5DFBA 4TTEA 3SVFA 5ETBA 5I7XA 2KTBB 1N72A 3P1DA 5LKXA 4NYVA 5II1A 5LKZA 5FE3A 5D3NA 4ALHA 5AD2A 5L98A 5EWVA 5DYXA 4O71A 5CQTA 5FFVA 4NQMA 4TT2A 5KU3A 4ZC9A 5H85A 2YELA 1X0JA 3ZYUA 5ENJA 5EV9A 5EM3A 5L8TA 4QEWA 4UYFA 5FB1A 4UYFB 3JVJA 5CUCA 3TLPA 5C87A 5EPSA 3U5NA 5LKTA 5HQ6A 4LR6A 4YH3A 4TU4A 3P1CA 5ENCA 3MQMA 4CFKA 3UVWA 2RNWA 2RFJA 3O35A 5L96A 3MB4A 2H60A 5F61A 3HMFA 5DKCA 5C8GA 5I83A 4A9IA 4O7FA 4HBVA 5HELA 5ACYA 4MEQA 5HQ5A 4TQNA 2G4AA 5E7DA 5D3SA 4QC1A 5E3DA 4PCEA 4CFLA 3UVXA 4Q0OA 3MULA 5D24A 5KHMA 4HXPA 1WUMA 4QSVA 5DLXA 4N4HA 3FKMX 4NRCA 5E9VA 5EI4A 4QR4A 5FG5A 5CFWA 5HFRA 4HXSA 3Q2FA 5J0DA 4NYWA 4BW3A 5A7CA 4HBYA 3DAIA 4Z6IA 4NXJA 5D3RA 2WP1A 4KCXA 4CUPA 2F6JA 3JVLA 4O72A 5IBNA 2RI7A 5JI8A 5FE9A 5KTWA 4IR3A 5EA1A 5A5OA 4O77A 5F62A 5F36A 5DYUA 2OO1A 5DKDA 5IG6A 4HXOA 4NR6A 4MR4A 4QYDA 1JM4B 5C85A 5K29A 5ENFA 4NRAA 3HMEA 5DBMA 5L97A 5HENA 4LZ2A 4TT4A 5HRWA 5FG4A 5FFWA 4YBTA 3G0LA 4J1PA 4A9OA 3K2JA 4Z1SA 4QUUA 5D7XA 5G4RA 5FBXA 1JSPB 5D3LA 4C66A 4OGJA 5CUGA 4UIWA 5D3TA 5AD3A 4O7BA
chains in the Genus database with same CATH superfamily
3IU5A 5IGNA 3D1DA 2E7OA 4MR3A 4O7CA 5A5RA 4J0RA 4NRBA 4YATA 5LKUA 5C4QA 5F3AA 4QB3A 3ERRA 4IR4A 3LXJA 5E73A 1ZS5A 4MR6A 3O36A 2N9GA 5IIDA 3AADA 5FE2A 4HXLA 4QEUA 5LJ1A 2LSPB 4YBMA 4YBSA 5HJCA 4A9EA 5I86A 4QR5A 4N4FA 5E9YA 3IU6A 5HFQA 4CL9A 5L8UA 5ENEA 5HRXA 4A9KA 3ONIA 4IR5A 5F63A 3VKHA 2WP2A 5H1UA 2YDWA 4LDFA 1F68A 2YEKA 4PCIA 1WUGA 4TS8A 4O70A 5FE4A 5EISA 3LQJA 2D82A 5TCMA 5ENIA 5DY7A 5HM0A 5KTXA 5DFDA 4BJXA 3Q2EA 4OGIA 5CUAA 2L85A 5EK9A 4UYDA 4HXNA 4E96A 4MR5A 2RS9B 4QSPA 3UV5A 5F25A 4AKHA 4NUEA 4QR3A 5CUDA 2DVRA 5BT3A 5IGLA 2L84A 5DKHA 5FE5A 3HMHA 4QY4A 3UV4A 5BT4A 5A85A 4O78A 3U5MA 4Z93A 5HEMA 4YABA 5II2A 3O37A 3LJWA 3LQHA 5C7NA 4LRGA 3UV2A 5EWHA 5A5PA 4NUCA 3AQAA 5FDZA 4OUFA 5A5SA 4PTBA 2YYNA 4DONA 4YYIA 4NR9A 5DX4A 3UW9A 5HLSA 5DW1A 5DFCA 5L99A 4Q0NA 4QSWA 5CQ6A 5E9KA 3SVGA 4MEPA 2E7NA 4UIUA 3JVKA 5FH6A 5EP7A 5F60A 3U5JA 5D3JA 4WHWA 5FB0A 5CQ8A 2F6NA 5EPRA 4XYAA 4LYIA 4QSQA 5CRMA 5FE0A 5FE6A 2DATA 5CZGA 3UVDA 5CTLA 4O7AA 2DVSA 3I3JA 4LC2A 5HCLA 3D7CA 1PUOA 4N4IA 4TZ2A 5EQ1A 5F1LA 4NUDA 4AKGA 4QEVA 4HXRA 4RVRA 3DWYA 4XY8A 4QBMA 4BW1A 4YYMA 4N4GA 3MB3A 4WHUA 4IOOA 5BT5A 3U5LA 5LJ0A 4UIYA 3P1FA 4UIXA 4CUQA 4TU6A 5D3PA 4YY4A 5CGPA 5FFYA 5FE7A 2RNXA 4YYJA 4NR8A 5DLZA 5ETDA 4Z6HA 5FE8A 5COIA 2R0SA 5F5ZA 4Z1QA 4UIZA 5EICA 4QUTA 2RO1A 4YC9A 5CUEA 4J3IA 4XY9A 3QZSA 5E3GA 2I7KA 4NS5A 4IORA 5IGMA 5IGKA 4YADA 5EVAA 4A9LA 4F3IA 5CY9A 5A5NA 4QSXA 5E74A 4GPJA 4BHWA 4A9JA 4BW4A 4CUSA 4QSSA 5CRZA 4LZSA 2EJNA 4LYWA 4LZRA 5FE1A 2DKWA 4CUTA 4NQNA 4YYKA 4ALGA 2YQDA 2R0YA 4NYXA 5CU8A 4HXMA 4TYLA 5EWDA 5HQ7A 4UYEA 3S92A 3GG3A 5D25A 5JWMA 4QC3A 4TT6A 5CQ5A 4A9MA 3G0JA 4QNSA 5CS8A 4PS5A 5EWWA 3O33A 4UYGA 5A5QA 4QSUA 4NR4A 1EQFA 4FLPA 2GRCA 4BW2A 4AKNA 4NR7A 5I88A 5DYCA 2R0VA 4CUUA 5E9MA 5H1TA 3NXBA 5KO4A 5FH7A 5F1HA 4QSRA 4YK0A 3O34A 5A83A 2I8NA 5KTUA 2DVQA 5ENGA 5FH8A 2R10A 2YW5A 3MXFA 4QZSA 4UITA 5F2PA 3QZVA 5I1QA 4O7EA 4YYNA 2NXBA 3MUKA 4HBXA 5CP5A 5AMFA 4A9NA 4ZW1A 5D0CA 5CQ4A 1ZKRA 4IOQA 5CPEA 5LJ2A 4YY6A 5EPBA 5HRVA 3U5PA 5A81A 4YYGA 4QYLA 4XUAA 3U5OA 5E0RA 5D26A 5ENBA 4NR5A 4C67A 2OUOA 4WIVA 4TZ8A 4PY6A 5EU1A 4YAXA 4ZQLA 1E6IA 3UVYA 4IR6A 4LYSA 4N3WA 5I89A 5FG6A 5TB6A 4MEOA 3P1EA 4UYHA 4J0SA 5DW2A 4A9HA 3QZTA 4HBWA 3U5KA 5LUUA 4XUBA 2YEMA 4KV4A 4QSTA 4O75A 5ENHA 4PKLA 4UIVA 4YYHA 5G4SA 2OSSA 3LQIA 5AMEA 5EGUA 4A9FA 4YYDA 4CURA 4MENA 2D9EA 2RNYA 2FSAA 4O76A 5CUBA 5I40A 2MJVB 5A82A 5H1VA 2DVVA 2E3KA 5CQAA 5C89A 5I7YA 3JVMA 5LVQA 4KV1A 5I80A 5E9IA 5LVRA 5I29A 4Y03A 4HXKA 5CQ3A 3P5OA 5EWCA 5D3HA 5E9LA 4CLBA 3S91A 2DWWA 3RCWA 3SVHA 4O74A 5DYAA 4X2IA 4YH4A 2L5EA 5CQ7A 5DFBA 4TTEA 3SVFA 5ETBA 5I7XA 2KTBB 1N72A 3P1DA 5LKXA 4NYVA 5II1A 5LKZA 5FE3A 5D3NA 4ALHA 5AD2A 5L98A 5EWVA 5DYXA 4O71A 5CQTA 5FFVA 4NQMA 4TT2A 5KU3A 4ZC9A 5H85A 2YELA 1X0JA 3ZYUA 5ENJA 5EV9A 5EM3A 5L8TA 4QEWA 4UYFA 5FB1A 4UYFB 3JVJA 5CUCA 3TLPA 5C87A 5EPSA 3U5NA 5LKTA 5HQ6A 4LR6A 4YH3A 4TU4A 3P1CA 5ENCA 3MQMA 4CFKA 3UVWA 2RNWA 2RFJA 3O35A 5L96A 3MB4A 2H60A 5F61A 3HMFA 5DKCA 5C8GA 5I83A 4A9IA 4O7FA 4HBVA 5HELA 5ACYA 4MEQA 5HQ5A 4TQNA 2G4AA 5E7DA 5D3SA 4QC1A 5E3DA 4PCEA 4CFLA 3UVXA 4Q0OA 3MULA 5D24A 5KHMA 4HXPA 1WUMA 4QSVA 3D1BA 5DLXA 4N4HA 3FKMX 4NRCA 5E9VA 5EI4A 4QR4A 5FG5A 5CFWA 5HFRA 4HXSA 3Q2FA 4AI6A 5J0DA 4NYWA 4BW3A 5A7CA 4HBYA 3DAIA 4Z6IA 4NXJA 5D3RA 2WP1A 4KCXA 4CUPA 2F6JA 3JVLA 4O72A 5IBNA 2RI7A 5JI8A 5FE9A 5KTWA 4IR3A 5EA1A 5A5OA 4O77A 5F62A 5F36A 5DYUA 4AKIA 2OO1A 5DKDA 5IG6A 4HXOA 4NR6A 4MR4A 4QYDA 1JM4B 5C85A 5K29A 5ENFA 4NRAA 3HMEA 5DBMA 5L97A 5HENA 4LZ2A 4TT4A 5HRWA 5FG4A 5FFWA 4YBTA 3VKGA 3G0LA 4J1PA 4A9OA 3K2JA 4Z1SA 4QUUA 5D7XA 5G4RA 5FBXA 1JSPB 5D3LA 4C66A 4OGJA 5CUGA 4UIWA 5D3TA 5AD3A 4O7BA
chains in the Genus database with same CATH topology
3IU5A 5IGNA 2E7OA 4MR3A 4O7CA 5A5RA 4J0RA 4NRBA 4YATA 5LKUA 5C4QA 5F3AA 4QB3A 4IR4A 3LXJA 5E73A 1ZS5A 4MR6A 3O36A 2N9GA 5IIDA 3AADA 5FE2A 4HXLA 4QEUA 5LJ1A 2LSPB 4YBMA 4YBSA 5HJCA 4A9EA 5I86A 4QR5A 4N4FA 5E9YA 3IU6A 5HFQA 4CL9A 5L8UA 5ENEA 5HRXA 4A9KA 3ONIA 4IR5A 5F63A 2WP2A 5H1UA 2YDWA 4LDFA 1F68A 2YEKA 4PCIA 1WUGA 4TS8A 4O70A 5FE4A 5EISA 3LQJA 2D82A 5TCMA 5ENIA 5DY7A 5HM0A 5KTXA 5DFDA 4BJXA 3Q2EA 4OGIA 5CUAA 2L85A 5EK9A 4UYDA 4HXNA 4E96A 4MR5A 2RS9B 4QSPA 3UV5A 5F25A 4NUEA 4QR3A 5CUDA 2DVRA 5BT3A 5IGLA 2L84A 5DKHA 5FE5A 3HMHA 4QY4A 3UV4A 5BT4A 5A85A 4O78A 3U5MA 4Z93A 5HEMA 4YABA 5II2A 3O37A 3LJWA 3LQHA 5C7NA 4LRGA 3UV2A 5EWHA 5A5PA 4NUCA 3AQAA 5FDZA 4OUFA 5A5SA 4PTBA 2YYNA 4DONA 4YYIA 4NR9A 5DX4A 3UW9A 5HLSA 5DW1A 5DFCA 5L99A 4Q0NA 4QSWA 5CQ6A 5E9KA 3SVGA 4MEPA 2E7NA 4UIUA 3JVKA 5FH6A 5EP7A 5F60A 3U5JA 5D3JA 4WHWA 5FB0A 5CQ8A 2F6NA 5EPRA 4XYAA 4LYIA 4QSQA 5CRMA 5FE0A 5FE6A 2DATA 5CZGA 3UVDA 5CTLA 4O7AA 2DVSA 3I3JA 4LC2A 5HCLA 3D7CA 4N4IA 4TZ2A 5EQ1A 5F1LA 4NUDA 4QEVA 4HXRA 4RVRA 3DWYA 4XY8A 4QBMA 4BW1A 4YYMA 4N4GA 3MB3A 4WHUA 4IOOA 5BT5A 3U5LA 5LJ0A 4UIYA 3P1FA 4UIXA 4CUQA 4TU6A 5D3PA 4YY4A 5CGPA 5FFYA 5FE7A 2RNXA 4YYJA 4NR8A 5DLZA 5ETDA 4Z6HA 5FE8A 5COIA 2R0SA 5F5ZA 4Z1QA 4UIZA 5EICA 4QUTA 2RO1A 4YC9A 5CUEA 4J3IA 4XY9A 3QZSA 5E3GA 2I7KA 4NS5A 4IORA 5IGMA 5IGKA 4YADA 5EVAA 4A9LA 4F3IA 5CY9A 5A5NA 4QSXA 5E74A 4GPJA 4BHWA 4A9JA 4BW4A 4CUSA 4QSSA 5CRZA 4LZSA 4LYWA 4LZRA 5FE1A 2DKWA 4CUTA 4NQNA 4YYKA 4ALGA 2YQDA 2R0YA 4NYXA 5CU8A 4HXMA 4TYLA 5EWDA 5HQ7A 4UYEA 3S92A 3GG3A 5D25A 5JWMA 4QC3A 4TT6A 5CQ5A 4A9MA 3G0JA 4QNSA 5CS8A 4PS5A 5EWWA 3O33A 4UYGA 5A5QA 4QSUA 4NR4A 1EQFA 4FLPA 2GRCA 4BW2A 4AKNA 4NR7A 5I88A 5DYCA 2R0VA 4CUUA 5E9MA 5H1TA 3NXBA 5KO4A 5FH7A 5F1HA 4QSRA 4YK0A 3O34A 5A83A 2I8NA 5KTUA 2DVQA 5ENGA 5FH8A 2R10A 2YW5A 3MXFA 4QZSA 4UITA 5F2PA 3QZVA 5I1QA 4O7EA 4YYNA 2NXBA 3MUKA 4HBXA 5CP5A 5AMFA 4A9NA 4ZW1A 5D0CA 5CQ4A 4IOQA 5CPEA 5LJ2A 4YY6A 5EPBA 5HRVA 3U5PA 5A81A 4YYGA 4QYLA 4XUAA 3U5OA 5E0RA 5D26A 5ENBA 4NR5A 4C67A 2OUOA 4WIVA 4TZ8A 4PY6A 5EU1A 4YAXA 4ZQLA 1E6IA 3UVYA 4IR6A 4LYSA 4N3WA 5I89A 5FG6A 5TB6A 4MEOA 3P1EA 4UYHA 4J0SA 5DW2A 4A9HA 3QZTA 4HBWA 3U5KA 5LUUA 4XUBA 2YEMA 4KV4A 4QSTA 4O75A 5ENHA 4PKLA 4UIVA 4YYHA 5G4SA 2OSSA 3LQIA 5AMEA 5EGUA 4A9FA 4YYDA 4CURA 4MENA 2D9EA 2RNYA 2FSAA 4O76A 5CUBA 5I40A 2MJVB 5A82A 5H1VA 2DVVA 2E3KA 5CQAA 5C89A 5I7YA 3JVMA 5LVQA 4KV1A 5I80A 5E9IA 5LVRA 5I29A 4Y03A 4HXKA 5CQ3A 3P5OA 5EWCA 5D3HA 5E9LA 4CLBA 3S91A 2DWWA 3RCWA 3SVHA 4O74A 5DYAA 4X2IA 4YH4A 2L5EA 5CQ7A 5DFBA 4TTEA 3SVFA 5ETBA 5I7XA 2KTBB 1N72A 3P1DA 5LKXA 4NYVA 5II1A 5LKZA 5FE3A 5D3NA 4ALHA 5AD2A 5L98A 5EWVA 5DYXA 4O71A 5CQTA 5FFVA 4NQMA 4TT2A 5KU3A 4ZC9A 5H85A 2YELA 1X0JA 3ZYUA 5ENJA 5EV9A 5EM3A 5L8TA 4QEWA 4UYFA 5FB1A 4UYFB 3JVJA 5CUCA 3TLPA 5C87A 5EPSA 3U5NA 5LKTA 5HQ6A 4LR6A 4YH3A 4TU4A 3P1CA 5ENCA 3MQMA 4CFKA 3UVWA 2RNWA 2RFJA 3O35A 5L96A 3MB4A 2H60A 5F61A 3HMFA 5DKCA 5C8GA 5I83A 4A9IA 4O7FA 4HBVA 5HELA 5ACYA 4MEQA 5HQ5A 4TQNA 2G4AA 5E7DA 5D3SA 4QC1A 5E3DA 4PCEA 4CFLA 3UVXA 4Q0OA 3MULA 5D24A 5KHMA 4HXPA 1WUMA 4QSVA 5DLXA 4N4HA 3FKMX 4NRCA 5E9VA 5EI4A 4QR4A 5FG5A 5CFWA 5HFRA 4HXSA 3Q2FA 5J0DA 4NYWA 4BW3A 5A7CA 4HBYA 3DAIA 4Z6IA 4NXJA 5D3RA 2WP1A 4KCXA 4CUPA 2F6JA 3JVLA 4O72A 5IBNA 2RI7A 5JI8A 5FE9A 5KTWA 4IR3A 5EA1A 5A5OA 4O77A 5F62A 5F36A 5DYUA 2OO1A 5DKDA 5IG6A 4HXOA 4NR6A 4MR4A 4QYDA 1JM4B 5C85A 5K29A 5ENFA 4NRAA 3HMEA 5DBMA 5L97A 5HENA 4LZ2A 4TT4A 5HRWA 5FG4A 5FFWA 4YBTA 3G0LA 4J1PA 4A9OA 3K2JA 4Z1SA 4QUUA 5D7XA 5G4RA 5FBXA 1JSPB 5D3LA 4C66A 4OGJA 5CUGA 4UIWA 5D3TA 5AD3A 4O7BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IU5 A;  5IGN A;  2E7O A;  4MR3 A;  4O7C A;  5A5R A;  4J0R A;  4NRB A;  4YAT A;  5LKU A;  5C4Q A;  5F3A A;  4QB3 A;  4IR4 A;  3LXJ A;  5E73 A;  1ZS5 A;  4MR6 A;  3O36 A;  2N9G A;  5IID A;  3AAD A;  5FE2 A;  4HXL A;  4QEU A;  5LJ1 A;  2LSP B;  4YBM A;  4YBS A;  5HJC A;  4A9E A;  5I86 A;  4QR5 A;  4N4F A;  5E9Y A;  3IU6 A;  5HFQ A;  4CL9 A;  5L8U A;  5ENE A;  5HRX A;  4A9K A;  3ONI A;  4IR5 A;  5F63 A;  2WP2 A;  5H1U A;  2YDW A;  4LDF A;  1F68 A;  2YEK A;  4PCI A;  1WUG A;  4TS8 A;  4O70 A;  5FE4 A;  5EIS A;  3LQJ A;  2D82 A;  5TCM A;  5ENI A;  5DY7 A;  5HM0 A;  5KTX A;  5DFD A;  4BJX A;  3Q2E A;  4OGI A;  5CUA A;  2L85 A;  5EK9 A;  4UYD A;  4HXN A;  4E96 A;  4MR5 A;  2RS9 B;  4QSP A;  3UV5 A;  5F25 A;  4NUE A;  4QR3 A;  5CUD A;  2DVR A;  5BT3 A;  5IGL A;  2L84 A;  5DKH A;  5FE5 A;  3HMH A;  4QY4 A;  3UV4 A;  5BT4 A;  5A85 A;  4O78 A;  3U5M A;  4Z93 A;  5HEM A;  4YAB A;  5II2 A;  3O37 A;  3LJW A;  3LQH A;  5C7N A;  4LRG A;  3UV2 A;  5EWH A;  5A5P A;  4NUC A;  3AQA A;  5FDZ A;  4OUF A;  5A5S A;  4PTB A;  2YYN A;  4DON A;  4YYI A;  4NR9 A;  5DX4 A;  3UW9 A;  5HLS A;  5DW1 A;  5DFC A;  5L99 A;  4Q0N A;  4QSW A;  5CQ6 A;  5E9K A;  3SVG A;  4MEP A;  2E7N A;  4UIU A;  3JVK A;  5FH6 A;  5EP7 A;  5F60 A;  3U5J A;  5D3J A;  4WHW A;  5FB0 A;  5CQ8 A;  2F6N A;  5EPR A;  4XYA A;  4LYI A;  4QSQ A;  5CRM A;  5FE0 A;  5FE6 A;  2DAT A;  5CZG A;  3UVD A;  5CTL A;  4O7A A;  2DVS A;  3I3J A;  4LC2 A;  5HCL A;  3D7C A;  4N4I A;  4TZ2 A;  5EQ1 A;  5F1L A;  4NUD A;  4QEV A;  4HXR A;  4RVR A;  3DWY A;  4XY8 A;  4QBM A;  4BW1 A;  4YYM A;  4N4G A;  3MB3 A;  4WHU A;  4IOO A;  5BT5 A;  3U5L A;  5LJ0 A;  4UIY A;  3P1F A;  4UIX A;  4CUQ A;  4TU6 A;  5D3P A;  4YY4 A;  5CGP A;  5FFY A;  5FE7 A;  2RNX A;  4YYJ A;  4NR8 A;  5DLZ A;  5ETD A;  4Z6H A;  5FE8 A;  5COI A;  2R0S A;  5F5Z A;  4Z1Q A;  4UIZ A;  5EIC A;  4QUT A;  2RO1 A;  4YC9 A;  5CUE A;  4J3I A;  4XY9 A;  3QZS A;  5E3G A;  2I7K A;  4NS5 A;  4IOR A;  5IGM A;  5IGK A;  4YAD A;  5EVA A;  4A9L A;  4F3I A;  5CY9 A;  5A5N A;  4QSX A;  5E74 A;  4GPJ A;  4BHW A;  4A9J A;  4BW4 A;  4CUS A;  4QSS A;  5CRZ A;  4LZS A;  4LYW A;  4LZR A;  5FE1 A;  2DKW A;  4CUT A;  4NQN A;  4YYK A;  4ALG A;  2YQD A;  2R0Y A;  4NYX A;  5CU8 A;  4HXM A;  4TYL A;  5EWD A;  5HQ7 A;  4UYE A;  3S92 A;  3GG3 A;  5D25 A;  5JWM A;  4QC3 A;  4TT6 A;  5CQ5 A;  4A9M A;  3G0J A;  4QNS A;  5CS8 A;  4PS5 A;  5EWW A;  3O33 A;  4UYG A;  5A5Q A;  4QSU A;  4NR4 A;  1EQF A;  4FLP A;  2GRC A;  4BW2 A;  4AKN A;  4NR7 A;  5I88 A;  5DYC A;  2R0V A;  4CUU A;  5E9M A;  5H1T A;  3NXB A;  5KO4 A;  5FH7 A;  5F1H A;  4QSR A;  4YK0 A;  3O34 A;  5A83 A;  2I8N A;  5KTU A;  2DVQ A;  5ENG A;  5FH8 A;  2R10 A;  2YW5 A;  3MXF A;  4QZS A;  4UIT A;  5F2P A;  3QZV A;  5I1Q A;  4O7E A;  4YYN A;  2NXB A;  3MUK A;  4HBX A;  5CP5 A;  5AMF A;  4A9N A;  4ZW1 A;  5D0C A;  5CQ4 A;  4IOQ A;  5CPE A;  5LJ2 A;  4YY6 A;  5EPB A;  5HRV A;  3U5P A;  5A81 A;  4YYG A;  4QYL A;  4XUA A;  3U5O A;  5E0R A;  5D26 A;  5ENB A;  4NR5 A;  4C67 A;  2OUO A;  4WIV A;  4TZ8 A;  4PY6 A;  5EU1 A;  4YAX A;  4ZQL A;  1E6I A;  3UVY A;  4IR6 A;  4LYS A;  4N3W A;  5I89 A;  5FG6 A;  5TB6 A;  4MEO A;  3P1E A;  4UYH A;  4J0S A;  5DW2 A;  4A9H A;  3QZT A;  4HBW A;  3U5K A;  5LUU A;  4XUB A;  2YEM A;  4KV4 A;  4QST A;  4O75 A;  5ENH A;  4PKL A;  4UIV A;  4YYH A;  5G4S A;  2OSS A;  3LQI A;  5AME A;  5EGU A;  4A9F A;  4YYD A;  4CUR A;  4MEN A;  2D9E A;  2RNY A;  2FSA A;  4O76 A;  5CUB A;  5I40 A;  2MJV B;  5A82 A;  5H1V A;  2DVV A;  2E3K A;  5CQA A;  5C89 A;  5I7Y A;  3JVM A;  5LVQ A;  4KV1 A;  5I80 A;  5E9I A;  5LVR A;  5I29 A;  4Y03 A;  4HXK A;  5CQ3 A;  3P5O A;  5EWC A;  5D3H A;  5E9L A;  4CLB A;  3S91 A;  2DWW A;  3RCW A;  3SVH A;  4O74 A;  5DYA A;  4X2I A;  4YH4 A;  2L5E A;  5CQ7 A;  5DFB A;  4TTE A;  3SVF A;  5ETB A;  5I7X A;  2KTB B;  1N72 A;  3P1D A;  5LKX A;  4NYV A;  5II1 A;  5LKZ A;  5FE3 A;  5D3N A;  4ALH A;  5AD2 A;  5L98 A;  5EWV A;  5DYX A;  4O71 A;  5CQT A;  5FFV A;  4NQM A;  4TT2 A;  5KU3 A;  4ZC9 A;  5H85 A;  2YEL A;  1X0J A;  3ZYU A;  5ENJ A;  5EV9 A;  5EM3 A;  5L8T A;  4QEW A;  4UYF A;  5FB1 A;  4UYF B;  3JVJ A;  5CUC A;  3TLP A;  5C87 A;  5EPS A;  3U5N A;  5LKT A;  5HQ6 A;  4LR6 A;  4YH3 A;  4TU4 A;  3P1C A;  5ENC A;  3MQM A;  4CFK A;  3UVW A;  2RNW A;  2RFJ A;  3O35 A;  5L96 A;  3MB4 A;  2H60 A;  5F61 A;  3HMF A;  5DKC A;  5C8G A;  5I83 A;  4A9I A;  4O7F A;  4HBV A;  5HEL A;  5ACY A;  4MEQ A;  5HQ5 A;  4TQN A;  2G4A A;  5E7D A;  5D3S A;  4QC1 A;  5E3D A;  4PCE A;  4CFL A;  3UVX A;  4Q0O A;  3MUL A;  5D24 A;  5KHM A;  4HXP A;  1WUM A;  4QSV A;  5DLX A;  4N4H A;  3FKM X;  4NRC A;  5E9V A;  5EI4 A;  4QR4 A;  5FG5 A;  5CFW A;  5HFR A;  4HXS A;  3Q2F A;  5J0D A;  4NYW A;  4BW3 A;  5A7C A;  4HBY A;  3DAI A;  4Z6I A;  4NXJ A;  5D3R A;  2WP1 A;  4KCX A;  4CUP A;  2F6J A;  3JVL A;  4O72 A;  5IBN A;  2RI7 A;  5JI8 A;  5FE9 A;  5KTW A;  4IR3 A;  5EA1 A;  5A5O A;  4O77 A;  5F62 A;  5F36 A;  5DYU A;  2OO1 A;  5DKD A;  5IG6 A;  4HXO A;  4NR6 A;  4MR4 A;  4QYD A;  1JM4 B;  5C85 A;  5K29 A;  5ENF A;  4NRA A;  3HME A;  5DBM A;  5L97 A;  5HEN A;  4LZ2 A;  4TT4 A;  5HRW A;  5FG4 A;  5FFW A;  4YBT A;  3G0L A;  4J1P A;  4A9O A;  3K2J A;  4Z1S A;  4QUU A;  5D7X A;  5G4R A;  5FBX A;  1JSP B;  5D3L A;  4C66 A;  4OGJ A;  5CUG A;  4UIW A;  5D3T A;  5AD3 A;  4O7B A; 
#chains in the Genus database with same CATH topology
 3IU5 A;  5IGN A;  3D1D A;  2E7O A;  4MR3 A;  4O7C A;  5A5R A;  4J0R A;  4NRB A;  4YAT A;  5LKU A;  5C4Q A;  5F3A A;  4QB3 A;  3ERR A;  4IR4 A;  3LXJ A;  5E73 A;  1ZS5 A;  4MR6 A;  3O36 A;  2N9G A;  5IID A;  3AAD A;  5FE2 A;  4HXL A;  4QEU A;  5LJ1 A;  2LSP B;  4YBM A;  4YBS A;  5HJC A;  4A9E A;  5I86 A;  4QR5 A;  4N4F A;  5E9Y A;  3IU6 A;  5HFQ A;  4CL9 A;  5L8U A;  5ENE A;  5HRX A;  4A9K A;  3ONI A;  4IR5 A;  5F63 A;  3VKH A;  2WP2 A;  5H1U A;  2YDW A;  4LDF A;  1F68 A;  2YEK A;  4PCI A;  1WUG A;  4TS8 A;  4O70 A;  5FE4 A;  5EIS A;  3LQJ A;  2D82 A;  5TCM A;  5ENI A;  5DY7 A;  5HM0 A;  5KTX A;  5DFD A;  4BJX A;  3Q2E A;  4OGI A;  5CUA A;  2L85 A;  5EK9 A;  4UYD A;  4HXN A;  4E96 A;  4MR5 A;  2RS9 B;  4QSP A;  3UV5 A;  5F25 A;  4AKH A;  4NUE A;  4QR3 A;  5CUD A;  2DVR A;  5BT3 A;  5IGL A;  2L84 A;  5DKH A;  5FE5 A;  3HMH A;  4QY4 A;  3UV4 A;  5BT4 A;  5A85 A;  4O78 A;  3U5M A;  4Z93 A;  5HEM A;  4YAB A;  5II2 A;  3O37 A;  3LJW A;  3LQH A;  5C7N A;  4LRG A;  3UV2 A;  5EWH A;  5A5P A;  4NUC A;  3AQA A;  5FDZ A;  4OUF A;  5A5S A;  4PTB A;  2YYN A;  4DON A;  4YYI A;  4NR9 A;  5DX4 A;  3UW9 A;  5HLS A;  5DW1 A;  5DFC A;  5L99 A;  4Q0N A;  4QSW A;  5CQ6 A;  5E9K A;  3SVG A;  4MEP A;  2E7N A;  4UIU A;  3JVK A;  5FH6 A;  5EP7 A;  5F60 A;  3U5J A;  5D3J A;  4WHW A;  5FB0 A;  5CQ8 A;  2F6N A;  5EPR A;  4XYA A;  4LYI A;  4QSQ A;  5CRM A;  5FE0 A;  5FE6 A;  2DAT A;  5CZG A;  3UVD A;  5CTL A;  4O7A A;  2DVS A;  3I3J A;  4LC2 A;  5HCL A;  3D7C A;  1PUO A;  4N4I A;  4TZ2 A;  5EQ1 A;  5F1L A;  4NUD A;  4AKG A;  4QEV A;  4HXR A;  4RVR A;  3DWY A;  4XY8 A;  4QBM A;  4BW1 A;  4YYM A;  4N4G A;  3MB3 A;  4WHU A;  4IOO A;  5BT5 A;  3U5L A;  5LJ0 A;  4UIY A;  3P1F A;  4UIX A;  4CUQ A;  4TU6 A;  5D3P A;  4YY4 A;  5CGP A;  5FFY A;  5FE7 A;  2RNX A;  4YYJ A;  4NR8 A;  5DLZ A;  5ETD A;  4Z6H A;  5FE8 A;  5COI A;  2R0S A;  5F5Z A;  4Z1Q A;  4UIZ A;  5EIC A;  4QUT A;  2RO1 A;  4YC9 A;  5CUE A;  4J3I A;  4XY9 A;  3QZS A;  5E3G A;  2I7K A;  4NS5 A;  4IOR A;  5IGM A;  5IGK A;  4YAD A;  5EVA A;  4A9L A;  4F3I A;  5CY9 A;  5A5N A;  4QSX A;  5E74 A;  4GPJ A;  4BHW A;  4A9J A;  4BW4 A;  4CUS A;  4QSS A;  5CRZ A;  4LZS A;  2EJN A;  4LYW A;  4LZR A;  5FE1 A;  2DKW A;  4CUT A;  4NQN A;  4YYK A;  4ALG A;  2YQD A;  2R0Y A;  4NYX A;  5CU8 A;  4HXM A;  4TYL A;  5EWD A;  5HQ7 A;  4UYE A;  3S92 A;  3GG3 A;  5D25 A;  5JWM A;  4QC3 A;  4TT6 A;  5CQ5 A;  4A9M A;  3G0J A;  4QNS A;  5CS8 A;  4PS5 A;  5EWW A;  3O33 A;  4UYG A;  5A5Q A;  4QSU A;  4NR4 A;  1EQF A;  4FLP A;  2GRC A;  4BW2 A;  4AKN A;  4NR7 A;  5I88 A;  5DYC A;  2R0V A;  4CUU A;  5E9M A;  5H1T A;  3NXB A;  5KO4 A;  5FH7 A;  5F1H A;  4QSR A;  4YK0 A;  3O34 A;  5A83 A;  2I8N A;  5KTU A;  2DVQ A;  5ENG A;  5FH8 A;  2R10 A;  2YW5 A;  3MXF A;  4QZS A;  4UIT A;  5F2P A;  3QZV A;  5I1Q A;  4O7E A;  4YYN A;  2NXB A;  3MUK A;  4HBX A;  5CP5 A;  5AMF A;  4A9N A;  4ZW1 A;  5D0C A;  5CQ4 A;  1ZKR A;  4IOQ A;  5CPE A;  5LJ2 A;  4YY6 A;  5EPB A;  5HRV A;  3U5P A;  5A81 A;  4YYG A;  4QYL A;  4XUA A;  3U5O A;  5E0R A;  5D26 A;  5ENB A;  4NR5 A;  4C67 A;  2OUO A;  4WIV A;  4TZ8 A;  4PY6 A;  5EU1 A;  4YAX A;  4ZQL A;  1E6I A;  3UVY A;  4IR6 A;  4LYS A;  4N3W A;  5I89 A;  5FG6 A;  5TB6 A;  4MEO A;  3P1E A;  4UYH A;  4J0S A;  5DW2 A;  4A9H A;  3QZT A;  4HBW A;  3U5K A;  5LUU A;  4XUB A;  2YEM A;  4KV4 A;  4QST A;  4O75 A;  5ENH A;  4PKL A;  4UIV A;  4YYH A;  5G4S A;  2OSS A;  3LQI A;  5AME A;  5EGU A;  4A9F A;  4YYD A;  4CUR A;  4MEN A;  2D9E A;  2RNY A;  2FSA A;  4O76 A;  5CUB A;  5I40 A;  2MJV B;  5A82 A;  5H1V A;  2DVV A;  2E3K A;  5CQA A;  5C89 A;  5I7Y A;  3JVM A;  5LVQ A;  4KV1 A;  5I80 A;  5E9I A;  5LVR A;  5I29 A;  4Y03 A;  4HXK A;  5CQ3 A;  3P5O A;  5EWC A;  5D3H A;  5E9L A;  4CLB A;  3S91 A;  2DWW A;  3RCW A;  3SVH A;  4O74 A;  5DYA A;  4X2I A;  4YH4 A;  2L5E A;  5CQ7 A;  5DFB A;  4TTE A;  3SVF A;  5ETB A;  5I7X A;  2KTB B;  1N72 A;  3P1D A;  5LKX A;  4NYV A;  5II1 A;  5LKZ A;  5FE3 A;  5D3N A;  4ALH A;  5AD2 A;  5L98 A;  5EWV A;  5DYX A;  4O71 A;  5CQT A;  5FFV A;  4NQM A;  4TT2 A;  5KU3 A;  4ZC9 A;  5H85 A;  2YEL A;  1X0J A;  3ZYU A;  5ENJ A;  5EV9 A;  5EM3 A;  5L8T A;  4QEW A;  4UYF A;  5FB1 A;  4UYF B;  3JVJ A;  5CUC A;  3TLP A;  5C87 A;  5EPS A;  3U5N A;  5LKT A;  5HQ6 A;  4LR6 A;  4YH3 A;  4TU4 A;  3P1C A;  5ENC A;  3MQM A;  4CFK A;  3UVW A;  2RNW A;  2RFJ A;  3O35 A;  5L96 A;  3MB4 A;  2H60 A;  5F61 A;  3HMF A;  5DKC A;  5C8G A;  5I83 A;  4A9I A;  4O7F A;  4HBV A;  5HEL A;  5ACY A;  4MEQ A;  5HQ5 A;  4TQN A;  2G4A A;  5E7D A;  5D3S A;  4QC1 A;  5E3D A;  4PCE A;  4CFL A;  3UVX A;  4Q0O A;  3MUL A;  5D24 A;  5KHM A;  4HXP A;  1WUM A;  4QSV A;  3D1B A;  5DLX A;  4N4H A;  3FKM X;  4NRC A;  5E9V A;  5EI4 A;  4QR4 A;  5FG5 A;  5CFW A;  5HFR A;  4HXS A;  3Q2F A;  4AI6 A;  5J0D A;  4NYW A;  4BW3 A;  5A7C A;  4HBY A;  3DAI A;  4Z6I A;  4NXJ A;  5D3R A;  2WP1 A;  4KCX A;  4CUP A;  2F6J A;  3JVL A;  4O72 A;  5IBN A;  2RI7 A;  5JI8 A;  5FE9 A;  5KTW A;  4IR3 A;  5EA1 A;  5A5O A;  4O77 A;  5F62 A;  5F36 A;  5DYU A;  4AKI A;  2OO1 A;  5DKD A;  5IG6 A;  4HXO A;  4NR6 A;  4MR4 A;  4QYD A;  1JM4 B;  5C85 A;  5K29 A;  5ENF A;  4NRA A;  3HME A;  5DBM A;  5L97 A;  5HEN A;  4LZ2 A;  4TT4 A;  5HRW A;  5FG4 A;  5FFW A;  4YBT A;  3VKG A;  3G0L A;  4J1P A;  4A9O A;  3K2J A;  4Z1S A;  4QUU A;  5D7X A;  5G4R A;  5FBX A;  1JSP B;  5D3L A;  4C66 A;  4OGJ A;  5CUG A;  4UIW A;  5D3T A;  5AD3 A;  4O7B A; 
#chains in the Genus database with same CATH homology
 3IU5 A;  5IGN A;  2E7O A;  4MR3 A;  4O7C A;  5A5R A;  4J0R A;  4NRB A;  4YAT A;  5LKU A;  5C4Q A;  5F3A A;  4QB3 A;  4IR4 A;  3LXJ A;  5E73 A;  1ZS5 A;  4MR6 A;  3O36 A;  2N9G A;  5IID A;  3AAD A;  5FE2 A;  4HXL A;  4QEU A;  5LJ1 A;  2LSP B;  4YBM A;  4YBS A;  5HJC A;  4A9E A;  5I86 A;  4QR5 A;  4N4F A;  5E9Y A;  3IU6 A;  5HFQ A;  4CL9 A;  5L8U A;  5ENE A;  5HRX A;  4A9K A;  3ONI A;  4IR5 A;  5F63 A;  2WP2 A;  5H1U A;  2YDW A;  4LDF A;  1F68 A;  2YEK A;  4PCI A;  1WUG A;  4TS8 A;  4O70 A;  5FE4 A;  5EIS A;  3LQJ A;  2D82 A;  5TCM A;  5ENI A;  5DY7 A;  5HM0 A;  5KTX A;  5DFD A;  4BJX A;  3Q2E A;  4OGI A;  5CUA A;  2L85 A;  5EK9 A;  4UYD A;  4HXN A;  4E96 A;  4MR5 A;  2RS9 B;  4QSP A;  3UV5 A;  5F25 A;  4NUE A;  4QR3 A;  5CUD A;  2DVR A;  5BT3 A;  5IGL A;  2L84 A;  5DKH A;  5FE5 A;  3HMH A;  4QY4 A;  3UV4 A;  5BT4 A;  5A85 A;  4O78 A;  3U5M A;  4Z93 A;  5HEM A;  4YAB A;  5II2 A;  3O37 A;  3LJW A;  3LQH A;  5C7N A;  4LRG A;  3UV2 A;  5EWH A;  5A5P A;  4NUC A;  3AQA A;  5FDZ A;  4OUF A;  5A5S A;  4PTB A;  2YYN A;  4DON A;  4YYI A;  4NR9 A;  5DX4 A;  3UW9 A;  5HLS A;  5DW1 A;  5DFC A;  5L99 A;  4Q0N A;  4QSW A;  5CQ6 A;  5E9K A;  3SVG A;  4MEP A;  2E7N A;  4UIU A;  3JVK A;  5FH6 A;  5EP7 A;  5F60 A;  3U5J A;  5D3J A;  4WHW A;  5FB0 A;  5CQ8 A;  2F6N A;  5EPR A;  4XYA A;  4LYI A;  4QSQ A;  5CRM A;  5FE0 A;  5FE6 A;  2DAT A;  5CZG A;  3UVD A;  5CTL A;  4O7A A;  2DVS A;  3I3J A;  4LC2 A;  5HCL A;  3D7C A;  4N4I A;  4TZ2 A;  5EQ1 A;  5F1L A;  4NUD A;  4QEV A;  4HXR A;  4RVR A;  3DWY A;  4XY8 A;  4QBM A;  4BW1 A;  4YYM A;  4N4G A;  3MB3 A;  4WHU A;  4IOO A;  5BT5 A;  3U5L A;  5LJ0 A;  4UIY A;  3P1F A;  4UIX A;  4CUQ A;  4TU6 A;  5D3P A;  4YY4 A;  5CGP A;  5FFY A;  5FE7 A;  2RNX A;  4YYJ A;  4NR8 A;  5DLZ A;  5ETD A;  4Z6H A;  5FE8 A;  5COI A;  2R0S A;  5F5Z A;  4Z1Q A;  4UIZ A;  5EIC A;  4QUT A;  2RO1 A;  4YC9 A;  5CUE A;  4J3I A;  4XY9 A;  3QZS A;  5E3G A;  2I7K A;  4NS5 A;  4IOR A;  5IGM A;  5IGK A;  4YAD A;  5EVA A;  4A9L A;  4F3I A;  5CY9 A;  5A5N A;  4QSX A;  5E74 A;  4GPJ A;  4BHW A;  4A9J A;  4BW4 A;  4CUS A;  4QSS A;  5CRZ A;  4LZS A;  4LYW A;  4LZR A;  5FE1 A;  2DKW A;  4CUT A;  4NQN A;  4YYK A;  4ALG A;  2YQD A;  2R0Y A;  4NYX A;  5CU8 A;  4HXM A;  4TYL A;  5EWD A;  5HQ7 A;  4UYE A;  3S92 A;  3GG3 A;  5D25 A;  5JWM A;  4QC3 A;  4TT6 A;  5CQ5 A;  4A9M A;  3G0J A;  4QNS A;  5CS8 A;  4PS5 A;  5EWW A;  3O33 A;  4UYG A;  5A5Q A;  4QSU A;  4NR4 A;  1EQF A;  4FLP A;  2GRC A;  4BW2 A;  4AKN A;  4NR7 A;  5I88 A;  5DYC A;  2R0V A;  4CUU A;  5E9M A;  5H1T A;  3NXB A;  5KO4 A;  5FH7 A;  5F1H A;  4QSR A;  4YK0 A;  3O34 A;  5A83 A;  2I8N A;  5KTU A;  2DVQ A;  5ENG A;  5FH8 A;  2R10 A;  2YW5 A;  3MXF A;  4QZS A;  4UIT A;  5F2P A;  3QZV A;  5I1Q A;  4O7E A;  4YYN A;  2NXB A;  3MUK A;  4HBX A;  5CP5 A;  5AMF A;  4A9N A;  4ZW1 A;  5D0C A;  5CQ4 A;  4IOQ A;  5CPE A;  5LJ2 A;  4YY6 A;  5EPB A;  5HRV A;  3U5P A;  5A81 A;  4YYG A;  4QYL A;  4XUA A;  3U5O A;  5E0R A;  5D26 A;  5ENB A;  4NR5 A;  4C67 A;  2OUO A;  4WIV A;  4TZ8 A;  4PY6 A;  5EU1 A;  4YAX A;  4ZQL A;  1E6I A;  3UVY A;  4IR6 A;  4LYS A;  4N3W A;  5I89 A;  5FG6 A;  5TB6 A;  4MEO A;  3P1E A;  4UYH A;  4J0S A;  5DW2 A;  4A9H A;  3QZT A;  4HBW A;  3U5K A;  5LUU A;  4XUB A;  2YEM A;  4KV4 A;  4QST A;  4O75 A;  5ENH A;  4PKL A;  4UIV A;  4YYH A;  5G4S A;  2OSS A;  3LQI A;  5AME A;  5EGU A;  4A9F A;  4YYD A;  4CUR A;  4MEN A;  2D9E A;  2RNY A;  2FSA A;  4O76 A;  5CUB A;  5I40 A;  2MJV B;  5A82 A;  5H1V A;  2DVV A;  2E3K A;  5CQA A;  5C89 A;  5I7Y A;  3JVM A;  5LVQ A;  4KV1 A;  5I80 A;  5E9I A;  5LVR A;  5I29 A;  4Y03 A;  4HXK A;  5CQ3 A;  3P5O A;  5EWC A;  5D3H A;  5E9L A;  4CLB A;  3S91 A;  2DWW A;  3RCW A;  3SVH A;  4O74 A;  5DYA A;  4X2I A;  4YH4 A;  2L5E A;  5CQ7 A;  5DFB A;  4TTE A;  3SVF A;  5ETB A;  5I7X A;  2KTB B;  1N72 A;  3P1D A;  5LKX A;  4NYV A;  5II1 A;  5LKZ A;  5FE3 A;  5D3N A;  4ALH A;  5AD2 A;  5L98 A;  5EWV A;  5DYX A;  4O71 A;  5CQT A;  5FFV A;  4NQM A;  4TT2 A;  5KU3 A;  4ZC9 A;  5H85 A;  2YEL A;  1X0J A;  3ZYU A;  5ENJ A;  5EV9 A;  5EM3 A;  5L8T A;  4QEW A;  4UYF A;  5FB1 A;  4UYF B;  3JVJ A;  5CUC A;  3TLP A;  5C87 A;  5EPS A;  3U5N A;  5LKT A;  5HQ6 A;  4LR6 A;  4YH3 A;  4TU4 A;  3P1C A;  5ENC A;  3MQM A;  4CFK A;  3UVW A;  2RNW A;  2RFJ A;  3O35 A;  5L96 A;  3MB4 A;  2H60 A;  5F61 A;  3HMF A;  5DKC A;  5C8G A;  5I83 A;  4A9I A;  4O7F A;  4HBV A;  5HEL A;  5ACY A;  4MEQ A;  5HQ5 A;  4TQN A;  2G4A A;  5E7D A;  5D3S A;  4QC1 A;  5E3D A;  4PCE A;  4CFL A;  3UVX A;  4Q0O A;  3MUL A;  5D24 A;  5KHM A;  4HXP A;  1WUM A;  4QSV A;  5DLX A;  4N4H A;  3FKM X;  4NRC A;  5E9V A;  5EI4 A;  4QR4 A;  5FG5 A;  5CFW A;  5HFR A;  4HXS A;  3Q2F A;  5J0D A;  4NYW A;  4BW3 A;  5A7C A;  4HBY A;  3DAI A;  4Z6I A;  4NXJ A;  5D3R A;  2WP1 A;  4KCX A;  4CUP A;  2F6J A;  3JVL A;  4O72 A;  5IBN A;  2RI7 A;  5JI8 A;  5FE9 A;  5KTW A;  4IR3 A;  5EA1 A;  5A5O A;  4O77 A;  5F62 A;  5F36 A;  5DYU A;  2OO1 A;  5DKD A;  5IG6 A;  4HXO A;  4NR6 A;  4MR4 A;  4QYD A;  1JM4 B;  5C85 A;  5K29 A;  5ENF A;  4NRA A;  3HME A;  5DBM A;  5L97 A;  5HEN A;  4LZ2 A;  4TT4 A;  5HRW A;  5FG4 A;  5FFW A;  4YBT A;  3G0L A;  4J1P A;  4A9O A;  3K2J A;  4Z1S A;  4QUU A;  5D7X A;  5G4R A;  5FBX A;  1JSP B;  5D3L A;  4C66 A;  4OGJ A;  5CUG A;  4UIW A;  5D3T A;  5AD3 A;  4O7B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...