5KO4A

Bromodomain from trypanosoma brucei tb427.10.8150
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
101
structure length
101
Chain Sequence
TSFYKQCRSILHVVMDLDRDGIFARDPSKLPDYRMIISHPMWWDLIKARLTRYEYTSPSAFINDMRLVVQNCYDYNREESPFSTLARRIEIAMEDLFVTEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Putative uncharacterized protein
publication title Bromodomain from Trypanosoma brucei Tb427.10.8150
rcsb
source organism Trypanosoma brucei brucei (strain 927/4 gutat10.1)
total genus 41
structure length 101
sequence length 101
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5ko4A00
5IGNA 5KTUA 5HLSA 5CUDA 4QB3A 4QYDA 4YH3A 4UYFA 5BT3A 5H85A 4A9MA 5EPBA 1N72A 5AMEA 4TZ2A 1EQFA 4IORA 4YBTA 2I8NA 4YYGA 4QNSA 4TQNA 5L98A 5CQ5A 4QC3A 4LZRA 2RO1A 4N3WA 4N4FA 5EM3A 4E96A 5I40A 3O34A 3UVWA 3HMFA 2L5EA 4XY8A 5DKDA 5ENGA 4PKLA 4QZSA 4MR5A 4UITA 4NQNA 4TU4A 3D7CA 5TCMA 5CU8A 2F6JA 5HRXA 4CUUA 5HJCA 4GPJA 4J0SA 4LZ2A 5EISA 5H1TA 5FE7A 4LYIA 4QY4A 4O7BA 5IG6A 4QEVA 4YYNA 5AD2A 4MEQA 3ZYUA 3HMEA 5AD3A 5C8GA 4Q0NA 3MXFA 3O35A 4NYXA 4ALGA 2LSPB 5L99A 2WP1A 4A9OA 3S92A 5KU3A 4YYJA 5LKUA 2RNWA 4KV4A 5CRMA 4IR5A 5F1LA 4CLBA 4O7EA 5HEMA 2R10A 2L85A 4LZSA 4TT6A 5TB6A 4YBMA 3G0JA 5FE3A 5DKCA 4QSXA 4O75A 4UYFB 4DONA 4LRGA 5FFYA 3P1EA 4CUTA 5EWDA 3P1FA 5HFQA 4YYIA 4HXPA 1WUGA 4TZ8A 4YY4A 4QSRA 5E3GA 3LQJA 5ENHA 4ALHA 2YDWA 4YK0A 5D3HA 5DFDA 4X2IA 4YYDA 4WIVA 3G0LA 5FB1A 3P1DA 5C4QA 5LJ1A 5IGMA 5CQ6A 3O36A 5DFCA 2YEMA 5F25A 5HELA 3QZTA 4YY6A 5A82A 5F3AA 5L8TA 5EPSA 5CP5A 4J3IA 5EWVA 5DW1A 3U5MA 1F68A 4OGJA 4LDFA 4WHUA 5J0DA 2NXBA 5COIA 3LQHA 5IBNA 2MJVB 2GRCA 4O7FA 5LKZA 3QZSA 4Z1QA 4RVRA 3U5LA 4F3IA 3AQAA 5ACYA 5DYCA 5CTLA 5EV9A 5FH7A 4NRBA 5ENCA 4A9KA 5G4SA 4ZC9A 4Z1SA 4Z6HA 5E9YA 3SVFA 4UIXA 4YYHA 5C85A 3UVYA 4ZQLA 5ENIA 4Y03A 4HXLA 5F5ZA 5FG6A 3MQMA 5CRZA 4MEOA 2OUOA 4TU6A 5A5RA 4UIVA 4IR4A 5ETDA 4HXRA 4QSTA 1X0JA 3O33A 5HRWA 4QSPA 5DX4A 4BW2A 4TS8A 4J1PA 4O7CA 5FE8A 5DW2A 3U5KA 4Q0OA 4YATA 4CURA 4YADA 2DVVA 5F2PA 4PCIA 2E3KA 5CQAA 2DWWA 4YH4A 2RNYA 4HBXA 3MB3A 4NRAA 5F63A 2N9GA 2E7OA 3DWYA 5JI8A 5IGLA 4XYAA 4MENA 4NR8A 5EVAA 1JM4B 5BT5A 4NUCA 2R0SA 5CZGA 2E7NA 4TT4A 5FE4A 5LUUA 4IR3A 4KCXA 5E0RA 5D26A 5I80A 5D3NA 4A9HA 5FH8A 4HBWA 5FE9A 4AKNA 4XY9A 5D25A 3UW9A 5L96A 2RNXA 4O77A 5FE0A 4NR5A 5F1HA 4A9LA 5HM0A 4TTEA 5D3PA 4QEWA 3SVHA 4PY6A 5DBMA 4LYWA 5ETBA 5EWCA 4BW1A 2OSSA 4IOOA 5A5PA 4TT2A 5I29A 5A83A 3MB4A 4QSVA 3JVJA 5HFRA 5EWWA 5FE2A 5EICA 4NR7A 4QSUA 4WHWA 5ENEA 4UIZA 4HXKA 5A85A 3AADA 5FBXA 5FG5A 5I1QA 4QSWA 4UIUA 5HRVA 5CGPA 5I7XA 5F36A 5EP7A 1E6IA 5ENFA 3UVDA 3FKMX 5D3SA 3UVXA 3JVLA 4NYWA 5FE1A 5I7YA 5D7XA 5II2A 4QSSA 5A7CA 4QUUA 5IGKA 4LR6A 4NRCA 4OUFA 4PCEA 5LVQA 4NR4A 5DYAA 5IIDA 5DY7A 5LJ2A 5FFVA 4CFLA 5FH6A 4YC9A 5E73A 5KTWA 4A9EA 4BW3A 5I89A 5CUGA 5D3JA 3JVKA 5CQ8A 4UIWA 5H1VA 5LVRA 5EWHA 4QR3A 5CPEA 5E3DA 2DKWA 1WUMA 4CUQA 4HBVA 4UYHA 4C67A 5A5SA 5HCLA 4QEUA 4BHWA 5C7NA 5KO4A 3JVMA 4HXOA 4NS5A 5FE5A 4NR6A 3TLPA 3LQIA 3UV5A 5EI4A 5CUBA 4BJXA 5CUEA 4CFKA 4Z6IA 1ZS5A 3MULA 4NQMA 4QR5A 3DAIA 2KTBB 5EQ1A 4YBSA 5H1UA 4XUAA 5FB0A 5CQ3A 5EGUA 4LC2A 2H60A 5HENA 4YYMA 4UIYA 3P1CA 4ZW1A 5LJ0A 5FE6A 4N4GA 3IU5A 4NR9A 5CQ7A 2G4AA 2YQDA 4HXMA 4TYLA 4NUEA 4NUDA 5A5QA 5DKHA 2DVRA 5K29A 2DVSA 5E9VA 4XUBA 4NYVA 5D3TA 3Q2FA 5D3LA 5F62A 2R0VA 4IR6A 3HMHA 4O70A 4O72A 4QC1A 4A9JA 5EK9A 2RI7A 3K2JA 4LYSA 5F60A 1JSPB 5LKXA 5ENJA 4A9FA 2I7KA 5DLZA 5II1A 4PS5A 4UYEA 4N4HA 5I88A 5G4RA 4YABA 2DATA 5CQTA 4KV1A 5A5OA 2DVQA 4CUPA 4YYKA 2FSAA 4IOQA 5D0CA 3U5PA 5CQ4A 3NXBA 3P5OA 4NXJA 5EU1A 2RS9B 5FDZA 5FG4A 4A9IA 4A9NA 4HBYA 2YW5A 5I86A 2OO1A 5EA1A 5A5NA 5C87A 4CL9A 5HQ6A 5D3RA 5L97A 4UYDA 4J0RA 5KTXA 5JWMA 5ENBA 3ONIA 4UYGA 4QSQA 2YYNA 3U5JA 4MR4A 4YAXA 3UV2A 4O74A 5E9MA 2YEKA 5LKTA 5CUCA 4O71A 4Z93A 3SVGA 5F61A 3I3JA 5D24A 5DLXA 5I83A 5EPRA 5DFBA 5CY9A 3GG3A 5E9IA 3O37A 2WP2A 5DYXA 3U5NA 4HXNA 5A81A 2D9EA 5C89A 5E9KA 3S91A 4O7AA 3UV4A 4C66A 4MR6A 4N4IA 3MUKA 3QZVA 5HQ7A 4QBMA 5E74A 4PTBA 4HXSA 5E9LA 3U5OA 4QYLA 5DYUA 4FLPA 4BW4A 5E7DA 3RCWA 4O76A 2YELA 5L8UA 4QUTA 2L84A 5CFWA 5HQ5A 5AMFA 5BT4A 4MEPA 3IU6A 4O78A 3LJWA 4OGIA 5CUAA 2R0YA 5KHMA 2D82A 2RFJA 3LXJA 2F6NA 4MR3A 3Q2EA 5CS8A 4CUSA 4QR4A 5FFWA
chains in the Genus database with same CATH superfamily
5IGNA 5KTUA 5HLSA 5CUDA 4QB3A 4QYDA 4YH3A 4UYFA 5BT3A 5H85A 4A9MA 5EPBA 1N72A 5AMEA 4TZ2A 1EQFA 4IORA 4YBTA 2I8NA 4YYGA 4QNSA 4TQNA 5L98A 5CQ5A 4QC3A 4LZRA 2RO1A 4N3WA 4N4FA 5EM3A 4E96A 5I40A 3O34A 3UVWA 3HMFA 2L5EA 4XY8A 5DKDA 5ENGA 4PKLA 4QZSA 4MR5A 4UITA 4NQNA 4TU4A 3D7CA 5TCMA 5CU8A 2F6JA 5HRXA 4CUUA 5HJCA 4GPJA 4J0SA 4LZ2A 5EISA 5H1TA 5FE7A 4LYIA 4QY4A 4O7BA 5IG6A 4QEVA 4YYNA 5AD2A 4MEQA 3ZYUA 3HMEA 5AD3A 5C8GA 4Q0NA 3MXFA 3O35A 4NYXA 4ALGA 2LSPB 5L99A 4AI6A 2WP1A 4A9OA 3S92A 5KU3A 4YYJA 5LKUA 2RNWA 4KV4A 5CRMA 4IR5A 5F1LA 4CLBA 4O7EA 5HEMA 2R10A 2L85A 4LZSA 4TT6A 5TB6A 4YBMA 3G0JA 5FE3A 5DKCA 4QSXA 4O75A 4UYFB 4DONA 4LRGA 5FFYA 3P1EA 4CUTA 5EWDA 3P1FA 5HFQA 4YYIA 4HXPA 1WUGA 4TZ8A 4YY4A 4QSRA 5E3GA 3LQJA 5ENHA 4ALHA 2YDWA 4YK0A 5D3HA 5DFDA 4X2IA 4YYDA 4WIVA 3G0LA 5FB1A 3P1DA 5C4QA 5LJ1A 5IGMA 5CQ6A 3O36A 5DFCA 2YEMA 5F25A 5HELA 3QZTA 4YY6A 5A82A 5F3AA 5L8TA 5EPSA 5CP5A 4J3IA 4AKHA 5EWVA 5DW1A 3U5MA 1F68A 4OGJA 4LDFA 4WHUA 5J0DA 2NXBA 5COIA 3LQHA 5IBNA 2MJVB 2GRCA 4O7FA 5LKZA 3QZSA 4Z1QA 4RVRA 3U5LA 4F3IA 3AQAA 5ACYA 5DYCA 5CTLA 5EV9A 5FH7A 4NRBA 5ENCA 4A9KA 5G4SA 4ZC9A 4Z1SA 4Z6HA 5E9YA 3SVFA 4UIXA 4YYHA 5C85A 3UVYA 4ZQLA 5ENIA 4Y03A 4HXLA 5F5ZA 5FG6A 3MQMA 5CRZA 1PUOA 4MEOA 2OUOA 4TU6A 5A5RA 4UIVA 4IR4A 5ETDA 4HXRA 4QSTA 1X0JA 3O33A 5HRWA 4QSPA 5DX4A 4BW2A 4TS8A 4J1PA 4O7CA 5FE8A 5DW2A 3U5KA 3VKHA 4Q0OA 4YATA 4CURA 4YADA 2DVVA 5F2PA 4PCIA 2E3KA 5CQAA 2DWWA 4YH4A 2RNYA 4HBXA 3MB3A 4NRAA 5F63A 2N9GA 2E7OA 3DWYA 5JI8A 5IGLA 4XYAA 4MENA 4NR8A 5EVAA 1JM4B 5BT5A 4NUCA 2R0SA 5CZGA 2EJNA 2E7NA 4TT4A 5FE4A 5LUUA 4IR3A 4KCXA 5E0RA 5D26A 5I80A 5D3NA 4A9HA 5FH8A 4HBWA 5FE9A 4AKNA 4XY9A 5D25A 3UW9A 5L96A 2RNXA 4O77A 5FE0A 4NR5A 5F1HA 4A9LA 5HM0A 4TTEA 5D3PA 4QEWA 3SVHA 4PY6A 5DBMA 4LYWA 5ETBA 5EWCA 4BW1A 2OSSA 4IOOA 5A5PA 4TT2A 5I29A 5A83A 3MB4A 4QSVA 3JVJA 5HFRA 5EWWA 5FE2A 5EICA 4NR7A 4QSUA 4WHWA 5ENEA 3D1BA 4UIZA 4HXKA 5A85A 1ZKRA 3AADA 5FBXA 5FG5A 5I1QA 4QSWA 4UIUA 4AKGA 5HRVA 5CGPA 5I7XA 5F36A 5EP7A 1E6IA 5ENFA 3UVDA 3FKMX 5D3SA 3UVXA 3JVLA 4NYWA 5FE1A 5I7YA 5D7XA 5II2A 4QSSA 5A7CA 4QUUA 5IGKA 4LR6A 4NRCA 4OUFA 4PCEA 5LVQA 4NR4A 5DYAA 5IIDA 5DY7A 5LJ2A 5FFVA 4CFLA 5FH6A 4YC9A 5E73A 5KTWA 4A9EA 4BW3A 5I89A 5CUGA 5D3JA 3JVKA 5CQ8A 4UIWA 5H1VA 5LVRA 5EWHA 4QR3A 5CPEA 5E3DA 2DKWA 1WUMA 4CUQA 4HBVA 4UYHA 4C67A 5A5SA 5HCLA 3D1DA 4QEUA 4BHWA 5C7NA 5KO4A 3JVMA 4HXOA 4NS5A 5FE5A 4NR6A 3TLPA 3LQIA 3UV5A 5EI4A 5CUBA 4BJXA 5CUEA 4CFKA 4Z6IA 1ZS5A 3MULA 4NQMA 4QR5A 3DAIA 2KTBB 5EQ1A 4YBSA 5H1UA 4XUAA 5FB0A 5CQ3A 5EGUA 4LC2A 2H60A 5HENA 4YYMA 4UIYA 3P1CA 4ZW1A 5LJ0A 5FE6A 4N4GA 3VKGA 3IU5A 4NR9A 5CQ7A 2G4AA 2YQDA 4HXMA 4TYLA 4NUEA 4NUDA 5A5QA 5DKHA 2DVRA 5K29A 2DVSA 5E9VA 4XUBA 4NYVA 5D3TA 3Q2FA 5D3LA 5F62A 2R0VA 4IR6A 3HMHA 4O70A 4O72A 4QC1A 4A9JA 5EK9A 2RI7A 3K2JA 4LYSA 5F60A 1JSPB 5LKXA 5ENJA 4A9FA 2I7KA 5DLZA 5II1A 4PS5A 4UYEA 4N4HA 5I88A 5G4RA 4YABA 2DATA 5CQTA 4KV1A 5A5OA 2DVQA 4CUPA 4YYKA 2FSAA 4IOQA 5D0CA 3U5PA 5CQ4A 3NXBA 3P5OA 4NXJA 5EU1A 2RS9B 5FDZA 5FG4A 4A9IA 4A9NA 4HBYA 2YW5A 5I86A 2OO1A 5EA1A 5A5NA 5C87A 4CL9A 5HQ6A 5D3RA 5L97A 4UYDA 4J0RA 5KTXA 5JWMA 5ENBA 3ONIA 4UYGA 4QSQA 2YYNA 3U5JA 4MR4A 4YAXA 3UV2A 4O74A 5E9MA 2YEKA 5LKTA 5CUCA 4O71A 4Z93A 3SVGA 5F61A 3I3JA 5D24A 4AKIA 5DLXA 5I83A 5EPRA 5DFBA 5CY9A 3GG3A 5E9IA 3O37A 2WP2A 5DYXA 3U5NA 4HXNA 5A81A 2D9EA 5C89A 5E9KA 3S91A 4O7AA 3UV4A 4C66A 4MR6A 4N4IA 3ERRA 3MUKA 3QZVA 5HQ7A 4QBMA 5E74A 4PTBA 4HXSA 5E9LA 3U5OA 4QYLA 5DYUA 4FLPA 4BW4A 5E7DA 3RCWA 4O76A 2YELA 5L8UA 4QUTA 2L84A 5CFWA 5HQ5A 5AMFA 5BT4A 4MEPA 3IU6A 4O78A 3LJWA 4OGIA 5CUAA 2R0YA 5KHMA 2D82A 2RFJA 3LXJA 2F6NA 4MR3A 3Q2EA 5CS8A 4CUSA 4QR4A 5FFWA
chains in the Genus database with same CATH topology
5IGNA 5KTUA 5HLSA 5CUDA 4QB3A 4QYDA 4YH3A 4UYFA 5BT3A 5H85A 4A9MA 5EPBA 1N72A 5AMEA 4TZ2A 1EQFA 4IORA 4YBTA 2I8NA 4YYGA 4QNSA 4TQNA 5L98A 5CQ5A 4QC3A 4LZRA 2RO1A 4N3WA 4N4FA 5EM3A 4E96A 5I40A 3O34A 3UVWA 3HMFA 2L5EA 4XY8A 5DKDA 5ENGA 4PKLA 4QZSA 4MR5A 4UITA 4NQNA 4TU4A 3D7CA 5TCMA 5CU8A 2F6JA 5HRXA 4CUUA 5HJCA 4GPJA 4J0SA 4LZ2A 5EISA 5H1TA 5FE7A 4LYIA 4QY4A 4O7BA 5IG6A 4QEVA 4YYNA 5AD2A 4MEQA 3ZYUA 3HMEA 5AD3A 5C8GA 4Q0NA 3MXFA 3O35A 4NYXA 4ALGA 2LSPB 5L99A 2WP1A 4A9OA 3S92A 5KU3A 4YYJA 5LKUA 2RNWA 4KV4A 5CRMA 4IR5A 5F1LA 4CLBA 4O7EA 5HEMA 2R10A 2L85A 4LZSA 4TT6A 5TB6A 4YBMA 3G0JA 5FE3A 5DKCA 4QSXA 4O75A 4UYFB 4DONA 4LRGA 5FFYA 3P1EA 4CUTA 5EWDA 3P1FA 5HFQA 4YYIA 4HXPA 1WUGA 4TZ8A 4YY4A 4QSRA 5E3GA 3LQJA 5ENHA 4ALHA 2YDWA 4YK0A 5D3HA 5DFDA 4X2IA 4YYDA 4WIVA 3G0LA 5FB1A 3P1DA 5C4QA 5LJ1A 5IGMA 5CQ6A 3O36A 5DFCA 2YEMA 5F25A 5HELA 3QZTA 4YY6A 5A82A 5F3AA 5L8TA 5EPSA 5CP5A 4J3IA 5EWVA 5DW1A 3U5MA 1F68A 4OGJA 4LDFA 4WHUA 5J0DA 2NXBA 5COIA 3LQHA 5IBNA 2MJVB 2GRCA 4O7FA 5LKZA 3QZSA 4Z1QA 4RVRA 3U5LA 4F3IA 3AQAA 5ACYA 5DYCA 5CTLA 5EV9A 5FH7A 4NRBA 5ENCA 4A9KA 5G4SA 4ZC9A 4Z1SA 4Z6HA 5E9YA 3SVFA 4UIXA 4YYHA 5C85A 3UVYA 4ZQLA 5ENIA 4Y03A 4HXLA 5F5ZA 5FG6A 3MQMA 5CRZA 4MEOA 2OUOA 4TU6A 5A5RA 4UIVA 4IR4A 5ETDA 4HXRA 4QSTA 1X0JA 3O33A 5HRWA 4QSPA 5DX4A 4BW2A 4TS8A 4J1PA 4O7CA 5FE8A 5DW2A 3U5KA 4Q0OA 4YATA 4CURA 4YADA 2DVVA 5F2PA 4PCIA 2E3KA 5CQAA 2DWWA 4YH4A 2RNYA 4HBXA 3MB3A 4NRAA 5F63A 2N9GA 2E7OA 3DWYA 5JI8A 5IGLA 4XYAA 4MENA 4NR8A 5EVAA 1JM4B 5BT5A 4NUCA 2R0SA 5CZGA 2E7NA 4TT4A 5FE4A 5LUUA 4IR3A 4KCXA 5E0RA 5D26A 5I80A 5D3NA 4A9HA 5FH8A 4HBWA 5FE9A 4AKNA 4XY9A 5D25A 3UW9A 5L96A 2RNXA 4O77A 5FE0A 4NR5A 5F1HA 4A9LA 5HM0A 4TTEA 5D3PA 4QEWA 3SVHA 4PY6A 5DBMA 4LYWA 5ETBA 5EWCA 4BW1A 2OSSA 4IOOA 5A5PA 4TT2A 5I29A 5A83A 3MB4A 4QSVA 3JVJA 5HFRA 5EWWA 5FE2A 5EICA 4NR7A 4QSUA 4WHWA 5ENEA 4UIZA 4HXKA 5A85A 3AADA 5FBXA 5FG5A 5I1QA 4QSWA 4UIUA 5HRVA 5CGPA 5I7XA 5F36A 5EP7A 1E6IA 5ENFA 3UVDA 3FKMX 5D3SA 3UVXA 3JVLA 4NYWA 5FE1A 5I7YA 5D7XA 5II2A 4QSSA 5A7CA 4QUUA 5IGKA 4LR6A 4NRCA 4OUFA 4PCEA 5LVQA 4NR4A 5DYAA 5IIDA 5DY7A 5LJ2A 5FFVA 4CFLA 5FH6A 4YC9A 5E73A 5KTWA 4A9EA 4BW3A 5I89A 5CUGA 5D3JA 3JVKA 5CQ8A 4UIWA 5H1VA 5LVRA 5EWHA 4QR3A 5CPEA 5E3DA 2DKWA 1WUMA 4CUQA 4HBVA 4UYHA 4C67A 5A5SA 5HCLA 4QEUA 4BHWA 5C7NA 5KO4A 3JVMA 4HXOA 4NS5A 5FE5A 4NR6A 3TLPA 3LQIA 3UV5A 5EI4A 5CUBA 4BJXA 5CUEA 4CFKA 4Z6IA 1ZS5A 3MULA 4NQMA 4QR5A 3DAIA 2KTBB 5EQ1A 4YBSA 5H1UA 4XUAA 5FB0A 5CQ3A 5EGUA 4LC2A 2H60A 5HENA 4YYMA 4UIYA 3P1CA 4ZW1A 5LJ0A 5FE6A 4N4GA 3IU5A 4NR9A 5CQ7A 2G4AA 2YQDA 4HXMA 4TYLA 4NUEA 4NUDA 5A5QA 5DKHA 2DVRA 5K29A 2DVSA 5E9VA 4XUBA 4NYVA 5D3TA 3Q2FA 5D3LA 5F62A 2R0VA 4IR6A 3HMHA 4O70A 4O72A 4QC1A 4A9JA 5EK9A 2RI7A 3K2JA 4LYSA 5F60A 1JSPB 5LKXA 5ENJA 4A9FA 2I7KA 5DLZA 5II1A 4PS5A 4UYEA 4N4HA 5I88A 5G4RA 4YABA 2DATA 5CQTA 4KV1A 5A5OA 2DVQA 4CUPA 4YYKA 2FSAA 4IOQA 5D0CA 3U5PA 5CQ4A 3NXBA 3P5OA 4NXJA 5EU1A 2RS9B 5FDZA 5FG4A 4A9IA 4A9NA 4HBYA 2YW5A 5I86A 2OO1A 5EA1A 5A5NA 5C87A 4CL9A 5HQ6A 5D3RA 5L97A 4UYDA 4J0RA 5KTXA 5JWMA 5ENBA 3ONIA 4UYGA 4QSQA 2YYNA 3U5JA 4MR4A 4YAXA 3UV2A 4O74A 5E9MA 2YEKA 5LKTA 5CUCA 4O71A 4Z93A 3SVGA 5F61A 3I3JA 5D24A 5DLXA 5I83A 5EPRA 5DFBA 5CY9A 3GG3A 5E9IA 3O37A 2WP2A 5DYXA 3U5NA 4HXNA 5A81A 2D9EA 5C89A 5E9KA 3S91A 4O7AA 3UV4A 4C66A 4MR6A 4N4IA 3MUKA 3QZVA 5HQ7A 4QBMA 5E74A 4PTBA 4HXSA 5E9LA 3U5OA 4QYLA 5DYUA 4FLPA 4BW4A 5E7DA 3RCWA 4O76A 2YELA 5L8UA 4QUTA 2L84A 5CFWA 5HQ5A 5AMFA 5BT4A 4MEPA 3IU6A 4O78A 3LJWA 4OGIA 5CUAA 2R0YA 5KHMA 2D82A 2RFJA 3LXJA 2F6NA 4MR3A 3Q2EA 5CS8A 4CUSA 4QR4A 5FFWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IGN A;  5KTU A;  5HLS A;  5CUD A;  4QB3 A;  4QYD A;  4YH3 A;  4UYF A;  5BT3 A;  5H85 A;  4A9M A;  5EPB A;  1N72 A;  5AME A;  4TZ2 A;  1EQF A;  4IOR A;  4YBT A;  2I8N A;  4YYG A;  4QNS A;  4TQN A;  5L98 A;  5CQ5 A;  4QC3 A;  4LZR A;  2RO1 A;  4N3W A;  4N4F A;  5EM3 A;  4E96 A;  5I40 A;  3O34 A;  3UVW A;  3HMF A;  2L5E A;  4XY8 A;  5DKD A;  5ENG A;  4PKL A;  4QZS A;  4MR5 A;  4UIT A;  4NQN A;  4TU4 A;  3D7C A;  5TCM A;  5CU8 A;  2F6J A;  5HRX A;  4CUU A;  5HJC A;  4GPJ A;  4J0S A;  4LZ2 A;  5EIS A;  5H1T A;  5FE7 A;  4LYI A;  4QY4 A;  4O7B A;  5IG6 A;  4QEV A;  4YYN A;  5AD2 A;  4MEQ A;  3ZYU A;  3HME A;  5AD3 A;  5C8G A;  4Q0N A;  3MXF A;  3O35 A;  4NYX A;  4ALG A;  2LSP B;  5L99 A;  2WP1 A;  4A9O A;  3S92 A;  5KU3 A;  4YYJ A;  5LKU A;  2RNW A;  4KV4 A;  5CRM A;  4IR5 A;  5F1L A;  4CLB A;  4O7E A;  5HEM A;  2R10 A;  2L85 A;  4LZS A;  4TT6 A;  5TB6 A;  4YBM A;  3G0J A;  5FE3 A;  5DKC A;  4QSX A;  4O75 A;  4UYF B;  4DON A;  4LRG A;  5FFY A;  3P1E A;  4CUT A;  5EWD A;  3P1F A;  5HFQ A;  4YYI A;  4HXP A;  1WUG A;  4TZ8 A;  4YY4 A;  4QSR A;  5E3G A;  3LQJ A;  5ENH A;  4ALH A;  2YDW A;  4YK0 A;  5D3H A;  5DFD A;  4X2I A;  4YYD A;  4WIV A;  3G0L A;  5FB1 A;  3P1D A;  5C4Q A;  5LJ1 A;  5IGM A;  5CQ6 A;  3O36 A;  5DFC A;  2YEM A;  5F25 A;  5HEL A;  3QZT A;  4YY6 A;  5A82 A;  5F3A A;  5L8T A;  5EPS A;  5CP5 A;  4J3I A;  5EWV A;  5DW1 A;  3U5M A;  1F68 A;  4OGJ A;  4LDF A;  4WHU A;  5J0D A;  2NXB A;  5COI A;  3LQH A;  5IBN A;  2MJV B;  2GRC A;  4O7F A;  5LKZ A;  3QZS A;  4Z1Q A;  4RVR A;  3U5L A;  4F3I A;  3AQA A;  5ACY A;  5DYC A;  5CTL A;  5EV9 A;  5FH7 A;  4NRB A;  5ENC A;  4A9K A;  5G4S A;  4ZC9 A;  4Z1S A;  4Z6H A;  5E9Y A;  3SVF A;  4UIX A;  4YYH A;  5C85 A;  3UVY A;  4ZQL A;  5ENI A;  4Y03 A;  4HXL A;  5F5Z A;  5FG6 A;  3MQM A;  5CRZ A;  4MEO A;  2OUO A;  4TU6 A;  5A5R A;  4UIV A;  4IR4 A;  5ETD A;  4HXR A;  4QST A;  1X0J A;  3O33 A;  5HRW A;  4QSP A;  5DX4 A;  4BW2 A;  4TS8 A;  4J1P A;  4O7C A;  5FE8 A;  5DW2 A;  3U5K A;  4Q0O A;  4YAT A;  4CUR A;  4YAD A;  2DVV A;  5F2P A;  4PCI A;  2E3K A;  5CQA A;  2DWW A;  4YH4 A;  2RNY A;  4HBX A;  3MB3 A;  4NRA A;  5F63 A;  2N9G A;  2E7O A;  3DWY A;  5JI8 A;  5IGL A;  4XYA A;  4MEN A;  4NR8 A;  5EVA A;  1JM4 B;  5BT5 A;  4NUC A;  2R0S A;  5CZG A;  2E7N A;  4TT4 A;  5FE4 A;  5LUU A;  4IR3 A;  4KCX A;  5E0R A;  5D26 A;  5I80 A;  5D3N A;  4A9H A;  5FH8 A;  4HBW A;  5FE9 A;  4AKN A;  4XY9 A;  5D25 A;  3UW9 A;  5L96 A;  2RNX A;  4O77 A;  5FE0 A;  4NR5 A;  5F1H A;  4A9L A;  5HM0 A;  4TTE A;  5D3P A;  4QEW A;  3SVH A;  4PY6 A;  5DBM A;  4LYW A;  5ETB A;  5EWC A;  4BW1 A;  2OSS A;  4IOO A;  5A5P A;  4TT2 A;  5I29 A;  5A83 A;  3MB4 A;  4QSV A;  3JVJ A;  5HFR A;  5EWW A;  5FE2 A;  5EIC A;  4NR7 A;  4QSU A;  4WHW A;  5ENE A;  4UIZ A;  4HXK A;  5A85 A;  3AAD A;  5FBX A;  5FG5 A;  5I1Q A;  4QSW A;  4UIU A;  5HRV A;  5CGP A;  5I7X A;  5F36 A;  5EP7 A;  1E6I A;  5ENF A;  3UVD A;  3FKM X;  5D3S A;  3UVX A;  3JVL A;  4NYW A;  5FE1 A;  5I7Y A;  5D7X A;  5II2 A;  4QSS A;  5A7C A;  4QUU A;  5IGK A;  4LR6 A;  4NRC A;  4OUF A;  4PCE A;  5LVQ A;  4NR4 A;  5DYA A;  5IID A;  5DY7 A;  5LJ2 A;  5FFV A;  4CFL A;  5FH6 A;  4YC9 A;  5E73 A;  5KTW A;  4A9E A;  4BW3 A;  5I89 A;  5CUG A;  5D3J A;  3JVK A;  5CQ8 A;  4UIW A;  5H1V A;  5LVR A;  5EWH A;  4QR3 A;  5CPE A;  5E3D A;  2DKW A;  1WUM A;  4CUQ A;  4HBV A;  4UYH A;  4C67 A;  5A5S A;  5HCL A;  4QEU A;  4BHW A;  5C7N A;  5KO4 A;  3JVM A;  4HXO A;  4NS5 A;  5FE5 A;  4NR6 A;  3TLP A;  3LQI A;  3UV5 A;  5EI4 A;  5CUB A;  4BJX A;  5CUE A;  4CFK A;  4Z6I A;  1ZS5 A;  3MUL A;  4NQM A;  4QR5 A;  3DAI A;  2KTB B;  5EQ1 A;  4YBS A;  5H1U A;  4XUA A;  5FB0 A;  5CQ3 A;  5EGU A;  4LC2 A;  2H60 A;  5HEN A;  4YYM A;  4UIY A;  3P1C A;  4ZW1 A;  5LJ0 A;  5FE6 A;  4N4G A;  3IU5 A;  4NR9 A;  5CQ7 A;  2G4A A;  2YQD A;  4HXM A;  4TYL A;  4NUE A;  4NUD A;  5A5Q A;  5DKH A;  2DVR A;  5K29 A;  2DVS A;  5E9V A;  4XUB A;  4NYV A;  5D3T A;  3Q2F A;  5D3L A;  5F62 A;  2R0V A;  4IR6 A;  3HMH A;  4O70 A;  4O72 A;  4QC1 A;  4A9J A;  5EK9 A;  2RI7 A;  3K2J A;  4LYS A;  5F60 A;  1JSP B;  5LKX A;  5ENJ A;  4A9F A;  2I7K A;  5DLZ A;  5II1 A;  4PS5 A;  4UYE A;  4N4H A;  5I88 A;  5G4R A;  4YAB A;  2DAT A;  5CQT A;  4KV1 A;  5A5O A;  2DVQ A;  4CUP A;  4YYK A;  2FSA A;  4IOQ A;  5D0C A;  3U5P A;  5CQ4 A;  3NXB A;  3P5O A;  4NXJ A;  5EU1 A;  2RS9 B;  5FDZ A;  5FG4 A;  4A9I A;  4A9N A;  4HBY A;  2YW5 A;  5I86 A;  2OO1 A;  5EA1 A;  5A5N A;  5C87 A;  4CL9 A;  5HQ6 A;  5D3R A;  5L97 A;  4UYD A;  4J0R A;  5KTX A;  5JWM A;  5ENB A;  3ONI A;  4UYG A;  4QSQ A;  2YYN A;  3U5J A;  4MR4 A;  4YAX A;  3UV2 A;  4O74 A;  5E9M A;  2YEK A;  5LKT A;  5CUC A;  4O71 A;  4Z93 A;  3SVG A;  5F61 A;  3I3J A;  5D24 A;  5DLX A;  5I83 A;  5EPR A;  5DFB A;  5CY9 A;  3GG3 A;  5E9I A;  3O37 A;  2WP2 A;  5DYX A;  3U5N A;  4HXN A;  5A81 A;  2D9E A;  5C89 A;  5E9K A;  3S91 A;  4O7A A;  3UV4 A;  4C66 A;  4MR6 A;  4N4I A;  3MUK A;  3QZV A;  5HQ7 A;  4QBM A;  5E74 A;  4PTB A;  4HXS A;  5E9L A;  3U5O A;  4QYL A;  5DYU A;  4FLP A;  4BW4 A;  5E7D A;  3RCW A;  4O76 A;  2YEL A;  5L8U A;  4QUT A;  2L84 A;  5CFW A;  5HQ5 A;  5AMF A;  5BT4 A;  4MEP A;  3IU6 A;  4O78 A;  3LJW A;  4OGI A;  5CUA A;  2R0Y A;  5KHM A;  2D82 A;  2RFJ A;  3LXJ A;  2F6N A;  4MR3 A;  3Q2E A;  5CS8 A;  4CUS A;  4QR4 A;  5FFW A; 
#chains in the Genus database with same CATH topology
 5IGN A;  5KTU A;  5HLS A;  5CUD A;  4QB3 A;  4QYD A;  4YH3 A;  4UYF A;  5BT3 A;  5H85 A;  4A9M A;  5EPB A;  1N72 A;  5AME A;  4TZ2 A;  1EQF A;  4IOR A;  4YBT A;  2I8N A;  4YYG A;  4QNS A;  4TQN A;  5L98 A;  5CQ5 A;  4QC3 A;  4LZR A;  2RO1 A;  4N3W A;  4N4F A;  5EM3 A;  4E96 A;  5I40 A;  3O34 A;  3UVW A;  3HMF A;  2L5E A;  4XY8 A;  5DKD A;  5ENG A;  4PKL A;  4QZS A;  4MR5 A;  4UIT A;  4NQN A;  4TU4 A;  3D7C A;  5TCM A;  5CU8 A;  2F6J A;  5HRX A;  4CUU A;  5HJC A;  4GPJ A;  4J0S A;  4LZ2 A;  5EIS A;  5H1T A;  5FE7 A;  4LYI A;  4QY4 A;  4O7B A;  5IG6 A;  4QEV A;  4YYN A;  5AD2 A;  4MEQ A;  3ZYU A;  3HME A;  5AD3 A;  5C8G A;  4Q0N A;  3MXF A;  3O35 A;  4NYX A;  4ALG A;  2LSP B;  5L99 A;  4AI6 A;  2WP1 A;  4A9O A;  3S92 A;  5KU3 A;  4YYJ A;  5LKU A;  2RNW A;  4KV4 A;  5CRM A;  4IR5 A;  5F1L A;  4CLB A;  4O7E A;  5HEM A;  2R10 A;  2L85 A;  4LZS A;  4TT6 A;  5TB6 A;  4YBM A;  3G0J A;  5FE3 A;  5DKC A;  4QSX A;  4O75 A;  4UYF B;  4DON A;  4LRG A;  5FFY A;  3P1E A;  4CUT A;  5EWD A;  3P1F A;  5HFQ A;  4YYI A;  4HXP A;  1WUG A;  4TZ8 A;  4YY4 A;  4QSR A;  5E3G A;  3LQJ A;  5ENH A;  4ALH A;  2YDW A;  4YK0 A;  5D3H A;  5DFD A;  4X2I A;  4YYD A;  4WIV A;  3G0L A;  5FB1 A;  3P1D A;  5C4Q A;  5LJ1 A;  5IGM A;  5CQ6 A;  3O36 A;  5DFC A;  2YEM A;  5F25 A;  5HEL A;  3QZT A;  4YY6 A;  5A82 A;  5F3A A;  5L8T A;  5EPS A;  5CP5 A;  4J3I A;  4AKH A;  5EWV A;  5DW1 A;  3U5M A;  1F68 A;  4OGJ A;  4LDF A;  4WHU A;  5J0D A;  2NXB A;  5COI A;  3LQH A;  5IBN A;  2MJV B;  2GRC A;  4O7F A;  5LKZ A;  3QZS A;  4Z1Q A;  4RVR A;  3U5L A;  4F3I A;  3AQA A;  5ACY A;  5DYC A;  5CTL A;  5EV9 A;  5FH7 A;  4NRB A;  5ENC A;  4A9K A;  5G4S A;  4ZC9 A;  4Z1S A;  4Z6H A;  5E9Y A;  3SVF A;  4UIX A;  4YYH A;  5C85 A;  3UVY A;  4ZQL A;  5ENI A;  4Y03 A;  4HXL A;  5F5Z A;  5FG6 A;  3MQM A;  5CRZ A;  1PUO A;  4MEO A;  2OUO A;  4TU6 A;  5A5R A;  4UIV A;  4IR4 A;  5ETD A;  4HXR A;  4QST A;  1X0J A;  3O33 A;  5HRW A;  4QSP A;  5DX4 A;  4BW2 A;  4TS8 A;  4J1P A;  4O7C A;  5FE8 A;  5DW2 A;  3U5K A;  3VKH A;  4Q0O A;  4YAT A;  4CUR A;  4YAD A;  2DVV A;  5F2P A;  4PCI A;  2E3K A;  5CQA A;  2DWW A;  4YH4 A;  2RNY A;  4HBX A;  3MB3 A;  4NRA A;  5F63 A;  2N9G A;  2E7O A;  3DWY A;  5JI8 A;  5IGL A;  4XYA A;  4MEN A;  4NR8 A;  5EVA A;  1JM4 B;  5BT5 A;  4NUC A;  2R0S A;  5CZG A;  2EJN A;  2E7N A;  4TT4 A;  5FE4 A;  5LUU A;  4IR3 A;  4KCX A;  5E0R A;  5D26 A;  5I80 A;  5D3N A;  4A9H A;  5FH8 A;  4HBW A;  5FE9 A;  4AKN A;  4XY9 A;  5D25 A;  3UW9 A;  5L96 A;  2RNX A;  4O77 A;  5FE0 A;  4NR5 A;  5F1H A;  4A9L A;  5HM0 A;  4TTE A;  5D3P A;  4QEW A;  3SVH A;  4PY6 A;  5DBM A;  4LYW A;  5ETB A;  5EWC A;  4BW1 A;  2OSS A;  4IOO A;  5A5P A;  4TT2 A;  5I29 A;  5A83 A;  3MB4 A;  4QSV A;  3JVJ A;  5HFR A;  5EWW A;  5FE2 A;  5EIC A;  4NR7 A;  4QSU A;  4WHW A;  5ENE A;  3D1B A;  4UIZ A;  4HXK A;  5A85 A;  1ZKR A;  3AAD A;  5FBX A;  5FG5 A;  5I1Q A;  4QSW A;  4UIU A;  4AKG A;  5HRV A;  5CGP A;  5I7X A;  5F36 A;  5EP7 A;  1E6I A;  5ENF A;  3UVD A;  3FKM X;  5D3S A;  3UVX A;  3JVL A;  4NYW A;  5FE1 A;  5I7Y A;  5D7X A;  5II2 A;  4QSS A;  5A7C A;  4QUU A;  5IGK A;  4LR6 A;  4NRC A;  4OUF A;  4PCE A;  5LVQ A;  4NR4 A;  5DYA A;  5IID A;  5DY7 A;  5LJ2 A;  5FFV A;  4CFL A;  5FH6 A;  4YC9 A;  5E73 A;  5KTW A;  4A9E A;  4BW3 A;  5I89 A;  5CUG A;  5D3J A;  3JVK A;  5CQ8 A;  4UIW A;  5H1V A;  5LVR A;  5EWH A;  4QR3 A;  5CPE A;  5E3D A;  2DKW A;  1WUM A;  4CUQ A;  4HBV A;  4UYH A;  4C67 A;  5A5S A;  5HCL A;  3D1D A;  4QEU A;  4BHW A;  5C7N A;  5KO4 A;  3JVM A;  4HXO A;  4NS5 A;  5FE5 A;  4NR6 A;  3TLP A;  3LQI A;  3UV5 A;  5EI4 A;  5CUB A;  4BJX A;  5CUE A;  4CFK A;  4Z6I A;  1ZS5 A;  3MUL A;  4NQM A;  4QR5 A;  3DAI A;  2KTB B;  5EQ1 A;  4YBS A;  5H1U A;  4XUA A;  5FB0 A;  5CQ3 A;  5EGU A;  4LC2 A;  2H60 A;  5HEN A;  4YYM A;  4UIY A;  3P1C A;  4ZW1 A;  5LJ0 A;  5FE6 A;  4N4G A;  3VKG A;  3IU5 A;  4NR9 A;  5CQ7 A;  2G4A A;  2YQD A;  4HXM A;  4TYL A;  4NUE A;  4NUD A;  5A5Q A;  5DKH A;  2DVR A;  5K29 A;  2DVS A;  5E9V A;  4XUB A;  4NYV A;  5D3T A;  3Q2F A;  5D3L A;  5F62 A;  2R0V A;  4IR6 A;  3HMH A;  4O70 A;  4O72 A;  4QC1 A;  4A9J A;  5EK9 A;  2RI7 A;  3K2J A;  4LYS A;  5F60 A;  1JSP B;  5LKX A;  5ENJ A;  4A9F A;  2I7K A;  5DLZ A;  5II1 A;  4PS5 A;  4UYE A;  4N4H A;  5I88 A;  5G4R A;  4YAB A;  2DAT A;  5CQT A;  4KV1 A;  5A5O A;  2DVQ A;  4CUP A;  4YYK A;  2FSA A;  4IOQ A;  5D0C A;  3U5P A;  5CQ4 A;  3NXB A;  3P5O A;  4NXJ A;  5EU1 A;  2RS9 B;  5FDZ A;  5FG4 A;  4A9I A;  4A9N A;  4HBY A;  2YW5 A;  5I86 A;  2OO1 A;  5EA1 A;  5A5N A;  5C87 A;  4CL9 A;  5HQ6 A;  5D3R A;  5L97 A;  4UYD A;  4J0R A;  5KTX A;  5JWM A;  5ENB A;  3ONI A;  4UYG A;  4QSQ A;  2YYN A;  3U5J A;  4MR4 A;  4YAX A;  3UV2 A;  4O74 A;  5E9M A;  2YEK A;  5LKT A;  5CUC A;  4O71 A;  4Z93 A;  3SVG A;  5F61 A;  3I3J A;  5D24 A;  4AKI A;  5DLX A;  5I83 A;  5EPR A;  5DFB A;  5CY9 A;  3GG3 A;  5E9I A;  3O37 A;  2WP2 A;  5DYX A;  3U5N A;  4HXN A;  5A81 A;  2D9E A;  5C89 A;  5E9K A;  3S91 A;  4O7A A;  3UV4 A;  4C66 A;  4MR6 A;  4N4I A;  3ERR A;  3MUK A;  3QZV A;  5HQ7 A;  4QBM A;  5E74 A;  4PTB A;  4HXS A;  5E9L A;  3U5O A;  4QYL A;  5DYU A;  4FLP A;  4BW4 A;  5E7D A;  3RCW A;  4O76 A;  2YEL A;  5L8U A;  4QUT A;  2L84 A;  5CFW A;  5HQ5 A;  5AMF A;  5BT4 A;  4MEP A;  3IU6 A;  4O78 A;  3LJW A;  4OGI A;  5CUA A;  2R0Y A;  5KHM A;  2D82 A;  2RFJ A;  3LXJ A;  2F6N A;  4MR3 A;  3Q2E A;  5CS8 A;  4CUS A;  4QR4 A;  5FFW A; 
#chains in the Genus database with same CATH homology
 5IGN A;  5KTU A;  5HLS A;  5CUD A;  4QB3 A;  4QYD A;  4YH3 A;  4UYF A;  5BT3 A;  5H85 A;  4A9M A;  5EPB A;  1N72 A;  5AME A;  4TZ2 A;  1EQF A;  4IOR A;  4YBT A;  2I8N A;  4YYG A;  4QNS A;  4TQN A;  5L98 A;  5CQ5 A;  4QC3 A;  4LZR A;  2RO1 A;  4N3W A;  4N4F A;  5EM3 A;  4E96 A;  5I40 A;  3O34 A;  3UVW A;  3HMF A;  2L5E A;  4XY8 A;  5DKD A;  5ENG A;  4PKL A;  4QZS A;  4MR5 A;  4UIT A;  4NQN A;  4TU4 A;  3D7C A;  5TCM A;  5CU8 A;  2F6J A;  5HRX A;  4CUU A;  5HJC A;  4GPJ A;  4J0S A;  4LZ2 A;  5EIS A;  5H1T A;  5FE7 A;  4LYI A;  4QY4 A;  4O7B A;  5IG6 A;  4QEV A;  4YYN A;  5AD2 A;  4MEQ A;  3ZYU A;  3HME A;  5AD3 A;  5C8G A;  4Q0N A;  3MXF A;  3O35 A;  4NYX A;  4ALG A;  2LSP B;  5L99 A;  2WP1 A;  4A9O A;  3S92 A;  5KU3 A;  4YYJ A;  5LKU A;  2RNW A;  4KV4 A;  5CRM A;  4IR5 A;  5F1L A;  4CLB A;  4O7E A;  5HEM A;  2R10 A;  2L85 A;  4LZS A;  4TT6 A;  5TB6 A;  4YBM A;  3G0J A;  5FE3 A;  5DKC A;  4QSX A;  4O75 A;  4UYF B;  4DON A;  4LRG A;  5FFY A;  3P1E A;  4CUT A;  5EWD A;  3P1F A;  5HFQ A;  4YYI A;  4HXP A;  1WUG A;  4TZ8 A;  4YY4 A;  4QSR A;  5E3G A;  3LQJ A;  5ENH A;  4ALH A;  2YDW A;  4YK0 A;  5D3H A;  5DFD A;  4X2I A;  4YYD A;  4WIV A;  3G0L A;  5FB1 A;  3P1D A;  5C4Q A;  5LJ1 A;  5IGM A;  5CQ6 A;  3O36 A;  5DFC A;  2YEM A;  5F25 A;  5HEL A;  3QZT A;  4YY6 A;  5A82 A;  5F3A A;  5L8T A;  5EPS A;  5CP5 A;  4J3I A;  5EWV A;  5DW1 A;  3U5M A;  1F68 A;  4OGJ A;  4LDF A;  4WHU A;  5J0D A;  2NXB A;  5COI A;  3LQH A;  5IBN A;  2MJV B;  2GRC A;  4O7F A;  5LKZ A;  3QZS A;  4Z1Q A;  4RVR A;  3U5L A;  4F3I A;  3AQA A;  5ACY A;  5DYC A;  5CTL A;  5EV9 A;  5FH7 A;  4NRB A;  5ENC A;  4A9K A;  5G4S A;  4ZC9 A;  4Z1S A;  4Z6H A;  5E9Y A;  3SVF A;  4UIX A;  4YYH A;  5C85 A;  3UVY A;  4ZQL A;  5ENI A;  4Y03 A;  4HXL A;  5F5Z A;  5FG6 A;  3MQM A;  5CRZ A;  4MEO A;  2OUO A;  4TU6 A;  5A5R A;  4UIV A;  4IR4 A;  5ETD A;  4HXR A;  4QST A;  1X0J A;  3O33 A;  5HRW A;  4QSP A;  5DX4 A;  4BW2 A;  4TS8 A;  4J1P A;  4O7C A;  5FE8 A;  5DW2 A;  3U5K A;  4Q0O A;  4YAT A;  4CUR A;  4YAD A;  2DVV A;  5F2P A;  4PCI A;  2E3K A;  5CQA A;  2DWW A;  4YH4 A;  2RNY A;  4HBX A;  3MB3 A;  4NRA A;  5F63 A;  2N9G A;  2E7O A;  3DWY A;  5JI8 A;  5IGL A;  4XYA A;  4MEN A;  4NR8 A;  5EVA A;  1JM4 B;  5BT5 A;  4NUC A;  2R0S A;  5CZG A;  2E7N A;  4TT4 A;  5FE4 A;  5LUU A;  4IR3 A;  4KCX A;  5E0R A;  5D26 A;  5I80 A;  5D3N A;  4A9H A;  5FH8 A;  4HBW A;  5FE9 A;  4AKN A;  4XY9 A;  5D25 A;  3UW9 A;  5L96 A;  2RNX A;  4O77 A;  5FE0 A;  4NR5 A;  5F1H A;  4A9L A;  5HM0 A;  4TTE A;  5D3P A;  4QEW A;  3SVH A;  4PY6 A;  5DBM A;  4LYW A;  5ETB A;  5EWC A;  4BW1 A;  2OSS A;  4IOO A;  5A5P A;  4TT2 A;  5I29 A;  5A83 A;  3MB4 A;  4QSV A;  3JVJ A;  5HFR A;  5EWW A;  5FE2 A;  5EIC A;  4NR7 A;  4QSU A;  4WHW A;  5ENE A;  4UIZ A;  4HXK A;  5A85 A;  3AAD A;  5FBX A;  5FG5 A;  5I1Q A;  4QSW A;  4UIU A;  5HRV A;  5CGP A;  5I7X A;  5F36 A;  5EP7 A;  1E6I A;  5ENF A;  3UVD A;  3FKM X;  5D3S A;  3UVX A;  3JVL A;  4NYW A;  5FE1 A;  5I7Y A;  5D7X A;  5II2 A;  4QSS A;  5A7C A;  4QUU A;  5IGK A;  4LR6 A;  4NRC A;  4OUF A;  4PCE A;  5LVQ A;  4NR4 A;  5DYA A;  5IID A;  5DY7 A;  5LJ2 A;  5FFV A;  4CFL A;  5FH6 A;  4YC9 A;  5E73 A;  5KTW A;  4A9E A;  4BW3 A;  5I89 A;  5CUG A;  5D3J A;  3JVK A;  5CQ8 A;  4UIW A;  5H1V A;  5LVR A;  5EWH A;  4QR3 A;  5CPE A;  5E3D A;  2DKW A;  1WUM A;  4CUQ A;  4HBV A;  4UYH A;  4C67 A;  5A5S A;  5HCL A;  4QEU A;  4BHW A;  5C7N A;  5KO4 A;  3JVM A;  4HXO A;  4NS5 A;  5FE5 A;  4NR6 A;  3TLP A;  3LQI A;  3UV5 A;  5EI4 A;  5CUB A;  4BJX A;  5CUE A;  4CFK A;  4Z6I A;  1ZS5 A;  3MUL A;  4NQM A;  4QR5 A;  3DAI A;  2KTB B;  5EQ1 A;  4YBS A;  5H1U A;  4XUA A;  5FB0 A;  5CQ3 A;  5EGU A;  4LC2 A;  2H60 A;  5HEN A;  4YYM A;  4UIY A;  3P1C A;  4ZW1 A;  5LJ0 A;  5FE6 A;  4N4G A;  3IU5 A;  4NR9 A;  5CQ7 A;  2G4A A;  2YQD A;  4HXM A;  4TYL A;  4NUE A;  4NUD A;  5A5Q A;  5DKH A;  2DVR A;  5K29 A;  2DVS A;  5E9V A;  4XUB A;  4NYV A;  5D3T A;  3Q2F A;  5D3L A;  5F62 A;  2R0V A;  4IR6 A;  3HMH A;  4O70 A;  4O72 A;  4QC1 A;  4A9J A;  5EK9 A;  2RI7 A;  3K2J A;  4LYS A;  5F60 A;  1JSP B;  5LKX A;  5ENJ A;  4A9F A;  2I7K A;  5DLZ A;  5II1 A;  4PS5 A;  4UYE A;  4N4H A;  5I88 A;  5G4R A;  4YAB A;  2DAT A;  5CQT A;  4KV1 A;  5A5O A;  2DVQ A;  4CUP A;  4YYK A;  2FSA A;  4IOQ A;  5D0C A;  3U5P A;  5CQ4 A;  3NXB A;  3P5O A;  4NXJ A;  5EU1 A;  2RS9 B;  5FDZ A;  5FG4 A;  4A9I A;  4A9N A;  4HBY A;  2YW5 A;  5I86 A;  2OO1 A;  5EA1 A;  5A5N A;  5C87 A;  4CL9 A;  5HQ6 A;  5D3R A;  5L97 A;  4UYD A;  4J0R A;  5KTX A;  5JWM A;  5ENB A;  3ONI A;  4UYG A;  4QSQ A;  2YYN A;  3U5J A;  4MR4 A;  4YAX A;  3UV2 A;  4O74 A;  5E9M A;  2YEK A;  5LKT A;  5CUC A;  4O71 A;  4Z93 A;  3SVG A;  5F61 A;  3I3J A;  5D24 A;  5DLX A;  5I83 A;  5EPR A;  5DFB A;  5CY9 A;  3GG3 A;  5E9I A;  3O37 A;  2WP2 A;  5DYX A;  3U5N A;  4HXN A;  5A81 A;  2D9E A;  5C89 A;  5E9K A;  3S91 A;  4O7A A;  3UV4 A;  4C66 A;  4MR6 A;  4N4I A;  3MUK A;  3QZV A;  5HQ7 A;  4QBM A;  5E74 A;  4PTB A;  4HXS A;  5E9L A;  3U5O A;  4QYL A;  5DYU A;  4FLP A;  4BW4 A;  5E7D A;  3RCW A;  4O76 A;  2YEL A;  5L8U A;  4QUT A;  2L84 A;  5CFW A;  5HQ5 A;  5AMF A;  5BT4 A;  4MEP A;  3IU6 A;  4O78 A;  3LJW A;  4OGI A;  5CUA A;  2R0Y A;  5KHM A;  2D82 A;  2RFJ A;  3LXJ A;  2F6N A;  4MR3 A;  3Q2E A;  5CS8 A;  4CUS A;  4QR4 A;  5FFW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...