5A81A

Crystal structure of human atad2 bromodomain in complex with 8-(3r,4r) -3-(cyclohexylmethoxy)piperidin-4-yl-amino-3-methyl-1,2-dihydro-1,7- naphthyridin-2-one
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
130
structure length
130
Chain Sequence
SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICSNALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords ATPASE FAMILY AAA DOMAIN-CONTAINING PROTEIN 2
publication title Structure-Based Optimization of Naphthyridones Into Potent Atad2 Bromodomain Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 55
structure length 130
sequence length 130
ec nomenclature ec 3.6.1.3: Adenosinetriphosphatase.
pdb deposition date 2015-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5a81A00
4CUPA 4KCXA 2RS9B 3JVMA 4A9LA 2OUOA 5HRVA 4Y03A 5DFDA 5D3PA 4TS8A 5D3NA 4YC9A 5F1LA 3UVYA 4KV4A 5F3AA 4BHWA 5FH7A 5I80A 4YH3A 5ENHA 4HXNA 5H1VA 3U5LA 1ZS5A 3MUKA 5D3JA 5F60A 5L96A 5K29A 4TU6A 4MR3A 4YH4A 3NXBA 4A9OA 4YBSA 4MEQA 4BW3A 2YEMA 4YYMA 4CUTA 5CQ7A 4CFKA 2YW5A 3UVDA 5F61A 5H1UA 5ENFA 4ZC9A 5CUAA 4XY9A 5D7XA 4NR6A 5BT4A 4MR6A 2H60A 5DW1A 4YYDA 4HXRA 5ACYA 4J3IA 4O75A 4QC1A 4NR4A 4CURA 4PS5A 5C8GA 5E9KA 5EM3A 4UIXA 4IR6A 5F2PA 5LVRA 4HBVA 5CRMA 5CQ4A 5DKCA 3MB3A 4OUFA 3Q2FA 5DYAA 3P5OA 5FE8A 3HMFA 4NS5A 4NR7A 3SVGA 5CQ3A 3U5NA 5TB6A 2OO1A 5A5NA 4N4HA 5AMEA 5A82A 5H85A 5FFWA 3I3JA 2R0SA 1X0JA 4TT6A 5E9VA 5E9LA 2L84A 5ENGA 5KTWA 5EPBA 3U5KA 3QZVA 4O78A 5HFRA 2R0YA 1E6IA 4NR5A 4XUBA 5CFWA 5E74A 4YATA 4F3IA 4NUCA 5EI4A 5D3SA 5HRXA 4UIWA 2L85A 5CP5A 5ETDA 5HQ7A 4QSSA 4YADA 5FE0A 4HBYA 5L8TA 2D82A 5C89A 4WHUA 3QZTA 5I86A 5BT5A 2DKWA 5F25A 4YABA 4IR5A 5D3RA 4O7BA 3DAIA 5DLXA 4NYVA 4A9FA 4NQMA 5HRWA 5HENA 5IG6A 4NR9A 5FBXA 3LQIA 5DY7A 5DYXA 1WUMA 5FE2A 3G0JA 5FE5A 5KU3A 5AD2A 3IU6A 2G4AA 3P1CA 4NRAA 5II1A 3LQJA 4WIVA 5F62A 5LKZA 4KV1A 5A5SA 4MEPA 2DWWA 4AKNA 4Z1QA 2L5EA 2LSPB 5A83A 5FE3A 3RCWA 4TZ2A 5ENBA 5HFQA 3AQAA 5CUEA 2RFJA 2MJVB 3LXJA 5A81A 4NQNA 4LC2A 5DX4A 5FE6A 4QSTA 4NR8A 4NYWA 5HM0A 5ENIA 3O35A 3O34A 4UIYA 4NRCA 5DKHA 5I40A 5KTXA 4YY4A 4HBWA 5C7NA 3UV5A 4O7CA 5ENJA 4IR4A 4BW4A 5JWMA 4HXPA 4QZSA 5FFYA 1WUGA 3O37A 5EK9A 4NXJA 4UYHA 5CUDA 4A9MA 4Z93A 1N72A 5L97A 2RNYA 2YEKA 3FKMX 5ENEA 4LZRA 5LJ0A 4X2IA 4RVRA 4C66A 5CRZA 2DVSA 3DWYA 4HBXA 5CTLA 3SVFA 4HXOA 5G4SA 4ALGA 5A5OA 2E7NA 4LYSA 5A85A 5FH6A 5HQ6A 4TU4A 2RO1A 5G4RA 2DVVA 2F6NA 4Q0NA 4N4GA 2GRCA 4YYGA 2WP1A 2YYNA 2RNWA 5IGNA 5EPRA 4O72A 5AD3A 4YAXA 5HQ5A 2D9EA 4MR5A 5FE4A 4YYKA 2NXBA 4UYFB 5F63A 5D24A 5FE7A 3K2JA 3D7CA 4Q0OA 5FG5A 5D3TA 5DW2A 5ENCA 5EU1A 4QEVA 4QC3A 4UYGA 5FB1A 3JVLA 5H1TA 5L98A 3G0LA 5EP7A 4MR4A 4GPJA 5LJ2A 3GG3A 4O7FA 4TT2A 5KO4A 4O71A 4UIZA 4A9KA 4XY8A 2N9GA 4QSRA 5LJ1A 3MXFA 5HEMA 4OGJA 5EGUA 4XUAA 4O7EA 4UYEA 5E73A 5FG4A 3MULA 5CUBA 5J0DA 3UVWA 5L99A 5LKUA 4YYJA 5II2A 4QSWA 4C67A 4XYAA 5EV9A 4NRBA 4CFLA 5A5PA 4N3WA 4UIVA 5FE1A 5EWHA 4CUQA 4TQNA 5C4QA 2R10A 4IOQA 4IR3A 4O74A 4QYDA 5FDZA 2DATA 1EQFA 5E3GA 5FFVA 3ONIA 5COIA 4TTEA 5FB0A 4CUUA 5CQ8A 4QR5A 4NUEA 4CLBA 4QR4A 5EISA 2E7OA 4YK0A 4BW1A 3IU5A 3LJWA 5BT3A 5HELA 5LUUA 5D3HA 5TCMA 5EWWA 3UW9A 3S91A 2KTBB 5CQ5A 5CY9A 4QEUA 4J1PA 4DONA 5DFCA 4E96A 3ZYUA 4UYDA 4LYWA 4A9HA 5IIDA 3HMEA 5CUCA 5ETBA 4ALHA 3UV2A 5EVAA 4HXKA 3HMHA 4ZW1A 3S92A 4YY6A 3JVKA 4YBMA 5LKXA 2YELA 4TZ8A 4FLPA 4A9NA 4QBMA 5CS8A 4QSPA 5CZGA 4UIUA 5A5RA 4Z1SA 4QSQA 4QY4A 2RNXA 4MEOA 2RI7A 4YYIA 1F68A 4LYIA 5IBNA 5E0RA 5FE9A 3SVHA 3U5OA 4UYFA 4ZQLA 4A9EA 4OGIA 3U5JA 3U5PA 3UV4A 3UVXA 4QSVA 3P1DA 5E9MA 5I88A 5I7XA 5LVQA 3O36A 4NYXA 4WHWA 2DVRA 5KTUA 5I29A 4BW2A 5I83A 4PCIA 4PTBA 4Z6HA 4TT4A 5CQ6A 4UITA 5LKTA 4YYHA 2YQDA 5DKDA 1JM4B 4PY6A 3MQMA 4QEWA 4QR3A 3U5MA 5DFBA 5DYUA 4TYLA 4O70A 3Q2EA 4A9IA 4LDFA 4LRGA 5KHMA 5E7DA 4NUDA 3JVJA 4Z6IA 5I1QA 5JI8A 3TLPA 5L8UA 3O33A 5CGPA 5HLSA 2I8NA 5DBMA 4MENA 5EWCA 5EWDA 2F6JA 5D26A 4IORA 3P1EA 5DYCA 5EICA 5EWVA 3AADA 5C87A 5HCLA 2I7KA 5F5ZA 4HXSA 2E3KA 4YBTA 4LZSA 4J0RA 4PCEA 5CU8A 5C85A 5F1HA 2YDWA 4HXLA 5A7CA 5EPSA 5FG6A 5E9YA 5FH8A 2R0VA 2WP2A 4PKLA 5EA1A 5D25A 3QZSA 4BJXA 5AMFA 5E9IA 5I7YA 5IGLA 4CL9A 5A5QA 2FSAA 5EQ1A 4QNSA 4O77A 4HXMA 4YYNA 2DVQA 4LR6A 5CPEA 4IOOA 5E3DA 4QUUA 4QYLA 3LQHA 5D0CA 5IGKA 4LZ2A 5DLZA 5F36A 5HJCA 5CQTA 3MB4A 5CUGA 4CUSA 5I89A 3P1FA 4A9JA 5IGMA 2OSSA 4O76A 4QUTA 5CQAA 4QSXA 5D3LA 4N4IA 4J0SA 4N4FA 1JSPB 4QB3A 4O7AA 4QSUA
chains in the Genus database with same CATH superfamily
4CUPA 4KCXA 2RS9B 3JVMA 4A9LA 2OUOA 3VKGA 5HRVA 4Y03A 5DFDA 5D3PA 4TS8A 5D3NA 4YC9A 5F1LA 3UVYA 4KV4A 5F3AA 4BHWA 5FH7A 5I80A 4YH3A 5ENHA 4HXNA 5H1VA 3U5LA 1ZS5A 3MUKA 5D3JA 5F60A 5L96A 5K29A 4TU6A 4MR3A 4YH4A 3NXBA 4A9OA 4YBSA 4MEQA 4BW3A 2YEMA 4YYMA 4CUTA 1PUOA 5CQ7A 4CFKA 2YW5A 3UVDA 5F61A 5H1UA 5ENFA 4ZC9A 5CUAA 4XY9A 5D7XA 4NR6A 5BT4A 4MR6A 2H60A 5DW1A 4YYDA 4HXRA 5ACYA 4J3IA 4O75A 4QC1A 4NR4A 4CURA 4PS5A 5C8GA 5E9KA 5EM3A 4UIXA 4IR6A 5F2PA 5LVRA 4HBVA 5CRMA 5CQ4A 5DKCA 3MB3A 4OUFA 3Q2FA 5DYAA 3P5OA 5FE8A 3HMFA 4NS5A 4NR7A 3SVGA 4AKHA 4AKGA 5CQ3A 3U5NA 5TB6A 2OO1A 5A5NA 4N4HA 5AMEA 5A82A 5H85A 5FFWA 3I3JA 2R0SA 1X0JA 4TT6A 5E9VA 5E9LA 2L84A 5ENGA 5KTWA 5EPBA 3U5KA 3QZVA 4O78A 5HFRA 2R0YA 1E6IA 4NR5A 4XUBA 5CFWA 5E74A 4YATA 4F3IA 4NUCA 5EI4A 5D3SA 5HRXA 4UIWA 2L85A 5CP5A 5ETDA 5HQ7A 4QSSA 4YADA 5FE0A 4HBYA 5L8TA 2D82A 5C89A 4WHUA 3QZTA 5I86A 5BT5A 2DKWA 5F25A 4YABA 4IR5A 5D3RA 4O7BA 3DAIA 5DLXA 4NYVA 4A9FA 4NQMA 5HRWA 5HENA 5IG6A 4NR9A 5FBXA 3LQIA 5DY7A 5DYXA 1WUMA 5FE2A 3G0JA 5FE5A 5KU3A 5AD2A 3IU6A 2G4AA 3P1CA 4AI6A 4NRAA 5II1A 3LQJA 4WIVA 5F62A 5LKZA 4KV1A 5A5SA 4MEPA 2DWWA 4AKNA 4Z1QA 2L5EA 2LSPB 5A83A 5FE3A 3RCWA 3D1BA 4TZ2A 5ENBA 5HFQA 3AQAA 5CUEA 2RFJA 2MJVB 3LXJA 5A81A 4NQNA 4LC2A 5DX4A 5FE6A 4QSTA 4AKIA 4NR8A 4NYWA 5HM0A 5ENIA 3O35A 3O34A 4UIYA 4NRCA 5DKHA 5I40A 5KTXA 4YY4A 4HBWA 5C7NA 3UV5A 4O7CA 5ENJA 4IR4A 4BW4A 5JWMA 4HXPA 4QZSA 5FFYA 1WUGA 3O37A 5EK9A 4NXJA 4UYHA 5CUDA 4A9MA 4Z93A 1N72A 5L97A 2RNYA 2YEKA 3FKMX 5ENEA 4LZRA 5LJ0A 4X2IA 4RVRA 4C66A 5CRZA 2DVSA 3DWYA 4HBXA 5CTLA 3SVFA 4HXOA 5G4SA 4ALGA 5A5OA 2E7NA 4LYSA 5A85A 5FH6A 5HQ6A 4TU4A 2RO1A 5G4RA 2DVVA 2F6NA 3ERRA 4Q0NA 4N4GA 2GRCA 4YYGA 2WP1A 2YYNA 2RNWA 5IGNA 5EPRA 4O72A 5AD3A 4YAXA 5HQ5A 2D9EA 4MR5A 5FE4A 4YYKA 2NXBA 4UYFB 5F63A 5D24A 5FE7A 3K2JA 3D7CA 4Q0OA 5FG5A 5D3TA 5DW2A 5ENCA 5EU1A 4QEVA 4QC3A 4UYGA 5FB1A 3JVLA 5H1TA 5L98A 3G0LA 5EP7A 4MR4A 4GPJA 5LJ2A 3GG3A 4O7FA 4TT2A 5KO4A 4O71A 4UIZA 4A9KA 4XY8A 2N9GA 4QSRA 5LJ1A 3MXFA 5HEMA 4OGJA 5EGUA 4XUAA 4O7EA 4UYEA 5E73A 5FG4A 3MULA 5CUBA 5J0DA 3UVWA 5L99A 5LKUA 4YYJA 5II2A 4QSWA 4C67A 4XYAA 5EV9A 4NRBA 4CFLA 5A5PA 4N3WA 4UIVA 5FE1A 5EWHA 4CUQA 4TQNA 5C4QA 2R10A 4IOQA 4IR3A 4O74A 4QYDA 5FDZA 2DATA 1EQFA 5E3GA 5FFVA 3ONIA 5COIA 4TTEA 5FB0A 4CUUA 5CQ8A 4QR5A 4NUEA 4CLBA 4QR4A 5EISA 2E7OA 4YK0A 4BW1A 3IU5A 3LJWA 5BT3A 5HELA 5LUUA 5D3HA 5TCMA 5EWWA 3UW9A 3S91A 2KTBB 5CQ5A 5CY9A 4QEUA 4J1PA 4DONA 5DFCA 4E96A 3ZYUA 4UYDA 3VKHA 4LYWA 4A9HA 5IIDA 3HMEA 5CUCA 5ETBA 4ALHA 3UV2A 5EVAA 4HXKA 3HMHA 4ZW1A 3S92A 4YY6A 3JVKA 4YBMA 5LKXA 2YELA 4TZ8A 4FLPA 4A9NA 4QBMA 5CS8A 4QSPA 5CZGA 4UIUA 5A5RA 4Z1SA 4QSQA 4QY4A 2RNXA 4MEOA 2RI7A 4YYIA 1F68A 4LYIA 5IBNA 5E0RA 5FE9A 3SVHA 3U5OA 4UYFA 4ZQLA 4A9EA 4OGIA 3U5JA 3U5PA 3UV4A 3UVXA 4QSVA 3P1DA 5E9MA 5I88A 5I7XA 5LVQA 3O36A 4NYXA 4WHWA 2DVRA 5KTUA 5I29A 4BW2A 5I83A 4PCIA 4PTBA 4Z6HA 4TT4A 5CQ6A 4UITA 5LKTA 4YYHA 2YQDA 5DKDA 1JM4B 4PY6A 3MQMA 4QEWA 4QR3A 3U5MA 5DFBA 5DYUA 4TYLA 4O70A 3Q2EA 4A9IA 4LDFA 4LRGA 5KHMA 5E7DA 4NUDA 3JVJA 4Z6IA 5I1QA 5JI8A 3TLPA 5L8UA 3O33A 5CGPA 5HLSA 2I8NA 5DBMA 4MENA 5EWCA 5EWDA 2F6JA 5D26A 4IORA 3P1EA 5DYCA 5EICA 5EWVA 3AADA 5C87A 5HCLA 2I7KA 5F5ZA 4HXSA 2E3KA 4YBTA 1ZKRA 4LZSA 4J0RA 4PCEA 5CU8A 5C85A 5F1HA 2YDWA 4HXLA 5A7CA 5EPSA 5FG6A 5E9YA 5FH8A 2R0VA 2WP2A 4PKLA 5EA1A 5D25A 3QZSA 4BJXA 5AMFA 5E9IA 5I7YA 5IGLA 4CL9A 5A5QA 2FSAA 5EQ1A 4QNSA 4O77A 4HXMA 4YYNA 2DVQA 4LR6A 5CPEA 4IOOA 5E3DA 4QUUA 4QYLA 3LQHA 5D0CA 5IGKA 4LZ2A 5DLZA 5F36A 5HJCA 5CQTA 3MB4A 5CUGA 2EJNA 4CUSA 5I89A 3P1FA 4A9JA 5IGMA 2OSSA 4O76A 4QUTA 5CQAA 4QSXA 5D3LA 3D1DA 4N4IA 4J0SA 4N4FA 1JSPB 4QB3A 4O7AA 4QSUA
chains in the Genus database with same CATH topology
4CUPA 4KCXA 2RS9B 3JVMA 4A9LA 2OUOA 5HRVA 4Y03A 5DFDA 5D3PA 4TS8A 5D3NA 4YC9A 5F1LA 3UVYA 4KV4A 5F3AA 4BHWA 5FH7A 5I80A 4YH3A 5ENHA 4HXNA 5H1VA 3U5LA 1ZS5A 3MUKA 5D3JA 5F60A 5L96A 5K29A 4TU6A 4MR3A 4YH4A 3NXBA 4A9OA 4YBSA 4MEQA 4BW3A 2YEMA 4YYMA 4CUTA 5CQ7A 4CFKA 2YW5A 3UVDA 5F61A 5H1UA 5ENFA 4ZC9A 5CUAA 4XY9A 5D7XA 4NR6A 5BT4A 4MR6A 2H60A 5DW1A 4YYDA 4HXRA 5ACYA 4J3IA 4O75A 4QC1A 4NR4A 4CURA 4PS5A 5C8GA 5E9KA 5EM3A 4UIXA 4IR6A 5F2PA 5LVRA 4HBVA 5CRMA 5CQ4A 5DKCA 3MB3A 4OUFA 3Q2FA 5DYAA 3P5OA 5FE8A 3HMFA 4NS5A 4NR7A 3SVGA 5CQ3A 3U5NA 5TB6A 2OO1A 5A5NA 4N4HA 5AMEA 5A82A 5H85A 5FFWA 3I3JA 2R0SA 1X0JA 4TT6A 5E9VA 5E9LA 2L84A 5ENGA 5KTWA 5EPBA 3U5KA 3QZVA 4O78A 5HFRA 2R0YA 1E6IA 4NR5A 4XUBA 5CFWA 5E74A 4YATA 4F3IA 4NUCA 5EI4A 5D3SA 5HRXA 4UIWA 2L85A 5CP5A 5ETDA 5HQ7A 4QSSA 4YADA 5FE0A 4HBYA 5L8TA 2D82A 5C89A 4WHUA 3QZTA 5I86A 5BT5A 2DKWA 5F25A 4YABA 4IR5A 5D3RA 4O7BA 3DAIA 5DLXA 4NYVA 4A9FA 4NQMA 5HRWA 5HENA 5IG6A 4NR9A 5FBXA 3LQIA 5DY7A 5DYXA 1WUMA 5FE2A 3G0JA 5FE5A 5KU3A 5AD2A 3IU6A 2G4AA 3P1CA 4NRAA 5II1A 3LQJA 4WIVA 5F62A 5LKZA 4KV1A 5A5SA 4MEPA 2DWWA 4AKNA 4Z1QA 2L5EA 2LSPB 5A83A 5FE3A 3RCWA 4TZ2A 5ENBA 5HFQA 3AQAA 5CUEA 2RFJA 2MJVB 3LXJA 5A81A 4NQNA 4LC2A 5DX4A 5FE6A 4QSTA 4NR8A 4NYWA 5HM0A 5ENIA 3O35A 3O34A 4UIYA 4NRCA 5DKHA 5I40A 5KTXA 4YY4A 4HBWA 5C7NA 3UV5A 4O7CA 5ENJA 4IR4A 4BW4A 5JWMA 4HXPA 4QZSA 5FFYA 1WUGA 3O37A 5EK9A 4NXJA 4UYHA 5CUDA 4A9MA 4Z93A 1N72A 5L97A 2RNYA 2YEKA 3FKMX 5ENEA 4LZRA 5LJ0A 4X2IA 4RVRA 4C66A 5CRZA 2DVSA 3DWYA 4HBXA 5CTLA 3SVFA 4HXOA 5G4SA 4ALGA 5A5OA 2E7NA 4LYSA 5A85A 5FH6A 5HQ6A 4TU4A 2RO1A 5G4RA 2DVVA 2F6NA 4Q0NA 4N4GA 2GRCA 4YYGA 2WP1A 2YYNA 2RNWA 5IGNA 5EPRA 4O72A 5AD3A 4YAXA 5HQ5A 2D9EA 4MR5A 5FE4A 4YYKA 2NXBA 4UYFB 5F63A 5D24A 5FE7A 3K2JA 3D7CA 4Q0OA 5FG5A 5D3TA 5DW2A 5ENCA 5EU1A 4QEVA 4QC3A 4UYGA 5FB1A 3JVLA 5H1TA 5L98A 3G0LA 5EP7A 4MR4A 4GPJA 5LJ2A 3GG3A 4O7FA 4TT2A 5KO4A 4O71A 4UIZA 4A9KA 4XY8A 2N9GA 4QSRA 5LJ1A 3MXFA 5HEMA 4OGJA 5EGUA 4XUAA 4O7EA 4UYEA 5E73A 5FG4A 3MULA 5CUBA 5J0DA 3UVWA 5L99A 5LKUA 4YYJA 5II2A 4QSWA 4C67A 4XYAA 5EV9A 4NRBA 4CFLA 5A5PA 4N3WA 4UIVA 5FE1A 5EWHA 4CUQA 4TQNA 5C4QA 2R10A 4IOQA 4IR3A 4O74A 4QYDA 5FDZA 2DATA 1EQFA 5E3GA 5FFVA 3ONIA 5COIA 4TTEA 5FB0A 4CUUA 5CQ8A 4QR5A 4NUEA 4CLBA 4QR4A 5EISA 2E7OA 4YK0A 4BW1A 3IU5A 3LJWA 5BT3A 5HELA 5LUUA 5D3HA 5TCMA 5EWWA 3UW9A 3S91A 2KTBB 5CQ5A 5CY9A 4QEUA 4J1PA 4DONA 5DFCA 4E96A 3ZYUA 4UYDA 4LYWA 4A9HA 5IIDA 3HMEA 5CUCA 5ETBA 4ALHA 3UV2A 5EVAA 4HXKA 3HMHA 4ZW1A 3S92A 4YY6A 3JVKA 4YBMA 5LKXA 2YELA 4TZ8A 4FLPA 4A9NA 4QBMA 5CS8A 4QSPA 5CZGA 4UIUA 5A5RA 4Z1SA 4QSQA 4QY4A 2RNXA 4MEOA 2RI7A 4YYIA 1F68A 4LYIA 5IBNA 5E0RA 5FE9A 3SVHA 3U5OA 4UYFA 4ZQLA 4A9EA 4OGIA 3U5JA 3U5PA 3UV4A 3UVXA 4QSVA 3P1DA 5E9MA 5I88A 5I7XA 5LVQA 3O36A 4NYXA 4WHWA 2DVRA 5KTUA 5I29A 4BW2A 5I83A 4PCIA 4PTBA 4Z6HA 4TT4A 5CQ6A 4UITA 5LKTA 4YYHA 2YQDA 5DKDA 1JM4B 4PY6A 3MQMA 4QEWA 4QR3A 3U5MA 5DFBA 5DYUA 4TYLA 4O70A 3Q2EA 4A9IA 4LDFA 4LRGA 5KHMA 5E7DA 4NUDA 3JVJA 4Z6IA 5I1QA 5JI8A 3TLPA 5L8UA 3O33A 5CGPA 5HLSA 2I8NA 5DBMA 4MENA 5EWCA 5EWDA 2F6JA 5D26A 4IORA 3P1EA 5DYCA 5EICA 5EWVA 3AADA 5C87A 5HCLA 2I7KA 5F5ZA 4HXSA 2E3KA 4YBTA 4LZSA 4J0RA 4PCEA 5CU8A 5C85A 5F1HA 2YDWA 4HXLA 5A7CA 5EPSA 5FG6A 5E9YA 5FH8A 2R0VA 2WP2A 4PKLA 5EA1A 5D25A 3QZSA 4BJXA 5AMFA 5E9IA 5I7YA 5IGLA 4CL9A 5A5QA 2FSAA 5EQ1A 4QNSA 4O77A 4HXMA 4YYNA 2DVQA 4LR6A 5CPEA 4IOOA 5E3DA 4QUUA 4QYLA 3LQHA 5D0CA 5IGKA 4LZ2A 5DLZA 5F36A 5HJCA 5CQTA 3MB4A 5CUGA 4CUSA 5I89A 3P1FA 4A9JA 5IGMA 2OSSA 4O76A 4QUTA 5CQAA 4QSXA 5D3LA 4N4IA 4J0SA 4N4FA 1JSPB 4QB3A 4O7AA 4QSUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CUP A;  4KCX A;  2RS9 B;  3JVM A;  4A9L A;  2OUO A;  5HRV A;  4Y03 A;  5DFD A;  5D3P A;  4TS8 A;  5D3N A;  4YC9 A;  5F1L A;  3UVY A;  4KV4 A;  5F3A A;  4BHW A;  5FH7 A;  5I80 A;  4YH3 A;  5ENH A;  4HXN A;  5H1V A;  3U5L A;  1ZS5 A;  3MUK A;  5D3J A;  5F60 A;  5L96 A;  5K29 A;  4TU6 A;  4MR3 A;  4YH4 A;  3NXB A;  4A9O A;  4YBS A;  4MEQ A;  4BW3 A;  2YEM A;  4YYM A;  4CUT A;  5CQ7 A;  4CFK A;  2YW5 A;  3UVD A;  5F61 A;  5H1U A;  5ENF A;  4ZC9 A;  5CUA A;  4XY9 A;  5D7X A;  4NR6 A;  5BT4 A;  4MR6 A;  2H60 A;  5DW1 A;  4YYD A;  4HXR A;  5ACY A;  4J3I A;  4O75 A;  4QC1 A;  4NR4 A;  4CUR A;  4PS5 A;  5C8G A;  5E9K A;  5EM3 A;  4UIX A;  4IR6 A;  5F2P A;  5LVR A;  4HBV A;  5CRM A;  5CQ4 A;  5DKC A;  3MB3 A;  4OUF A;  3Q2F A;  5DYA A;  3P5O A;  5FE8 A;  3HMF A;  4NS5 A;  4NR7 A;  3SVG A;  5CQ3 A;  3U5N A;  5TB6 A;  2OO1 A;  5A5N A;  4N4H A;  5AME A;  5A82 A;  5H85 A;  5FFW A;  3I3J A;  2R0S A;  1X0J A;  4TT6 A;  5E9V A;  5E9L A;  2L84 A;  5ENG A;  5KTW A;  5EPB A;  3U5K A;  3QZV A;  4O78 A;  5HFR A;  2R0Y A;  1E6I A;  4NR5 A;  4XUB A;  5CFW A;  5E74 A;  4YAT A;  4F3I A;  4NUC A;  5EI4 A;  5D3S A;  5HRX A;  4UIW A;  2L85 A;  5CP5 A;  5ETD A;  5HQ7 A;  4QSS A;  4YAD A;  5FE0 A;  4HBY A;  5L8T A;  2D82 A;  5C89 A;  4WHU A;  3QZT A;  5I86 A;  5BT5 A;  2DKW A;  5F25 A;  4YAB A;  4IR5 A;  5D3R A;  4O7B A;  3DAI A;  5DLX A;  4NYV A;  4A9F A;  4NQM A;  5HRW A;  5HEN A;  5IG6 A;  4NR9 A;  5FBX A;  3LQI A;  5DY7 A;  5DYX A;  1WUM A;  5FE2 A;  3G0J A;  5FE5 A;  5KU3 A;  5AD2 A;  3IU6 A;  2G4A A;  3P1C A;  4NRA A;  5II1 A;  3LQJ A;  4WIV A;  5F62 A;  5LKZ A;  4KV1 A;  5A5S A;  4MEP A;  2DWW A;  4AKN A;  4Z1Q A;  2L5E A;  2LSP B;  5A83 A;  5FE3 A;  3RCW A;  4TZ2 A;  5ENB A;  5HFQ A;  3AQA A;  5CUE A;  2RFJ A;  2MJV B;  3LXJ A;  5A81 A;  4NQN A;  4LC2 A;  5DX4 A;  5FE6 A;  4QST A;  4NR8 A;  4NYW A;  5HM0 A;  5ENI A;  3O35 A;  3O34 A;  4UIY A;  4NRC A;  5DKH A;  5I40 A;  5KTX A;  4YY4 A;  4HBW A;  5C7N A;  3UV5 A;  4O7C A;  5ENJ A;  4IR4 A;  4BW4 A;  5JWM A;  4HXP A;  4QZS A;  5FFY A;  1WUG A;  3O37 A;  5EK9 A;  4NXJ A;  4UYH A;  5CUD A;  4A9M A;  4Z93 A;  1N72 A;  5L97 A;  2RNY A;  2YEK A;  3FKM X;  5ENE A;  4LZR A;  5LJ0 A;  4X2I A;  4RVR A;  4C66 A;  5CRZ A;  2DVS A;  3DWY A;  4HBX A;  5CTL A;  3SVF A;  4HXO A;  5G4S A;  4ALG A;  5A5O A;  2E7N A;  4LYS A;  5A85 A;  5FH6 A;  5HQ6 A;  4TU4 A;  2RO1 A;  5G4R A;  2DVV A;  2F6N A;  4Q0N A;  4N4G A;  2GRC A;  4YYG A;  2WP1 A;  2YYN A;  2RNW A;  5IGN A;  5EPR A;  4O72 A;  5AD3 A;  4YAX A;  5HQ5 A;  2D9E A;  4MR5 A;  5FE4 A;  4YYK A;  2NXB A;  4UYF B;  5F63 A;  5D24 A;  5FE7 A;  3K2J A;  3D7C A;  4Q0O A;  5FG5 A;  5D3T A;  5DW2 A;  5ENC A;  5EU1 A;  4QEV A;  4QC3 A;  4UYG A;  5FB1 A;  3JVL A;  5H1T A;  5L98 A;  3G0L A;  5EP7 A;  4MR4 A;  4GPJ A;  5LJ2 A;  3GG3 A;  4O7F A;  4TT2 A;  5KO4 A;  4O71 A;  4UIZ A;  4A9K A;  4XY8 A;  2N9G A;  4QSR A;  5LJ1 A;  3MXF A;  5HEM A;  4OGJ A;  5EGU A;  4XUA A;  4O7E A;  4UYE A;  5E73 A;  5FG4 A;  3MUL A;  5CUB A;  5J0D A;  3UVW A;  5L99 A;  5LKU A;  4YYJ A;  5II2 A;  4QSW A;  4C67 A;  4XYA A;  5EV9 A;  4NRB A;  4CFL A;  5A5P A;  4N3W A;  4UIV A;  5FE1 A;  5EWH A;  4CUQ A;  4TQN A;  5C4Q A;  2R10 A;  4IOQ A;  4IR3 A;  4O74 A;  4QYD A;  5FDZ A;  2DAT A;  1EQF A;  5E3G A;  5FFV A;  3ONI A;  5COI A;  4TTE A;  5FB0 A;  4CUU A;  5CQ8 A;  4QR5 A;  4NUE A;  4CLB A;  4QR4 A;  5EIS A;  2E7O A;  4YK0 A;  4BW1 A;  3IU5 A;  3LJW A;  5BT3 A;  5HEL A;  5LUU A;  5D3H A;  5TCM A;  5EWW A;  3UW9 A;  3S91 A;  2KTB B;  5CQ5 A;  5CY9 A;  4QEU A;  4J1P A;  4DON A;  5DFC A;  4E96 A;  3ZYU A;  4UYD A;  4LYW A;  4A9H A;  5IID A;  3HME A;  5CUC A;  5ETB A;  4ALH A;  3UV2 A;  5EVA A;  4HXK A;  3HMH A;  4ZW1 A;  3S92 A;  4YY6 A;  3JVK A;  4YBM A;  5LKX A;  2YEL A;  4TZ8 A;  4FLP A;  4A9N A;  4QBM A;  5CS8 A;  4QSP A;  5CZG A;  4UIU A;  5A5R A;  4Z1S A;  4QSQ A;  4QY4 A;  2RNX A;  4MEO A;  2RI7 A;  4YYI A;  1F68 A;  4LYI A;  5IBN A;  5E0R A;  5FE9 A;  3SVH A;  3U5O A;  4UYF A;  4ZQL A;  4A9E A;  4OGI A;  3U5J A;  3U5P A;  3UV4 A;  3UVX A;  4QSV A;  3P1D A;  5E9M A;  5I88 A;  5I7X A;  5LVQ A;  3O36 A;  4NYX A;  4WHW A;  2DVR A;  5KTU A;  5I29 A;  4BW2 A;  5I83 A;  4PCI A;  4PTB A;  4Z6H A;  4TT4 A;  5CQ6 A;  4UIT A;  5LKT A;  4YYH A;  2YQD A;  5DKD A;  1JM4 B;  4PY6 A;  3MQM A;  4QEW A;  4QR3 A;  3U5M A;  5DFB A;  5DYU A;  4TYL A;  4O70 A;  3Q2E A;  4A9I A;  4LDF A;  4LRG A;  5KHM A;  5E7D A;  4NUD A;  3JVJ A;  4Z6I A;  5I1Q A;  5JI8 A;  3TLP A;  5L8U A;  3O33 A;  5CGP A;  5HLS A;  2I8N A;  5DBM A;  4MEN A;  5EWC A;  5EWD A;  2F6J A;  5D26 A;  4IOR A;  3P1E A;  5DYC A;  5EIC A;  5EWV A;  3AAD A;  5C87 A;  5HCL A;  2I7K A;  5F5Z A;  4HXS A;  2E3K A;  4YBT A;  4LZS A;  4J0R A;  4PCE A;  5CU8 A;  5C85 A;  5F1H A;  2YDW A;  4HXL A;  5A7C A;  5EPS A;  5FG6 A;  5E9Y A;  5FH8 A;  2R0V A;  2WP2 A;  4PKL A;  5EA1 A;  5D25 A;  3QZS A;  4BJX A;  5AMF A;  5E9I A;  5I7Y A;  5IGL A;  4CL9 A;  5A5Q A;  2FSA A;  5EQ1 A;  4QNS A;  4O77 A;  4HXM A;  4YYN A;  2DVQ A;  4LR6 A;  5CPE A;  4IOO A;  5E3D A;  4QUU A;  4QYL A;  3LQH A;  5D0C A;  5IGK A;  4LZ2 A;  5DLZ A;  5F36 A;  5HJC A;  5CQT A;  3MB4 A;  5CUG A;  4CUS A;  5I89 A;  3P1F A;  4A9J A;  5IGM A;  2OSS A;  4O76 A;  4QUT A;  5CQA A;  4QSX A;  5D3L A;  4N4I A;  4J0S A;  4N4F A;  1JSP B;  4QB3 A;  4O7A A;  4QSU A; 
#chains in the Genus database with same CATH topology
 4CUP A;  4KCX A;  2RS9 B;  3JVM A;  4A9L A;  2OUO A;  3VKG A;  5HRV A;  4Y03 A;  5DFD A;  5D3P A;  4TS8 A;  5D3N A;  4YC9 A;  5F1L A;  3UVY A;  4KV4 A;  5F3A A;  4BHW A;  5FH7 A;  5I80 A;  4YH3 A;  5ENH A;  4HXN A;  5H1V A;  3U5L A;  1ZS5 A;  3MUK A;  5D3J A;  5F60 A;  5L96 A;  5K29 A;  4TU6 A;  4MR3 A;  4YH4 A;  3NXB A;  4A9O A;  4YBS A;  4MEQ A;  4BW3 A;  2YEM A;  4YYM A;  4CUT A;  1PUO A;  5CQ7 A;  4CFK A;  2YW5 A;  3UVD A;  5F61 A;  5H1U A;  5ENF A;  4ZC9 A;  5CUA A;  4XY9 A;  5D7X A;  4NR6 A;  5BT4 A;  4MR6 A;  2H60 A;  5DW1 A;  4YYD A;  4HXR A;  5ACY A;  4J3I A;  4O75 A;  4QC1 A;  4NR4 A;  4CUR A;  4PS5 A;  5C8G A;  5E9K A;  5EM3 A;  4UIX A;  4IR6 A;  5F2P A;  5LVR A;  4HBV A;  5CRM A;  5CQ4 A;  5DKC A;  3MB3 A;  4OUF A;  3Q2F A;  5DYA A;  3P5O A;  5FE8 A;  3HMF A;  4NS5 A;  4NR7 A;  3SVG A;  4AKH A;  4AKG A;  5CQ3 A;  3U5N A;  5TB6 A;  2OO1 A;  5A5N A;  4N4H A;  5AME A;  5A82 A;  5H85 A;  5FFW A;  3I3J A;  2R0S A;  1X0J A;  4TT6 A;  5E9V A;  5E9L A;  2L84 A;  5ENG A;  5KTW A;  5EPB A;  3U5K A;  3QZV A;  4O78 A;  5HFR A;  2R0Y A;  1E6I A;  4NR5 A;  4XUB A;  5CFW A;  5E74 A;  4YAT A;  4F3I A;  4NUC A;  5EI4 A;  5D3S A;  5HRX A;  4UIW A;  2L85 A;  5CP5 A;  5ETD A;  5HQ7 A;  4QSS A;  4YAD A;  5FE0 A;  4HBY A;  5L8T A;  2D82 A;  5C89 A;  4WHU A;  3QZT A;  5I86 A;  5BT5 A;  2DKW A;  5F25 A;  4YAB A;  4IR5 A;  5D3R A;  4O7B A;  3DAI A;  5DLX A;  4NYV A;  4A9F A;  4NQM A;  5HRW A;  5HEN A;  5IG6 A;  4NR9 A;  5FBX A;  3LQI A;  5DY7 A;  5DYX A;  1WUM A;  5FE2 A;  3G0J A;  5FE5 A;  5KU3 A;  5AD2 A;  3IU6 A;  2G4A A;  3P1C A;  4AI6 A;  4NRA A;  5II1 A;  3LQJ A;  4WIV A;  5F62 A;  5LKZ A;  4KV1 A;  5A5S A;  4MEP A;  2DWW A;  4AKN A;  4Z1Q A;  2L5E A;  2LSP B;  5A83 A;  5FE3 A;  3RCW A;  3D1B A;  4TZ2 A;  5ENB A;  5HFQ A;  3AQA A;  5CUE A;  2RFJ A;  2MJV B;  3LXJ A;  5A81 A;  4NQN A;  4LC2 A;  5DX4 A;  5FE6 A;  4QST A;  4AKI A;  4NR8 A;  4NYW A;  5HM0 A;  5ENI A;  3O35 A;  3O34 A;  4UIY A;  4NRC A;  5DKH A;  5I40 A;  5KTX A;  4YY4 A;  4HBW A;  5C7N A;  3UV5 A;  4O7C A;  5ENJ A;  4IR4 A;  4BW4 A;  5JWM A;  4HXP A;  4QZS A;  5FFY A;  1WUG A;  3O37 A;  5EK9 A;  4NXJ A;  4UYH A;  5CUD A;  4A9M A;  4Z93 A;  1N72 A;  5L97 A;  2RNY A;  2YEK A;  3FKM X;  5ENE A;  4LZR A;  5LJ0 A;  4X2I A;  4RVR A;  4C66 A;  5CRZ A;  2DVS A;  3DWY A;  4HBX A;  5CTL A;  3SVF A;  4HXO A;  5G4S A;  4ALG A;  5A5O A;  2E7N A;  4LYS A;  5A85 A;  5FH6 A;  5HQ6 A;  4TU4 A;  2RO1 A;  5G4R A;  2DVV A;  2F6N A;  3ERR A;  4Q0N A;  4N4G A;  2GRC A;  4YYG A;  2WP1 A;  2YYN A;  2RNW A;  5IGN A;  5EPR A;  4O72 A;  5AD3 A;  4YAX A;  5HQ5 A;  2D9E A;  4MR5 A;  5FE4 A;  4YYK A;  2NXB A;  4UYF B;  5F63 A;  5D24 A;  5FE7 A;  3K2J A;  3D7C A;  4Q0O A;  5FG5 A;  5D3T A;  5DW2 A;  5ENC A;  5EU1 A;  4QEV A;  4QC3 A;  4UYG A;  5FB1 A;  3JVL A;  5H1T A;  5L98 A;  3G0L A;  5EP7 A;  4MR4 A;  4GPJ A;  5LJ2 A;  3GG3 A;  4O7F A;  4TT2 A;  5KO4 A;  4O71 A;  4UIZ A;  4A9K A;  4XY8 A;  2N9G A;  4QSR A;  5LJ1 A;  3MXF A;  5HEM A;  4OGJ A;  5EGU A;  4XUA A;  4O7E A;  4UYE A;  5E73 A;  5FG4 A;  3MUL A;  5CUB A;  5J0D A;  3UVW A;  5L99 A;  5LKU A;  4YYJ A;  5II2 A;  4QSW A;  4C67 A;  4XYA A;  5EV9 A;  4NRB A;  4CFL A;  5A5P A;  4N3W A;  4UIV A;  5FE1 A;  5EWH A;  4CUQ A;  4TQN A;  5C4Q A;  2R10 A;  4IOQ A;  4IR3 A;  4O74 A;  4QYD A;  5FDZ A;  2DAT A;  1EQF A;  5E3G A;  5FFV A;  3ONI A;  5COI A;  4TTE A;  5FB0 A;  4CUU A;  5CQ8 A;  4QR5 A;  4NUE A;  4CLB A;  4QR4 A;  5EIS A;  2E7O A;  4YK0 A;  4BW1 A;  3IU5 A;  3LJW A;  5BT3 A;  5HEL A;  5LUU A;  5D3H A;  5TCM A;  5EWW A;  3UW9 A;  3S91 A;  2KTB B;  5CQ5 A;  5CY9 A;  4QEU A;  4J1P A;  4DON A;  5DFC A;  4E96 A;  3ZYU A;  4UYD A;  3VKH A;  4LYW A;  4A9H A;  5IID A;  3HME A;  5CUC A;  5ETB A;  4ALH A;  3UV2 A;  5EVA A;  4HXK A;  3HMH A;  4ZW1 A;  3S92 A;  4YY6 A;  3JVK A;  4YBM A;  5LKX A;  2YEL A;  4TZ8 A;  4FLP A;  4A9N A;  4QBM A;  5CS8 A;  4QSP A;  5CZG A;  4UIU A;  5A5R A;  4Z1S A;  4QSQ A;  4QY4 A;  2RNX A;  4MEO A;  2RI7 A;  4YYI A;  1F68 A;  4LYI A;  5IBN A;  5E0R A;  5FE9 A;  3SVH A;  3U5O A;  4UYF A;  4ZQL A;  4A9E A;  4OGI A;  3U5J A;  3U5P A;  3UV4 A;  3UVX A;  4QSV A;  3P1D A;  5E9M A;  5I88 A;  5I7X A;  5LVQ A;  3O36 A;  4NYX A;  4WHW A;  2DVR A;  5KTU A;  5I29 A;  4BW2 A;  5I83 A;  4PCI A;  4PTB A;  4Z6H A;  4TT4 A;  5CQ6 A;  4UIT A;  5LKT A;  4YYH A;  2YQD A;  5DKD A;  1JM4 B;  4PY6 A;  3MQM A;  4QEW A;  4QR3 A;  3U5M A;  5DFB A;  5DYU A;  4TYL A;  4O70 A;  3Q2E A;  4A9I A;  4LDF A;  4LRG A;  5KHM A;  5E7D A;  4NUD A;  3JVJ A;  4Z6I A;  5I1Q A;  5JI8 A;  3TLP A;  5L8U A;  3O33 A;  5CGP A;  5HLS A;  2I8N A;  5DBM A;  4MEN A;  5EWC A;  5EWD A;  2F6J A;  5D26 A;  4IOR A;  3P1E A;  5DYC A;  5EIC A;  5EWV A;  3AAD A;  5C87 A;  5HCL A;  2I7K A;  5F5Z A;  4HXS A;  2E3K A;  4YBT A;  1ZKR A;  4LZS A;  4J0R A;  4PCE A;  5CU8 A;  5C85 A;  5F1H A;  2YDW A;  4HXL A;  5A7C A;  5EPS A;  5FG6 A;  5E9Y A;  5FH8 A;  2R0V A;  2WP2 A;  4PKL A;  5EA1 A;  5D25 A;  3QZS A;  4BJX A;  5AMF A;  5E9I A;  5I7Y A;  5IGL A;  4CL9 A;  5A5Q A;  2FSA A;  5EQ1 A;  4QNS A;  4O77 A;  4HXM A;  4YYN A;  2DVQ A;  4LR6 A;  5CPE A;  4IOO A;  5E3D A;  4QUU A;  4QYL A;  3LQH A;  5D0C A;  5IGK A;  4LZ2 A;  5DLZ A;  5F36 A;  5HJC A;  5CQT A;  3MB4 A;  5CUG A;  2EJN A;  4CUS A;  5I89 A;  3P1F A;  4A9J A;  5IGM A;  2OSS A;  4O76 A;  4QUT A;  5CQA A;  4QSX A;  5D3L A;  3D1D A;  4N4I A;  4J0S A;  4N4F A;  1JSP B;  4QB3 A;  4O7A A;  4QSU A; 
#chains in the Genus database with same CATH homology
 4CUP A;  4KCX A;  2RS9 B;  3JVM A;  4A9L A;  2OUO A;  5HRV A;  4Y03 A;  5DFD A;  5D3P A;  4TS8 A;  5D3N A;  4YC9 A;  5F1L A;  3UVY A;  4KV4 A;  5F3A A;  4BHW A;  5FH7 A;  5I80 A;  4YH3 A;  5ENH A;  4HXN A;  5H1V A;  3U5L A;  1ZS5 A;  3MUK A;  5D3J A;  5F60 A;  5L96 A;  5K29 A;  4TU6 A;  4MR3 A;  4YH4 A;  3NXB A;  4A9O A;  4YBS A;  4MEQ A;  4BW3 A;  2YEM A;  4YYM A;  4CUT A;  5CQ7 A;  4CFK A;  2YW5 A;  3UVD A;  5F61 A;  5H1U A;  5ENF A;  4ZC9 A;  5CUA A;  4XY9 A;  5D7X A;  4NR6 A;  5BT4 A;  4MR6 A;  2H60 A;  5DW1 A;  4YYD A;  4HXR A;  5ACY A;  4J3I A;  4O75 A;  4QC1 A;  4NR4 A;  4CUR A;  4PS5 A;  5C8G A;  5E9K A;  5EM3 A;  4UIX A;  4IR6 A;  5F2P A;  5LVR A;  4HBV A;  5CRM A;  5CQ4 A;  5DKC A;  3MB3 A;  4OUF A;  3Q2F A;  5DYA A;  3P5O A;  5FE8 A;  3HMF A;  4NS5 A;  4NR7 A;  3SVG A;  5CQ3 A;  3U5N A;  5TB6 A;  2OO1 A;  5A5N A;  4N4H A;  5AME A;  5A82 A;  5H85 A;  5FFW A;  3I3J A;  2R0S A;  1X0J A;  4TT6 A;  5E9V A;  5E9L A;  2L84 A;  5ENG A;  5KTW A;  5EPB A;  3U5K A;  3QZV A;  4O78 A;  5HFR A;  2R0Y A;  1E6I A;  4NR5 A;  4XUB A;  5CFW A;  5E74 A;  4YAT A;  4F3I A;  4NUC A;  5EI4 A;  5D3S A;  5HRX A;  4UIW A;  2L85 A;  5CP5 A;  5ETD A;  5HQ7 A;  4QSS A;  4YAD A;  5FE0 A;  4HBY A;  5L8T A;  2D82 A;  5C89 A;  4WHU A;  3QZT A;  5I86 A;  5BT5 A;  2DKW A;  5F25 A;  4YAB A;  4IR5 A;  5D3R A;  4O7B A;  3DAI A;  5DLX A;  4NYV A;  4A9F A;  4NQM A;  5HRW A;  5HEN A;  5IG6 A;  4NR9 A;  5FBX A;  3LQI A;  5DY7 A;  5DYX A;  1WUM A;  5FE2 A;  3G0J A;  5FE5 A;  5KU3 A;  5AD2 A;  3IU6 A;  2G4A A;  3P1C A;  4NRA A;  5II1 A;  3LQJ A;  4WIV A;  5F62 A;  5LKZ A;  4KV1 A;  5A5S A;  4MEP A;  2DWW A;  4AKN A;  4Z1Q A;  2L5E A;  2LSP B;  5A83 A;  5FE3 A;  3RCW A;  4TZ2 A;  5ENB A;  5HFQ A;  3AQA A;  5CUE A;  2RFJ A;  2MJV B;  3LXJ A;  5A81 A;  4NQN A;  4LC2 A;  5DX4 A;  5FE6 A;  4QST A;  4NR8 A;  4NYW A;  5HM0 A;  5ENI A;  3O35 A;  3O34 A;  4UIY A;  4NRC A;  5DKH A;  5I40 A;  5KTX A;  4YY4 A;  4HBW A;  5C7N A;  3UV5 A;  4O7C A;  5ENJ A;  4IR4 A;  4BW4 A;  5JWM A;  4HXP A;  4QZS A;  5FFY A;  1WUG A;  3O37 A;  5EK9 A;  4NXJ A;  4UYH A;  5CUD A;  4A9M A;  4Z93 A;  1N72 A;  5L97 A;  2RNY A;  2YEK A;  3FKM X;  5ENE A;  4LZR A;  5LJ0 A;  4X2I A;  4RVR A;  4C66 A;  5CRZ A;  2DVS A;  3DWY A;  4HBX A;  5CTL A;  3SVF A;  4HXO A;  5G4S A;  4ALG A;  5A5O A;  2E7N A;  4LYS A;  5A85 A;  5FH6 A;  5HQ6 A;  4TU4 A;  2RO1 A;  5G4R A;  2DVV A;  2F6N A;  4Q0N A;  4N4G A;  2GRC A;  4YYG A;  2WP1 A;  2YYN A;  2RNW A;  5IGN A;  5EPR A;  4O72 A;  5AD3 A;  4YAX A;  5HQ5 A;  2D9E A;  4MR5 A;  5FE4 A;  4YYK A;  2NXB A;  4UYF B;  5F63 A;  5D24 A;  5FE7 A;  3K2J A;  3D7C A;  4Q0O A;  5FG5 A;  5D3T A;  5DW2 A;  5ENC A;  5EU1 A;  4QEV A;  4QC3 A;  4UYG A;  5FB1 A;  3JVL A;  5H1T A;  5L98 A;  3G0L A;  5EP7 A;  4MR4 A;  4GPJ A;  5LJ2 A;  3GG3 A;  4O7F A;  4TT2 A;  5KO4 A;  4O71 A;  4UIZ A;  4A9K A;  4XY8 A;  2N9G A;  4QSR A;  5LJ1 A;  3MXF A;  5HEM A;  4OGJ A;  5EGU A;  4XUA A;  4O7E A;  4UYE A;  5E73 A;  5FG4 A;  3MUL A;  5CUB A;  5J0D A;  3UVW A;  5L99 A;  5LKU A;  4YYJ A;  5II2 A;  4QSW A;  4C67 A;  4XYA A;  5EV9 A;  4NRB A;  4CFL A;  5A5P A;  4N3W A;  4UIV A;  5FE1 A;  5EWH A;  4CUQ A;  4TQN A;  5C4Q A;  2R10 A;  4IOQ A;  4IR3 A;  4O74 A;  4QYD A;  5FDZ A;  2DAT A;  1EQF A;  5E3G A;  5FFV A;  3ONI A;  5COI A;  4TTE A;  5FB0 A;  4CUU A;  5CQ8 A;  4QR5 A;  4NUE A;  4CLB A;  4QR4 A;  5EIS A;  2E7O A;  4YK0 A;  4BW1 A;  3IU5 A;  3LJW A;  5BT3 A;  5HEL A;  5LUU A;  5D3H A;  5TCM A;  5EWW A;  3UW9 A;  3S91 A;  2KTB B;  5CQ5 A;  5CY9 A;  4QEU A;  4J1P A;  4DON A;  5DFC A;  4E96 A;  3ZYU A;  4UYD A;  4LYW A;  4A9H A;  5IID A;  3HME A;  5CUC A;  5ETB A;  4ALH A;  3UV2 A;  5EVA A;  4HXK A;  3HMH A;  4ZW1 A;  3S92 A;  4YY6 A;  3JVK A;  4YBM A;  5LKX A;  2YEL A;  4TZ8 A;  4FLP A;  4A9N A;  4QBM A;  5CS8 A;  4QSP A;  5CZG A;  4UIU A;  5A5R A;  4Z1S A;  4QSQ A;  4QY4 A;  2RNX A;  4MEO A;  2RI7 A;  4YYI A;  1F68 A;  4LYI A;  5IBN A;  5E0R A;  5FE9 A;  3SVH A;  3U5O A;  4UYF A;  4ZQL A;  4A9E A;  4OGI A;  3U5J A;  3U5P A;  3UV4 A;  3UVX A;  4QSV A;  3P1D A;  5E9M A;  5I88 A;  5I7X A;  5LVQ A;  3O36 A;  4NYX A;  4WHW A;  2DVR A;  5KTU A;  5I29 A;  4BW2 A;  5I83 A;  4PCI A;  4PTB A;  4Z6H A;  4TT4 A;  5CQ6 A;  4UIT A;  5LKT A;  4YYH A;  2YQD A;  5DKD A;  1JM4 B;  4PY6 A;  3MQM A;  4QEW A;  4QR3 A;  3U5M A;  5DFB A;  5DYU A;  4TYL A;  4O70 A;  3Q2E A;  4A9I A;  4LDF A;  4LRG A;  5KHM A;  5E7D A;  4NUD A;  3JVJ A;  4Z6I A;  5I1Q A;  5JI8 A;  3TLP A;  5L8U A;  3O33 A;  5CGP A;  5HLS A;  2I8N A;  5DBM A;  4MEN A;  5EWC A;  5EWD A;  2F6J A;  5D26 A;  4IOR A;  3P1E A;  5DYC A;  5EIC A;  5EWV A;  3AAD A;  5C87 A;  5HCL A;  2I7K A;  5F5Z A;  4HXS A;  2E3K A;  4YBT A;  4LZS A;  4J0R A;  4PCE A;  5CU8 A;  5C85 A;  5F1H A;  2YDW A;  4HXL A;  5A7C A;  5EPS A;  5FG6 A;  5E9Y A;  5FH8 A;  2R0V A;  2WP2 A;  4PKL A;  5EA1 A;  5D25 A;  3QZS A;  4BJX A;  5AMF A;  5E9I A;  5I7Y A;  5IGL A;  4CL9 A;  5A5Q A;  2FSA A;  5EQ1 A;  4QNS A;  4O77 A;  4HXM A;  4YYN A;  2DVQ A;  4LR6 A;  5CPE A;  4IOO A;  5E3D A;  4QUU A;  4QYL A;  3LQH A;  5D0C A;  5IGK A;  4LZ2 A;  5DLZ A;  5F36 A;  5HJC A;  5CQT A;  3MB4 A;  5CUG A;  4CUS A;  5I89 A;  3P1F A;  4A9J A;  5IGM A;  2OSS A;  4O76 A;  4QUT A;  5CQA A;  4QSX A;  5D3L A;  4N4I A;  4J0S A;  4N4F A;  1JSP B;  4QB3 A;  4O7A A;  4QSU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...