4NR5A

Crystal structure of the bromodomain of human crebbp in complex with an isoxazolyl-benzimidazole ligand
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
113
structure length
113
Chain Sequence
KIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CREB-binding protein
publication title Crystal structure of the bromodomain of human CREBBP in complex with an isoxazolyl-benzimidazole ligand
rcsb
source organism Homo sapiens
molecule tags Transcription/inhibitor
total genus 37
structure length 113
sequence length 113
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2013-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4nr5A00
5HENA 4QR4A 4YK0A 4QSSA 4NR7A 2H60A 5AMEA 5C4QA 5DYCA 2DVRA 2N9GA 4CUQA 2YELA 5F62A 3ONIA 4HXSA 5CGPA 2E3KA 4YH3A 4CFLA 5I86A 4HBXA 5DFDA 4NUCA 4QYDA 2DVSA 4QEUA 4Z6IA 2F6JA 5LVQA 5IIDA 5A5PA 4QUUA 5IBNA 2RFJA 4MR4A 4MENA 5CY9A 4OGIA 4BW3A 5A5RA 4Q0OA 5F5ZA 4BW2A 5I83A 5C89A 5DBMA 5CUAA 5FE9A 4NUEA 4O75A 5E9IA 5FE8A 2NXBA 5EPBA 2RNWA 2F6NA 4NR6A 5D26A 3U5NA 5KTWA 4HXPA 4MEPA 4NRCA 3LQHA 3HMEA 4J1PA 5FE2A 4TU6A 5CS8A 5C8GA 5CUDA 4MEQA 4TZ8A 1WUGA 4UIYA 4YATA 4ALGA 4IOQA 3LQIA 4BHWA 4QSVA 5L8TA 4LYIA 4PKLA 2R0VA 5DX4A 5AD2A 2I8NA 4MR6A 4O70A 5DKCA 5FE1A 3S92A 2YYNA 5FFYA 3LJWA 3O34A 1F68A 5HLSA 5HQ6A 4NYXA 4A9LA 5FDZA 3SVHA 4GPJA 4J3IA 4NXJA 4NUDA 5D3JA 5I29A 4PS5A 2DATA 2E7NA 4HXLA 4LYWA 5D3LA 4MR3A 5DYAA 2OO1A 4HXKA 5ENBA 5CTLA 2R0YA 4CUTA 4NQMA 5HQ5A 3O36A 4NR5A 4UIUA 5CUCA 2YQDA 1N72A 5IGLA 5F25A 4UIZA 5D3RA 5LKUA 5FE4A 3P1FA 4Z1SA 4TQNA 2YDWA 4A9NA 4QSXA 4TZ2A 4IR4A 4HXNA 1WUMA 1JM4B 5BT3A 4PCEA 5DKHA 5EWWA 5A5NA 5FE7A 4QSRA 5II2A 4PY6A 4A9OA 3O37A 4NRBA 4WHWA 5LJ1A 5E74A 5ENGA 5I1QA 5E9YA 5A81A 4XYAA 5FBXA 5A7CA 3JVMA 5FE3A 4N4IA 5IGMA 5LJ0A 3AADA 4QEVA 5HJCA 3MUKA 4HBYA 4QC3A 5CP5A 3JVLA 4CL9A 5ENFA 5EVAA 5CFWA 3QZVA 4TU4A 1ZS5A 3I3JA 2YEKA 5C87A 5CQ5A 5EWVA 4LDFA 2OUOA 4FLPA 3MQMA 4MEOA 4UIXA 2L84A 4UYDA 5DKDA 2WP2A 5CZGA 5EWCA 4CURA 4NR4A 5L99A 4O77A 5JWMA 3SVGA 4C66A 5FH7A 3O35A 5LKZA 5F1LA 5HFQA 3U5MA 4NR9A 5E9MA 3UVDA 4KV1A 5EI4A 5HFRA 3U5PA 4QR5A 5II1A 2L85A 5KU3A 3UVXA 5H85A 4O7BA 5ENJA 2DVVA 5FE6A 5E7DA 4F3IA 4O72A 3IU6A 4KCXA 4YYNA 5E3DA 5ENHA 4O7FA 5E3GA 5IGKA 5ENIA 5A83A 5CU8A 4QNSA 4A9IA 5HRXA 2I7KA 4HXMA 4ALHA 4IR3A 4C67A 4YABA 5DY7A 5H1UA 4OGJA 4XY9A 4YY6A 4CUPA 4NYWA 4QSTA 5A5SA 4TYLA 4Z93A 4UITA 4LYSA 3TLPA 4O74A 5CQ7A 2R10A 5I88A 4ZW1A 4DONA 5D3TA 5FG5A 3ZYUA 4QB3A 5FG4A 5LKXA 4YBTA 5CQ8A 5HELA 4CUSA 3S91A 4HXRA 5DW1A 5ETBA 1JSPB 4YADA 4Y03A 4HXOA 3HMFA 4A9JA 4HBWA 4O78A 5IGNA 4QZSA 5I89A 4QYLA 5CRMA 4YYDA 5L96A 4YY4A 2YW5A 4RVRA 5JI8A 3UW9A 4TS8A 4E96A 5L8UA 5LUUA 5EM3A 3U5KA 3D7CA 5CUEA 2DWWA 4XUBA 5FH6A 4QSWA 4ZQLA 4YAXA 5CQAA 5FE0A 4N3WA 2L5EA 3DWYA 3AQAA 5G4SA 5EWHA 5CQ3A 2KTBB 3IU5A 4TT2A 4QEWA 4QY4A 2RO1A 5KHMA 4TTEA 2DKWA 3Q2FA 5DFBA 4A9FA 4QBMA 4TT6A 4IOOA 5KTUA 4YBMA 4UYFB 5FB1A 4BJXA 5FE5A 3JVKA 3MULA 4CLBA 3DAIA 5DLXA 4NYVA 4QSQA 4UYEA 1EQFA 3MB4A 3P1CA 5L98A 5H1TA 3Q2EA 5D3SA 3HMHA 5A5OA 2RI7A 4UIVA 4UYGA 4N4HA 4Z6HA 5TCMA 5HM0A 5EWDA 5CRZA 3QZTA 3P5OA 1X0JA 4LZ2A 5E73A 5C7NA 3UVWA 5BT4A 5F36A 4UYFA 2E7OA 4N4FA 4LR6A 3MXFA 3U5LA 4LC2A 4YYIA 5C85A 3NXBA 5EV9A 5DFCA 4LRGA 4WHUA 3UV4A 5D0CA 4PTBA 5D7XA 3P1EA 3UV2A 4QSUA 5ENEA 3SVFA 5HRVA 4QSPA 4QR3A 5D3HA 4CUUA 5D3NA 4A9MA 5F2PA 5F60A 5K29A 3O33A 3MB3A 2OSSA 5KO4A 5D24A 4Q0NA 2YEMA 4LZRA 4MR5A 4IR6A 5EP7A 2G4AA 4A9KA 4Z1QA 4AKNA 5KTXA 2GRCA 3G0LA 4TT4A 5I7YA 2MJVB 4A9HA 4N4GA 3UVYA 5E9LA 5ETDA 5I40A 5HCLA 4OUFA 4NRAA 3U5JA 4YYMA 5E9VA 4X2IA 5EPSA 3K2JA 2FSAA 5LJ2A 5HQ7A 4BW4A 5TB6A 5D3PA 3LXJA 5ENCA 5AMFA 5COIA 4J0SA 4XY8A 4ZC9A 5H1VA 5LKTA 5EQ1A 5FFVA 4YYJA 5D25A 5I7XA 4HBVA 5F3AA 2D9EA 5I80A 5FH8A 3G0JA 5IG6A 4YYHA 3LQJA 4NR8A 5F63A 4J0RA 5J0DA 4QC1A 5EGUA 1E6IA 5EK9A 5A5QA 5FB0A 3RCWA 4IR5A 5EICA 4KV4A 4YBSA 5EU1A 4NS5A 5A85A 4XUAA 4CFKA 5BT5A 4O7EA 4A9EA 5HRWA 5L97A 5EISA 3UV5A 5FFWA 5CQ6A 4BW1A 3GG3A 5CQ4A 5AD3A 5ACYA 4WIVA 5HEMA 3U5OA 2D82A 5FG6A 3JVJA 5DYXA 5CQTA 2RNXA 5EPRA 4O7AA 5EA1A 4O76A 5CUGA 5DW2A 5LVRA 4O7CA 4YH4A 5DLZA 2RNYA 2R0SA 5CUBA 4YYGA 5CPEA 5F61A 5G4RA 5A82A 2RS9B 3P1DA 5DYUA 5F1HA 3QZSA 2WP1A 4O71A 2LSPB 4LZSA 4UIWA 4PCIA 5E0RA 4IORA 3FKMX 4QUTA 5E9KA 4YC9A 4YYKA 4UYHA 2DVQA 4NQNA
chains in the Genus database with same CATH superfamily
5HENA 4QR4A 4YK0A 4QSSA 4NR7A 2H60A 5AMEA 5C4QA 5DYCA 2DVRA 2N9GA 4CUQA 2YELA 5F62A 3ONIA 4HXSA 5CGPA 2E3KA 4YH3A 4CFLA 5I86A 4HBXA 5DFDA 4NUCA 4QYDA 2DVSA 4QEUA 4Z6IA 2F6JA 5LVQA 5IIDA 5A5PA 4QUUA 5IBNA 2RFJA 4MR4A 4MENA 5CY9A 4OGIA 4BW3A 5A5RA 4Q0OA 5F5ZA 4BW2A 5I83A 5C89A 5DBMA 5CUAA 5FE9A 4NUEA 4O75A 5E9IA 5FE8A 2NXBA 5EPBA 2RNWA 2F6NA 4NR6A 5D26A 3U5NA 5KTWA 4HXPA 4MEPA 4NRCA 3LQHA 3HMEA 4J1PA 5FE2A 4TU6A 5CS8A 5C8GA 5CUDA 4MEQA 4TZ8A 1WUGA 4UIYA 4YATA 2EJNA 4ALGA 4IOQA 3LQIA 4BHWA 4QSVA 5L8TA 4LYIA 4PKLA 2R0VA 5DX4A 5AD2A 2I8NA 4MR6A 4O70A 5DKCA 5FE1A 3S92A 2YYNA 5FFYA 3LJWA 3O34A 1F68A 5HLSA 5HQ6A 4NYXA 4A9LA 5FDZA 3SVHA 4GPJA 4J3IA 4NXJA 4NUDA 5D3JA 5I29A 4PS5A 2DATA 2E7NA 4HXLA 4LYWA 5D3LA 4MR3A 5DYAA 2OO1A 4HXKA 5ENBA 5CTLA 2R0YA 4CUTA 4NQMA 5HQ5A 3O36A 4NR5A 4UIUA 5CUCA 2YQDA 1N72A 5IGLA 5F25A 4UIZA 5D3RA 5LKUA 5FE4A 3P1FA 4Z1SA 4TQNA 2YDWA 4A9NA 1PUOA 4QSXA 4TZ2A 4IR4A 4HXNA 1WUMA 1JM4B 5BT3A 4PCEA 5DKHA 5EWWA 5A5NA 5FE7A 4QSRA 5II2A 1ZKRA 4PY6A 4A9OA 3O37A 4NRBA 4WHWA 5LJ1A 5E74A 5ENGA 5I1QA 5E9YA 5A81A 4XYAA 5FBXA 5A7CA 3JVMA 5FE3A 4N4IA 5IGMA 5LJ0A 3AADA 4QEVA 5HJCA 3MUKA 4HBYA 4QC3A 5CP5A 3JVLA 4AI6A 4CL9A 5ENFA 5EVAA 5CFWA 3QZVA 4TU4A 1ZS5A 3I3JA 2YEKA 5C87A 5CQ5A 5EWVA 4LDFA 2OUOA 4FLPA 3MQMA 4MEOA 4UIXA 2L84A 4UYDA 5DKDA 2WP2A 5CZGA 5EWCA 4CURA 4NR4A 5L99A 4O77A 5JWMA 3SVGA 4C66A 5FH7A 3O35A 5LKZA 5F1LA 5HFQA 3U5MA 4NR9A 5E9MA 3UVDA 4KV1A 5EI4A 5HFRA 3U5PA 4QR5A 5II1A 2L85A 5KU3A 3UVXA 5H85A 4O7BA 5ENJA 2DVVA 5FE6A 5E7DA 3D1DA 4F3IA 4O72A 3IU6A 4KCXA 4YYNA 5E3DA 5ENHA 4O7FA 5E3GA 5IGKA 5ENIA 5A83A 5CU8A 4QNSA 4A9IA 5HRXA 2I7KA 4HXMA 4ALHA 4IR3A 4C67A 4YABA 5DY7A 5H1UA 4OGJA 4XY9A 4YY6A 4CUPA 4NYWA 4QSTA 5A5SA 4TYLA 4Z93A 4UITA 4LYSA 3TLPA 4O74A 5CQ7A 2R10A 5I88A 4ZW1A 4DONA 5D3TA 5FG5A 3ZYUA 4QB3A 5FG4A 5LKXA 4YBTA 5CQ8A 5HELA 4CUSA 3S91A 4HXRA 5DW1A 5ETBA 1JSPB 4YADA 4Y03A 4HXOA 3HMFA 4A9JA 4HBWA 4O78A 5IGNA 4QZSA 5I89A 4QYLA 5CRMA 4YYDA 5L96A 4YY4A 2YW5A 4RVRA 5JI8A 3UW9A 4TS8A 4E96A 5L8UA 5LUUA 5EM3A 3U5KA 3D7CA 5CUEA 2DWWA 4XUBA 5FH6A 4QSWA 4ZQLA 4YAXA 5CQAA 5FE0A 4N3WA 2L5EA 3DWYA 3AQAA 5G4SA 5EWHA 5CQ3A 2KTBB 3IU5A 4TT2A 4QEWA 4QY4A 2RO1A 5KHMA 4TTEA 2DKWA 3Q2FA 5DFBA 4A9FA 4QBMA 4TT6A 4IOOA 5KTUA 4YBMA 4UYFB 5FB1A 4BJXA 5FE5A 3JVKA 3MULA 4CLBA 4AKHA 3DAIA 5DLXA 4NYVA 4QSQA 4UYEA 1EQFA 3MB4A 3P1CA 5L98A 5H1TA 3Q2EA 5D3SA 3HMHA 5A5OA 2RI7A 4UIVA 4UYGA 4N4HA 4Z6HA 5TCMA 5HM0A 5EWDA 5CRZA 3QZTA 3P5OA 1X0JA 4LZ2A 5E73A 5C7NA 3UVWA 5BT4A 5F36A 4UYFA 2E7OA 4N4FA 4LR6A 3MXFA 3U5LA 4LC2A 4YYIA 5C85A 3NXBA 5EV9A 5DFCA 4LRGA 4WHUA 3UV4A 5D0CA 4PTBA 5D7XA 3P1EA 3UV2A 4QSUA 5ENEA 3SVFA 5HRVA 4QSPA 4QR3A 5D3HA 4CUUA 5D3NA 4A9MA 5F2PA 5F60A 3VKGA 5K29A 3O33A 3MB3A 2OSSA 5KO4A 5D24A 4Q0NA 2YEMA 4LZRA 4MR5A 4IR6A 5EP7A 2G4AA 4A9KA 4Z1QA 4AKNA 5KTXA 2GRCA 3G0LA 4TT4A 5I7YA 2MJVB 4A9HA 4N4GA 3UVYA 5E9LA 5ETDA 5I40A 5HCLA 4OUFA 4NRAA 3U5JA 4YYMA 5E9VA 4X2IA 5EPSA 3K2JA 2FSAA 5LJ2A 5HQ7A 4BW4A 5TB6A 5D3PA 3LXJA 5ENCA 5AMFA 5COIA 4J0SA 4XY8A 4ZC9A 5H1VA 5LKTA 5EQ1A 5FFVA 4YYJA 5D25A 5I7XA 4HBVA 5F3AA 2D9EA 5I80A 5FH8A 3D1BA 3G0JA 5IG6A 4YYHA 3LQJA 4NR8A 5F63A 4J0RA 5J0DA 4QC1A 5EGUA 1E6IA 5EK9A 5A5QA 5FB0A 3RCWA 4IR5A 5EICA 4KV4A 4YBSA 5EU1A 4NS5A 5A85A 4XUAA 4CFKA 3VKHA 5BT5A 4AKIA 4O7EA 4A9EA 5HRWA 5L97A 5EISA 3UV5A 5FFWA 5CQ6A 4BW1A 3GG3A 5CQ4A 5AD3A 5ACYA 4WIVA 3ERRA 5HEMA 3U5OA 2D82A 5FG6A 3JVJA 5DYXA 5CQTA 2RNXA 5EPRA 4AKGA 4O7AA 5EA1A 4O76A 5CUGA 5DW2A 5LVRA 4O7CA 4YH4A 5DLZA 2RNYA 2R0SA 5CUBA 4YYGA 5CPEA 5F61A 5G4RA 5A82A 2RS9B 3P1DA 5DYUA 5F1HA 3QZSA 2WP1A 4O71A 2LSPB 4LZSA 4UIWA 4PCIA 5E0RA 4IORA 3FKMX 4QUTA 5E9KA 4YC9A 4YYKA 4UYHA 2DVQA 4NQNA
chains in the Genus database with same CATH topology
5HENA 4QR4A 4YK0A 4QSSA 4NR7A 2H60A 5AMEA 5C4QA 5DYCA 2DVRA 2N9GA 4CUQA 2YELA 5F62A 3ONIA 4HXSA 5CGPA 2E3KA 4YH3A 4CFLA 5I86A 4HBXA 5DFDA 4NUCA 4QYDA 2DVSA 4QEUA 4Z6IA 2F6JA 5LVQA 5IIDA 5A5PA 4QUUA 5IBNA 2RFJA 4MR4A 4MENA 5CY9A 4OGIA 4BW3A 5A5RA 4Q0OA 5F5ZA 4BW2A 5I83A 5C89A 5DBMA 5CUAA 5FE9A 4NUEA 4O75A 5E9IA 5FE8A 2NXBA 5EPBA 2RNWA 2F6NA 4NR6A 5D26A 3U5NA 5KTWA 4HXPA 4MEPA 4NRCA 3LQHA 3HMEA 4J1PA 5FE2A 4TU6A 5CS8A 5C8GA 5CUDA 4MEQA 4TZ8A 1WUGA 4UIYA 4YATA 4ALGA 4IOQA 3LQIA 4BHWA 4QSVA 5L8TA 4LYIA 4PKLA 2R0VA 5DX4A 5AD2A 2I8NA 4MR6A 4O70A 5DKCA 5FE1A 3S92A 2YYNA 5FFYA 3LJWA 3O34A 1F68A 5HLSA 5HQ6A 4NYXA 4A9LA 5FDZA 3SVHA 4GPJA 4J3IA 4NXJA 4NUDA 5D3JA 5I29A 4PS5A 2DATA 2E7NA 4HXLA 4LYWA 5D3LA 4MR3A 5DYAA 2OO1A 4HXKA 5ENBA 5CTLA 2R0YA 4CUTA 4NQMA 5HQ5A 3O36A 4NR5A 4UIUA 5CUCA 2YQDA 1N72A 5IGLA 5F25A 4UIZA 5D3RA 5LKUA 5FE4A 3P1FA 4Z1SA 4TQNA 2YDWA 4A9NA 4QSXA 4TZ2A 4IR4A 4HXNA 1WUMA 1JM4B 5BT3A 4PCEA 5DKHA 5EWWA 5A5NA 5FE7A 4QSRA 5II2A 4PY6A 4A9OA 3O37A 4NRBA 4WHWA 5LJ1A 5E74A 5ENGA 5I1QA 5E9YA 5A81A 4XYAA 5FBXA 5A7CA 3JVMA 5FE3A 4N4IA 5IGMA 5LJ0A 3AADA 4QEVA 5HJCA 3MUKA 4HBYA 4QC3A 5CP5A 3JVLA 4CL9A 5ENFA 5EVAA 5CFWA 3QZVA 4TU4A 1ZS5A 3I3JA 2YEKA 5C87A 5CQ5A 5EWVA 4LDFA 2OUOA 4FLPA 3MQMA 4MEOA 4UIXA 2L84A 4UYDA 5DKDA 2WP2A 5CZGA 5EWCA 4CURA 4NR4A 5L99A 4O77A 5JWMA 3SVGA 4C66A 5FH7A 3O35A 5LKZA 5F1LA 5HFQA 3U5MA 4NR9A 5E9MA 3UVDA 4KV1A 5EI4A 5HFRA 3U5PA 4QR5A 5II1A 2L85A 5KU3A 3UVXA 5H85A 4O7BA 5ENJA 2DVVA 5FE6A 5E7DA 4F3IA 4O72A 3IU6A 4KCXA 4YYNA 5E3DA 5ENHA 4O7FA 5E3GA 5IGKA 5ENIA 5A83A 5CU8A 4QNSA 4A9IA 5HRXA 2I7KA 4HXMA 4ALHA 4IR3A 4C67A 4YABA 5DY7A 5H1UA 4OGJA 4XY9A 4YY6A 4CUPA 4NYWA 4QSTA 5A5SA 4TYLA 4Z93A 4UITA 4LYSA 3TLPA 4O74A 5CQ7A 2R10A 5I88A 4ZW1A 4DONA 5D3TA 5FG5A 3ZYUA 4QB3A 5FG4A 5LKXA 4YBTA 5CQ8A 5HELA 4CUSA 3S91A 4HXRA 5DW1A 5ETBA 1JSPB 4YADA 4Y03A 4HXOA 3HMFA 4A9JA 4HBWA 4O78A 5IGNA 4QZSA 5I89A 4QYLA 5CRMA 4YYDA 5L96A 4YY4A 2YW5A 4RVRA 5JI8A 3UW9A 4TS8A 4E96A 5L8UA 5LUUA 5EM3A 3U5KA 3D7CA 5CUEA 2DWWA 4XUBA 5FH6A 4QSWA 4ZQLA 4YAXA 5CQAA 5FE0A 4N3WA 2L5EA 3DWYA 3AQAA 5G4SA 5EWHA 5CQ3A 2KTBB 3IU5A 4TT2A 4QEWA 4QY4A 2RO1A 5KHMA 4TTEA 2DKWA 3Q2FA 5DFBA 4A9FA 4QBMA 4TT6A 4IOOA 5KTUA 4YBMA 4UYFB 5FB1A 4BJXA 5FE5A 3JVKA 3MULA 4CLBA 3DAIA 5DLXA 4NYVA 4QSQA 4UYEA 1EQFA 3MB4A 3P1CA 5L98A 5H1TA 3Q2EA 5D3SA 3HMHA 5A5OA 2RI7A 4UIVA 4UYGA 4N4HA 4Z6HA 5TCMA 5HM0A 5EWDA 5CRZA 3QZTA 3P5OA 1X0JA 4LZ2A 5E73A 5C7NA 3UVWA 5BT4A 5F36A 4UYFA 2E7OA 4N4FA 4LR6A 3MXFA 3U5LA 4LC2A 4YYIA 5C85A 3NXBA 5EV9A 5DFCA 4LRGA 4WHUA 3UV4A 5D0CA 4PTBA 5D7XA 3P1EA 3UV2A 4QSUA 5ENEA 3SVFA 5HRVA 4QSPA 4QR3A 5D3HA 4CUUA 5D3NA 4A9MA 5F2PA 5F60A 5K29A 3O33A 3MB3A 2OSSA 5KO4A 5D24A 4Q0NA 2YEMA 4LZRA 4MR5A 4IR6A 5EP7A 2G4AA 4A9KA 4Z1QA 4AKNA 5KTXA 2GRCA 3G0LA 4TT4A 5I7YA 2MJVB 4A9HA 4N4GA 3UVYA 5E9LA 5ETDA 5I40A 5HCLA 4OUFA 4NRAA 3U5JA 4YYMA 5E9VA 4X2IA 5EPSA 3K2JA 2FSAA 5LJ2A 5HQ7A 4BW4A 5TB6A 5D3PA 3LXJA 5ENCA 5AMFA 5COIA 4J0SA 4XY8A 4ZC9A 5H1VA 5LKTA 5EQ1A 5FFVA 4YYJA 5D25A 5I7XA 4HBVA 5F3AA 2D9EA 5I80A 5FH8A 3G0JA 5IG6A 4YYHA 3LQJA 4NR8A 5F63A 4J0RA 5J0DA 4QC1A 5EGUA 1E6IA 5EK9A 5A5QA 5FB0A 3RCWA 4IR5A 5EICA 4KV4A 4YBSA 5EU1A 4NS5A 5A85A 4XUAA 4CFKA 5BT5A 4O7EA 4A9EA 5HRWA 5L97A 5EISA 3UV5A 5FFWA 5CQ6A 4BW1A 3GG3A 5CQ4A 5AD3A 5ACYA 4WIVA 5HEMA 3U5OA 2D82A 5FG6A 3JVJA 5DYXA 5CQTA 2RNXA 5EPRA 4O7AA 5EA1A 4O76A 5CUGA 5DW2A 5LVRA 4O7CA 4YH4A 5DLZA 2RNYA 2R0SA 5CUBA 4YYGA 5CPEA 5F61A 5G4RA 5A82A 2RS9B 3P1DA 5DYUA 5F1HA 3QZSA 2WP1A 4O71A 2LSPB 4LZSA 4UIWA 4PCIA 5E0RA 4IORA 3FKMX 4QUTA 5E9KA 4YC9A 4YYKA 4UYHA 2DVQA 4NQNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HEN A;  4QR4 A;  4YK0 A;  4QSS A;  4NR7 A;  2H60 A;  5AME A;  5C4Q A;  5DYC A;  2DVR A;  2N9G A;  4CUQ A;  2YEL A;  5F62 A;  3ONI A;  4HXS A;  5CGP A;  2E3K A;  4YH3 A;  4CFL A;  5I86 A;  4HBX A;  5DFD A;  4NUC A;  4QYD A;  2DVS A;  4QEU A;  4Z6I A;  2F6J A;  5LVQ A;  5IID A;  5A5P A;  4QUU A;  5IBN A;  2RFJ A;  4MR4 A;  4MEN A;  5CY9 A;  4OGI A;  4BW3 A;  5A5R A;  4Q0O A;  5F5Z A;  4BW2 A;  5I83 A;  5C89 A;  5DBM A;  5CUA A;  5FE9 A;  4NUE A;  4O75 A;  5E9I A;  5FE8 A;  2NXB A;  5EPB A;  2RNW A;  2F6N A;  4NR6 A;  5D26 A;  3U5N A;  5KTW A;  4HXP A;  4MEP A;  4NRC A;  3LQH A;  3HME A;  4J1P A;  5FE2 A;  4TU6 A;  5CS8 A;  5C8G A;  5CUD A;  4MEQ A;  4TZ8 A;  1WUG A;  4UIY A;  4YAT A;  4ALG A;  4IOQ A;  3LQI A;  4BHW A;  4QSV A;  5L8T A;  4LYI A;  4PKL A;  2R0V A;  5DX4 A;  5AD2 A;  2I8N A;  4MR6 A;  4O70 A;  5DKC A;  5FE1 A;  3S92 A;  2YYN A;  5FFY A;  3LJW A;  3O34 A;  1F68 A;  5HLS A;  5HQ6 A;  4NYX A;  4A9L A;  5FDZ A;  3SVH A;  4GPJ A;  4J3I A;  4NXJ A;  4NUD A;  5D3J A;  5I29 A;  4PS5 A;  2DAT A;  2E7N A;  4HXL A;  4LYW A;  5D3L A;  4MR3 A;  5DYA A;  2OO1 A;  4HXK A;  5ENB A;  5CTL A;  2R0Y A;  4CUT A;  4NQM A;  5HQ5 A;  3O36 A;  4NR5 A;  4UIU A;  5CUC A;  2YQD A;  1N72 A;  5IGL A;  5F25 A;  4UIZ A;  5D3R A;  5LKU A;  5FE4 A;  3P1F A;  4Z1S A;  4TQN A;  2YDW A;  4A9N A;  4QSX A;  4TZ2 A;  4IR4 A;  4HXN A;  1WUM A;  1JM4 B;  5BT3 A;  4PCE A;  5DKH A;  5EWW A;  5A5N A;  5FE7 A;  4QSR A;  5II2 A;  4PY6 A;  4A9O A;  3O37 A;  4NRB A;  4WHW A;  5LJ1 A;  5E74 A;  5ENG A;  5I1Q A;  5E9Y A;  5A81 A;  4XYA A;  5FBX A;  5A7C A;  3JVM A;  5FE3 A;  4N4I A;  5IGM A;  5LJ0 A;  3AAD A;  4QEV A;  5HJC A;  3MUK A;  4HBY A;  4QC3 A;  5CP5 A;  3JVL A;  4CL9 A;  5ENF A;  5EVA A;  5CFW A;  3QZV A;  4TU4 A;  1ZS5 A;  3I3J A;  2YEK A;  5C87 A;  5CQ5 A;  5EWV A;  4LDF A;  2OUO A;  4FLP A;  3MQM A;  4MEO A;  4UIX A;  2L84 A;  4UYD A;  5DKD A;  2WP2 A;  5CZG A;  5EWC A;  4CUR A;  4NR4 A;  5L99 A;  4O77 A;  5JWM A;  3SVG A;  4C66 A;  5FH7 A;  3O35 A;  5LKZ A;  5F1L A;  5HFQ A;  3U5M A;  4NR9 A;  5E9M A;  3UVD A;  4KV1 A;  5EI4 A;  5HFR A;  3U5P A;  4QR5 A;  5II1 A;  2L85 A;  5KU3 A;  3UVX A;  5H85 A;  4O7B A;  5ENJ A;  2DVV A;  5FE6 A;  5E7D A;  4F3I A;  4O72 A;  3IU6 A;  4KCX A;  4YYN A;  5E3D A;  5ENH A;  4O7F A;  5E3G A;  5IGK A;  5ENI A;  5A83 A;  5CU8 A;  4QNS A;  4A9I A;  5HRX A;  2I7K A;  4HXM A;  4ALH A;  4IR3 A;  4C67 A;  4YAB A;  5DY7 A;  5H1U A;  4OGJ A;  4XY9 A;  4YY6 A;  4CUP A;  4NYW A;  4QST A;  5A5S A;  4TYL A;  4Z93 A;  4UIT A;  4LYS A;  3TLP A;  4O74 A;  5CQ7 A;  2R10 A;  5I88 A;  4ZW1 A;  4DON A;  5D3T A;  5FG5 A;  3ZYU A;  4QB3 A;  5FG4 A;  5LKX A;  4YBT A;  5CQ8 A;  5HEL A;  4CUS A;  3S91 A;  4HXR A;  5DW1 A;  5ETB A;  1JSP B;  4YAD A;  4Y03 A;  4HXO A;  3HMF A;  4A9J A;  4HBW A;  4O78 A;  5IGN A;  4QZS A;  5I89 A;  4QYL A;  5CRM A;  4YYD A;  5L96 A;  4YY4 A;  2YW5 A;  4RVR A;  5JI8 A;  3UW9 A;  4TS8 A;  4E96 A;  5L8U A;  5LUU A;  5EM3 A;  3U5K A;  3D7C A;  5CUE A;  2DWW A;  4XUB A;  5FH6 A;  4QSW A;  4ZQL A;  4YAX A;  5CQA A;  5FE0 A;  4N3W A;  2L5E A;  3DWY A;  3AQA A;  5G4S A;  5EWH A;  5CQ3 A;  2KTB B;  3IU5 A;  4TT2 A;  4QEW A;  4QY4 A;  2RO1 A;  5KHM A;  4TTE A;  2DKW A;  3Q2F A;  5DFB A;  4A9F A;  4QBM A;  4TT6 A;  4IOO A;  5KTU A;  4YBM A;  4UYF B;  5FB1 A;  4BJX A;  5FE5 A;  3JVK A;  3MUL A;  4CLB A;  3DAI A;  5DLX A;  4NYV A;  4QSQ A;  4UYE A;  1EQF A;  3MB4 A;  3P1C A;  5L98 A;  5H1T A;  3Q2E A;  5D3S A;  3HMH A;  5A5O A;  2RI7 A;  4UIV A;  4UYG A;  4N4H A;  4Z6H A;  5TCM A;  5HM0 A;  5EWD A;  5CRZ A;  3QZT A;  3P5O A;  1X0J A;  4LZ2 A;  5E73 A;  5C7N A;  3UVW A;  5BT4 A;  5F36 A;  4UYF A;  2E7O A;  4N4F A;  4LR6 A;  3MXF A;  3U5L A;  4LC2 A;  4YYI A;  5C85 A;  3NXB A;  5EV9 A;  5DFC A;  4LRG A;  4WHU A;  3UV4 A;  5D0C A;  4PTB A;  5D7X A;  3P1E A;  3UV2 A;  4QSU A;  5ENE A;  3SVF A;  5HRV A;  4QSP A;  4QR3 A;  5D3H A;  4CUU A;  5D3N A;  4A9M A;  5F2P A;  5F60 A;  5K29 A;  3O33 A;  3MB3 A;  2OSS A;  5KO4 A;  5D24 A;  4Q0N A;  2YEM A;  4LZR A;  4MR5 A;  4IR6 A;  5EP7 A;  2G4A A;  4A9K A;  4Z1Q A;  4AKN A;  5KTX A;  2GRC A;  3G0L A;  4TT4 A;  5I7Y A;  2MJV B;  4A9H A;  4N4G A;  3UVY A;  5E9L A;  5ETD A;  5I40 A;  5HCL A;  4OUF A;  4NRA A;  3U5J A;  4YYM A;  5E9V A;  4X2I A;  5EPS A;  3K2J A;  2FSA A;  5LJ2 A;  5HQ7 A;  4BW4 A;  5TB6 A;  5D3P A;  3LXJ A;  5ENC A;  5AMF A;  5COI A;  4J0S A;  4XY8 A;  4ZC9 A;  5H1V A;  5LKT A;  5EQ1 A;  5FFV A;  4YYJ A;  5D25 A;  5I7X A;  4HBV A;  5F3A A;  2D9E A;  5I80 A;  5FH8 A;  3G0J A;  5IG6 A;  4YYH A;  3LQJ A;  4NR8 A;  5F63 A;  4J0R A;  5J0D A;  4QC1 A;  5EGU A;  1E6I A;  5EK9 A;  5A5Q A;  5FB0 A;  3RCW A;  4IR5 A;  5EIC A;  4KV4 A;  4YBS A;  5EU1 A;  4NS5 A;  5A85 A;  4XUA A;  4CFK A;  5BT5 A;  4O7E A;  4A9E A;  5HRW A;  5L97 A;  5EIS A;  3UV5 A;  5FFW A;  5CQ6 A;  4BW1 A;  3GG3 A;  5CQ4 A;  5AD3 A;  5ACY A;  4WIV A;  5HEM A;  3U5O A;  2D82 A;  5FG6 A;  3JVJ A;  5DYX A;  5CQT A;  2RNX A;  5EPR A;  4O7A A;  5EA1 A;  4O76 A;  5CUG A;  5DW2 A;  5LVR A;  4O7C A;  4YH4 A;  5DLZ A;  2RNY A;  2R0S A;  5CUB A;  4YYG A;  5CPE A;  5F61 A;  5G4R A;  5A82 A;  2RS9 B;  3P1D A;  5DYU A;  5F1H A;  3QZS A;  2WP1 A;  4O71 A;  2LSP B;  4LZS A;  4UIW A;  4PCI A;  5E0R A;  4IOR A;  3FKM X;  4QUT A;  5E9K A;  4YC9 A;  4YYK A;  4UYH A;  2DVQ A;  4NQN A; 
#chains in the Genus database with same CATH topology
 5HEN A;  4QR4 A;  4YK0 A;  4QSS A;  4NR7 A;  2H60 A;  5AME A;  5C4Q A;  5DYC A;  2DVR A;  2N9G A;  4CUQ A;  2YEL A;  5F62 A;  3ONI A;  4HXS A;  5CGP A;  2E3K A;  4YH3 A;  4CFL A;  5I86 A;  4HBX A;  5DFD A;  4NUC A;  4QYD A;  2DVS A;  4QEU A;  4Z6I A;  2F6J A;  5LVQ A;  5IID A;  5A5P A;  4QUU A;  5IBN A;  2RFJ A;  4MR4 A;  4MEN A;  5CY9 A;  4OGI A;  4BW3 A;  5A5R A;  4Q0O A;  5F5Z A;  4BW2 A;  5I83 A;  5C89 A;  5DBM A;  5CUA A;  5FE9 A;  4NUE A;  4O75 A;  5E9I A;  5FE8 A;  2NXB A;  5EPB A;  2RNW A;  2F6N A;  4NR6 A;  5D26 A;  3U5N A;  5KTW A;  4HXP A;  4MEP A;  4NRC A;  3LQH A;  3HME A;  4J1P A;  5FE2 A;  4TU6 A;  5CS8 A;  5C8G A;  5CUD A;  4MEQ A;  4TZ8 A;  1WUG A;  4UIY A;  4YAT A;  2EJN A;  4ALG A;  4IOQ A;  3LQI A;  4BHW A;  4QSV A;  5L8T A;  4LYI A;  4PKL A;  2R0V A;  5DX4 A;  5AD2 A;  2I8N A;  4MR6 A;  4O70 A;  5DKC A;  5FE1 A;  3S92 A;  2YYN A;  5FFY A;  3LJW A;  3O34 A;  1F68 A;  5HLS A;  5HQ6 A;  4NYX A;  4A9L A;  5FDZ A;  3SVH A;  4GPJ A;  4J3I A;  4NXJ A;  4NUD A;  5D3J A;  5I29 A;  4PS5 A;  2DAT A;  2E7N A;  4HXL A;  4LYW A;  5D3L A;  4MR3 A;  5DYA A;  2OO1 A;  4HXK A;  5ENB A;  5CTL A;  2R0Y A;  4CUT A;  4NQM A;  5HQ5 A;  3O36 A;  4NR5 A;  4UIU A;  5CUC A;  2YQD A;  1N72 A;  5IGL A;  5F25 A;  4UIZ A;  5D3R A;  5LKU A;  5FE4 A;  3P1F A;  4Z1S A;  4TQN A;  2YDW A;  4A9N A;  1PUO A;  4QSX A;  4TZ2 A;  4IR4 A;  4HXN A;  1WUM A;  1JM4 B;  5BT3 A;  4PCE A;  5DKH A;  5EWW A;  5A5N A;  5FE7 A;  4QSR A;  5II2 A;  1ZKR A;  4PY6 A;  4A9O A;  3O37 A;  4NRB A;  4WHW A;  5LJ1 A;  5E74 A;  5ENG A;  5I1Q A;  5E9Y A;  5A81 A;  4XYA A;  5FBX A;  5A7C A;  3JVM A;  5FE3 A;  4N4I A;  5IGM A;  5LJ0 A;  3AAD A;  4QEV A;  5HJC A;  3MUK A;  4HBY A;  4QC3 A;  5CP5 A;  3JVL A;  4AI6 A;  4CL9 A;  5ENF A;  5EVA A;  5CFW A;  3QZV A;  4TU4 A;  1ZS5 A;  3I3J A;  2YEK A;  5C87 A;  5CQ5 A;  5EWV A;  4LDF A;  2OUO A;  4FLP A;  3MQM A;  4MEO A;  4UIX A;  2L84 A;  4UYD A;  5DKD A;  2WP2 A;  5CZG A;  5EWC A;  4CUR A;  4NR4 A;  5L99 A;  4O77 A;  5JWM A;  3SVG A;  4C66 A;  5FH7 A;  3O35 A;  5LKZ A;  5F1L A;  5HFQ A;  3U5M A;  4NR9 A;  5E9M A;  3UVD A;  4KV1 A;  5EI4 A;  5HFR A;  3U5P A;  4QR5 A;  5II1 A;  2L85 A;  5KU3 A;  3UVX A;  5H85 A;  4O7B A;  5ENJ A;  2DVV A;  5FE6 A;  5E7D A;  3D1D A;  4F3I A;  4O72 A;  3IU6 A;  4KCX A;  4YYN A;  5E3D A;  5ENH A;  4O7F A;  5E3G A;  5IGK A;  5ENI A;  5A83 A;  5CU8 A;  4QNS A;  4A9I A;  5HRX A;  2I7K A;  4HXM A;  4ALH A;  4IR3 A;  4C67 A;  4YAB A;  5DY7 A;  5H1U A;  4OGJ A;  4XY9 A;  4YY6 A;  4CUP A;  4NYW A;  4QST A;  5A5S A;  4TYL A;  4Z93 A;  4UIT A;  4LYS A;  3TLP A;  4O74 A;  5CQ7 A;  2R10 A;  5I88 A;  4ZW1 A;  4DON A;  5D3T A;  5FG5 A;  3ZYU A;  4QB3 A;  5FG4 A;  5LKX A;  4YBT A;  5CQ8 A;  5HEL A;  4CUS A;  3S91 A;  4HXR A;  5DW1 A;  5ETB A;  1JSP B;  4YAD A;  4Y03 A;  4HXO A;  3HMF A;  4A9J A;  4HBW A;  4O78 A;  5IGN A;  4QZS A;  5I89 A;  4QYL A;  5CRM A;  4YYD A;  5L96 A;  4YY4 A;  2YW5 A;  4RVR A;  5JI8 A;  3UW9 A;  4TS8 A;  4E96 A;  5L8U A;  5LUU A;  5EM3 A;  3U5K A;  3D7C A;  5CUE A;  2DWW A;  4XUB A;  5FH6 A;  4QSW A;  4ZQL A;  4YAX A;  5CQA A;  5FE0 A;  4N3W A;  2L5E A;  3DWY A;  3AQA A;  5G4S A;  5EWH A;  5CQ3 A;  2KTB B;  3IU5 A;  4TT2 A;  4QEW A;  4QY4 A;  2RO1 A;  5KHM A;  4TTE A;  2DKW A;  3Q2F A;  5DFB A;  4A9F A;  4QBM A;  4TT6 A;  4IOO A;  5KTU A;  4YBM A;  4UYF B;  5FB1 A;  4BJX A;  5FE5 A;  3JVK A;  3MUL A;  4CLB A;  4AKH A;  3DAI A;  5DLX A;  4NYV A;  4QSQ A;  4UYE A;  1EQF A;  3MB4 A;  3P1C A;  5L98 A;  5H1T A;  3Q2E A;  5D3S A;  3HMH A;  5A5O A;  2RI7 A;  4UIV A;  4UYG A;  4N4H A;  4Z6H A;  5TCM A;  5HM0 A;  5EWD A;  5CRZ A;  3QZT A;  3P5O A;  1X0J A;  4LZ2 A;  5E73 A;  5C7N A;  3UVW A;  5BT4 A;  5F36 A;  4UYF A;  2E7O A;  4N4F A;  4LR6 A;  3MXF A;  3U5L A;  4LC2 A;  4YYI A;  5C85 A;  3NXB A;  5EV9 A;  5DFC A;  4LRG A;  4WHU A;  3UV4 A;  5D0C A;  4PTB A;  5D7X A;  3P1E A;  3UV2 A;  4QSU A;  5ENE A;  3SVF A;  5HRV A;  4QSP A;  4QR3 A;  5D3H A;  4CUU A;  5D3N A;  4A9M A;  5F2P A;  5F60 A;  3VKG A;  5K29 A;  3O33 A;  3MB3 A;  2OSS A;  5KO4 A;  5D24 A;  4Q0N A;  2YEM A;  4LZR A;  4MR5 A;  4IR6 A;  5EP7 A;  2G4A A;  4A9K A;  4Z1Q A;  4AKN A;  5KTX A;  2GRC A;  3G0L A;  4TT4 A;  5I7Y A;  2MJV B;  4A9H A;  4N4G A;  3UVY A;  5E9L A;  5ETD A;  5I40 A;  5HCL A;  4OUF A;  4NRA A;  3U5J A;  4YYM A;  5E9V A;  4X2I A;  5EPS A;  3K2J A;  2FSA A;  5LJ2 A;  5HQ7 A;  4BW4 A;  5TB6 A;  5D3P A;  3LXJ A;  5ENC A;  5AMF A;  5COI A;  4J0S A;  4XY8 A;  4ZC9 A;  5H1V A;  5LKT A;  5EQ1 A;  5FFV A;  4YYJ A;  5D25 A;  5I7X A;  4HBV A;  5F3A A;  2D9E A;  5I80 A;  5FH8 A;  3D1B A;  3G0J A;  5IG6 A;  4YYH A;  3LQJ A;  4NR8 A;  5F63 A;  4J0R A;  5J0D A;  4QC1 A;  5EGU A;  1E6I A;  5EK9 A;  5A5Q A;  5FB0 A;  3RCW A;  4IR5 A;  5EIC A;  4KV4 A;  4YBS A;  5EU1 A;  4NS5 A;  5A85 A;  4XUA A;  4CFK A;  3VKH A;  5BT5 A;  4AKI A;  4O7E A;  4A9E A;  5HRW A;  5L97 A;  5EIS A;  3UV5 A;  5FFW A;  5CQ6 A;  4BW1 A;  3GG3 A;  5CQ4 A;  5AD3 A;  5ACY A;  4WIV A;  3ERR A;  5HEM A;  3U5O A;  2D82 A;  5FG6 A;  3JVJ A;  5DYX A;  5CQT A;  2RNX A;  5EPR A;  4AKG A;  4O7A A;  5EA1 A;  4O76 A;  5CUG A;  5DW2 A;  5LVR A;  4O7C A;  4YH4 A;  5DLZ A;  2RNY A;  2R0S A;  5CUB A;  4YYG A;  5CPE A;  5F61 A;  5G4R A;  5A82 A;  2RS9 B;  3P1D A;  5DYU A;  5F1H A;  3QZS A;  2WP1 A;  4O71 A;  2LSP B;  4LZS A;  4UIW A;  4PCI A;  5E0R A;  4IOR A;  3FKM X;  4QUT A;  5E9K A;  4YC9 A;  4YYK A;  4UYH A;  2DVQ A;  4NQN A; 
#chains in the Genus database with same CATH homology
 5HEN A;  4QR4 A;  4YK0 A;  4QSS A;  4NR7 A;  2H60 A;  5AME A;  5C4Q A;  5DYC A;  2DVR A;  2N9G A;  4CUQ A;  2YEL A;  5F62 A;  3ONI A;  4HXS A;  5CGP A;  2E3K A;  4YH3 A;  4CFL A;  5I86 A;  4HBX A;  5DFD A;  4NUC A;  4QYD A;  2DVS A;  4QEU A;  4Z6I A;  2F6J A;  5LVQ A;  5IID A;  5A5P A;  4QUU A;  5IBN A;  2RFJ A;  4MR4 A;  4MEN A;  5CY9 A;  4OGI A;  4BW3 A;  5A5R A;  4Q0O A;  5F5Z A;  4BW2 A;  5I83 A;  5C89 A;  5DBM A;  5CUA A;  5FE9 A;  4NUE A;  4O75 A;  5E9I A;  5FE8 A;  2NXB A;  5EPB A;  2RNW A;  2F6N A;  4NR6 A;  5D26 A;  3U5N A;  5KTW A;  4HXP A;  4MEP A;  4NRC A;  3LQH A;  3HME A;  4J1P A;  5FE2 A;  4TU6 A;  5CS8 A;  5C8G A;  5CUD A;  4MEQ A;  4TZ8 A;  1WUG A;  4UIY A;  4YAT A;  4ALG A;  4IOQ A;  3LQI A;  4BHW A;  4QSV A;  5L8T A;  4LYI A;  4PKL A;  2R0V A;  5DX4 A;  5AD2 A;  2I8N A;  4MR6 A;  4O70 A;  5DKC A;  5FE1 A;  3S92 A;  2YYN A;  5FFY A;  3LJW A;  3O34 A;  1F68 A;  5HLS A;  5HQ6 A;  4NYX A;  4A9L A;  5FDZ A;  3SVH A;  4GPJ A;  4J3I A;  4NXJ A;  4NUD A;  5D3J A;  5I29 A;  4PS5 A;  2DAT A;  2E7N A;  4HXL A;  4LYW A;  5D3L A;  4MR3 A;  5DYA A;  2OO1 A;  4HXK A;  5ENB A;  5CTL A;  2R0Y A;  4CUT A;  4NQM A;  5HQ5 A;  3O36 A;  4NR5 A;  4UIU A;  5CUC A;  2YQD A;  1N72 A;  5IGL A;  5F25 A;  4UIZ A;  5D3R A;  5LKU A;  5FE4 A;  3P1F A;  4Z1S A;  4TQN A;  2YDW A;  4A9N A;  4QSX A;  4TZ2 A;  4IR4 A;  4HXN A;  1WUM A;  1JM4 B;  5BT3 A;  4PCE A;  5DKH A;  5EWW A;  5A5N A;  5FE7 A;  4QSR A;  5II2 A;  4PY6 A;  4A9O A;  3O37 A;  4NRB A;  4WHW A;  5LJ1 A;  5E74 A;  5ENG A;  5I1Q A;  5E9Y A;  5A81 A;  4XYA A;  5FBX A;  5A7C A;  3JVM A;  5FE3 A;  4N4I A;  5IGM A;  5LJ0 A;  3AAD A;  4QEV A;  5HJC A;  3MUK A;  4HBY A;  4QC3 A;  5CP5 A;  3JVL A;  4CL9 A;  5ENF A;  5EVA A;  5CFW A;  3QZV A;  4TU4 A;  1ZS5 A;  3I3J A;  2YEK A;  5C87 A;  5CQ5 A;  5EWV A;  4LDF A;  2OUO A;  4FLP A;  3MQM A;  4MEO A;  4UIX A;  2L84 A;  4UYD A;  5DKD A;  2WP2 A;  5CZG A;  5EWC A;  4CUR A;  4NR4 A;  5L99 A;  4O77 A;  5JWM A;  3SVG A;  4C66 A;  5FH7 A;  3O35 A;  5LKZ A;  5F1L A;  5HFQ A;  3U5M A;  4NR9 A;  5E9M A;  3UVD A;  4KV1 A;  5EI4 A;  5HFR A;  3U5P A;  4QR5 A;  5II1 A;  2L85 A;  5KU3 A;  3UVX A;  5H85 A;  4O7B A;  5ENJ A;  2DVV A;  5FE6 A;  5E7D A;  4F3I A;  4O72 A;  3IU6 A;  4KCX A;  4YYN A;  5E3D A;  5ENH A;  4O7F A;  5E3G A;  5IGK A;  5ENI A;  5A83 A;  5CU8 A;  4QNS A;  4A9I A;  5HRX A;  2I7K A;  4HXM A;  4ALH A;  4IR3 A;  4C67 A;  4YAB A;  5DY7 A;  5H1U A;  4OGJ A;  4XY9 A;  4YY6 A;  4CUP A;  4NYW A;  4QST A;  5A5S A;  4TYL A;  4Z93 A;  4UIT A;  4LYS A;  3TLP A;  4O74 A;  5CQ7 A;  2R10 A;  5I88 A;  4ZW1 A;  4DON A;  5D3T A;  5FG5 A;  3ZYU A;  4QB3 A;  5FG4 A;  5LKX A;  4YBT A;  5CQ8 A;  5HEL A;  4CUS A;  3S91 A;  4HXR A;  5DW1 A;  5ETB A;  1JSP B;  4YAD A;  4Y03 A;  4HXO A;  3HMF A;  4A9J A;  4HBW A;  4O78 A;  5IGN A;  4QZS A;  5I89 A;  4QYL A;  5CRM A;  4YYD A;  5L96 A;  4YY4 A;  2YW5 A;  4RVR A;  5JI8 A;  3UW9 A;  4TS8 A;  4E96 A;  5L8U A;  5LUU A;  5EM3 A;  3U5K A;  3D7C A;  5CUE A;  2DWW A;  4XUB A;  5FH6 A;  4QSW A;  4ZQL A;  4YAX A;  5CQA A;  5FE0 A;  4N3W A;  2L5E A;  3DWY A;  3AQA A;  5G4S A;  5EWH A;  5CQ3 A;  2KTB B;  3IU5 A;  4TT2 A;  4QEW A;  4QY4 A;  2RO1 A;  5KHM A;  4TTE A;  2DKW A;  3Q2F A;  5DFB A;  4A9F A;  4QBM A;  4TT6 A;  4IOO A;  5KTU A;  4YBM A;  4UYF B;  5FB1 A;  4BJX A;  5FE5 A;  3JVK A;  3MUL A;  4CLB A;  3DAI A;  5DLX A;  4NYV A;  4QSQ A;  4UYE A;  1EQF A;  3MB4 A;  3P1C A;  5L98 A;  5H1T A;  3Q2E A;  5D3S A;  3HMH A;  5A5O A;  2RI7 A;  4UIV A;  4UYG A;  4N4H A;  4Z6H A;  5TCM A;  5HM0 A;  5EWD A;  5CRZ A;  3QZT A;  3P5O A;  1X0J A;  4LZ2 A;  5E73 A;  5C7N A;  3UVW A;  5BT4 A;  5F36 A;  4UYF A;  2E7O A;  4N4F A;  4LR6 A;  3MXF A;  3U5L A;  4LC2 A;  4YYI A;  5C85 A;  3NXB A;  5EV9 A;  5DFC A;  4LRG A;  4WHU A;  3UV4 A;  5D0C A;  4PTB A;  5D7X A;  3P1E A;  3UV2 A;  4QSU A;  5ENE A;  3SVF A;  5HRV A;  4QSP A;  4QR3 A;  5D3H A;  4CUU A;  5D3N A;  4A9M A;  5F2P A;  5F60 A;  5K29 A;  3O33 A;  3MB3 A;  2OSS A;  5KO4 A;  5D24 A;  4Q0N A;  2YEM A;  4LZR A;  4MR5 A;  4IR6 A;  5EP7 A;  2G4A A;  4A9K A;  4Z1Q A;  4AKN A;  5KTX A;  2GRC A;  3G0L A;  4TT4 A;  5I7Y A;  2MJV B;  4A9H A;  4N4G A;  3UVY A;  5E9L A;  5ETD A;  5I40 A;  5HCL A;  4OUF A;  4NRA A;  3U5J A;  4YYM A;  5E9V A;  4X2I A;  5EPS A;  3K2J A;  2FSA A;  5LJ2 A;  5HQ7 A;  4BW4 A;  5TB6 A;  5D3P A;  3LXJ A;  5ENC A;  5AMF A;  5COI A;  4J0S A;  4XY8 A;  4ZC9 A;  5H1V A;  5LKT A;  5EQ1 A;  5FFV A;  4YYJ A;  5D25 A;  5I7X A;  4HBV A;  5F3A A;  2D9E A;  5I80 A;  5FH8 A;  3G0J A;  5IG6 A;  4YYH A;  3LQJ A;  4NR8 A;  5F63 A;  4J0R A;  5J0D A;  4QC1 A;  5EGU A;  1E6I A;  5EK9 A;  5A5Q A;  5FB0 A;  3RCW A;  4IR5 A;  5EIC A;  4KV4 A;  4YBS A;  5EU1 A;  4NS5 A;  5A85 A;  4XUA A;  4CFK A;  5BT5 A;  4O7E A;  4A9E A;  5HRW A;  5L97 A;  5EIS A;  3UV5 A;  5FFW A;  5CQ6 A;  4BW1 A;  3GG3 A;  5CQ4 A;  5AD3 A;  5ACY A;  4WIV A;  5HEM A;  3U5O A;  2D82 A;  5FG6 A;  3JVJ A;  5DYX A;  5CQT A;  2RNX A;  5EPR A;  4O7A A;  5EA1 A;  4O76 A;  5CUG A;  5DW2 A;  5LVR A;  4O7C A;  4YH4 A;  5DLZ A;  2RNY A;  2R0S A;  5CUB A;  4YYG A;  5CPE A;  5F61 A;  5G4R A;  5A82 A;  2RS9 B;  3P1D A;  5DYU A;  5F1H A;  3QZS A;  2WP1 A;  4O71 A;  2LSP B;  4LZS A;  4UIW A;  4PCI A;  5E0R A;  4IOR A;  3FKM X;  4QUT A;  5E9K A;  4YC9 A;  4YYK A;  4UYH A;  2DVQ A;  4NQN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...