4Y03A

Crystal structure of the fifth bromodomain of human pb1 in complex with salicylic acid
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
115
structure length
115
Chain Sequence
SKYMTPMQQKLNEVYEAVKNYTDKRGRRLSAIFLRLPSRSELPDYYLTIKKPMDMEKIRSHMMANKYQDIDSMVEDFVMMFNNACTYNEPESLIYKDALVLHKVLLETRRDLEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein polybromo-1
publication title Crystal Structure of the fifth bromodomain of human PB1 in complex with salicylic acid
rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 35
structure length 115
sequence length 115
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4y03A00
4TS8A 4O71A 4QSQA 5EI4A 5LKTA 2OUOA 4NR4A 3QZSA 4XY9A 4YC9A 5EV9A 4A9LA 4YABA 4TYLA 5E9YA 4RVRA 4NRBA 5DBMA 4CURA 5D3HA 4LRGA 3UVWA 4LYWA 3U5PA 4FLPA 2FSAA 4PCEA 4NUEA 5CUBA 4YYJA 5IGLA 5EGUA 5L8TA 5E7DA 4CUUA 2DVRA 4QUTA 3MB3A 4NR9A 5DKDA 4TZ8A 4QC3A 3MXFA 4YYMA 4J0RA 5EK9A 5CUEA 4MR4A 4HXLA 5FE4A 4IR5A 5JWMA 4TT4A 5AMFA 5FFYA 5HFRA 4LZSA 4HXKA 3HMEA 5I88A 3UV5A 2F6JA 5CGPA 4QEUA 5I40A 5EA1A 3U5KA 5FE5A 4NR6A 5EWDA 4O78A 4YYDA 5EPBA 5L99A 5DFBA 5LVRA 5EICA 2E3KA 5A5SA 5LKXA 3I3JA 5IIDA 4QUUA 5LVQA 5FE0A 5LJ0A 3Q2FA 5F62A 5HENA 5CUAA 5DX4A 4QEVA 4KCXA 4A9EA 5HRVA 5II2A 3JVJA 5I7YA 5EU1A 5I83A 2LSPB 4J1PA 4N4GA 2YDWA 2L85A 3O35A 2R0VA 4O70A 5A83A 4UIXA 4WHWA 2KTBB 4NXJA 4IOQA 5ENIA 2DATA 3S91A 4N4FA 5C89A 1JM4B 3O37A 5EWVA 5F36A 4TQNA 5EPRA 1E6IA 4UYEA 4Z6IA 5HLSA 5TB6A 4CUQA 5HQ6A 3JVLA 4XUAA 4HXSA 5CY9A 2L84A 5E9VA 5FG6A 5IG6A 5CQTA 5EISA 3UW9A 4X2IA 3FKMX 4HBYA 3GG3A 4HBWA 5EM3A 5CFWA 3S92A 4TU4A 5DLXA 5FE1A 5A5NA 5CQAA 5G4RA 4C66A 3LJWA 4BJXA 5D3JA 4BW3A 5K29A 4ZQLA 4QSVA 4NR7A 5C7NA 2YEKA 4QSTA 5LJ1A 5D26A 5KO4A 5FE7A 5DFDA 5HRXA 5CRMA 5CPEA 3TLPA 5ENBA 4Z93A 2RNWA 4UYGA 2DKWA 4ZC9A 5HFQA 4CUPA 3U5NA 5FBXA 3UV2A 5ENCA 5CUGA 1F68A 3QZVA 5F63A 5CQ6A 5LJ2A 3SVHA 4NYXA 5II1A 5H1TA 5A81A 4YATA 3P1DA 4J0SA 5D25A 5D7XA 3U5OA 3K2JA 5A5QA 5DYCA 1N72A 4HBXA 4YK0A 5E9KA 4AKNA 2E7OA 4MR5A 5DYXA 4NUDA 4YYGA 4MEOA 4C67A 5BT3A 3LQJA 4N4HA 4UYFA 3UVDA 4NR5A 4YYIA 4MEQA 4UIZA 2R0YA 3MULA 4IR3A 5I1QA 4IR6A 2WP2A 4QSXA 5DYUA 4A9IA 5C87A 2YW5A 2D82A 5HCLA 3UVXA 5FE2A 4PKLA 4NYVA 4NUCA 5CQ3A 4XUBA 2RS9B 4QSWA 4QSRA 4YADA 5L98A 3ONIA 5FH8A 4QR4A 4E96A 5F3AA 5CQ8A 3NXBA 4KV1A 5HEMA 4YH3A 5IGMA 5L97A 4O76A 5AD3A 3P1EA 4BW4A 4OGJA 3P5OA 4NS5A 4ALHA 2YELA 4UIYA 5D3TA 5C85A 4QR5A 3G0JA 2DWWA 3HMFA 3O34A 4UIUA 5FE9A 5F1HA 4A9OA 5ENGA 4CUTA 2YYNA 2N9GA 4MENA 5HELA 4LR6A 4NQNA 5H85A 5EQ1A 3U5MA 3LXJA 5EPSA 4HXRA 2NXBA 2RNYA 4Q0OA 4LZ2A 2D9EA 5E9IA 3SVGA 4QNSA 4N3WA 3G0LA 2DVSA 1WUMA 4LYIA 5D3SA 5CTLA 2RFJA 5HRWA 2OSSA 4IR4A 5CQ4A 4A9JA 4YAXA 4YYHA 5I86A 3U5JA 5EWCA 5E74A 4HXNA 5F61A 4PCIA 4QSPA 4BW2A 2RNXA 5LKZA 5H1UA 5BT5A 5C8GA 5FE8A 5I89A 4QYDA 5L8UA 3LQHA 5EWWA 4TT2A 5HJCA 4YBTA 5F60A 4O7FA 4MR6A 3O33A 4UYFB 3DAIA 5AMEA 2RO1A 2R0SA 4HBVA 4TU6A 4CUSA 5FFWA 4UIWA 5FB0A 5DYAA 2OO1A 4XY8A 3RCWA 5FE3A 4QR3A 3AQAA 4UITA 2DVVA 4TZ2A 3UVYA 4GPJA 4Z1QA 2I7KA 4O7EA 2I8NA 3JVKA 5D3NA 4QBMA 5DKCA 5DY7A 4WHUA 4O75A 3SVFA 5CUDA 4YBSA 4NRAA 3LQIA 4LZRA 5H1VA 4ZW1A 2YQDA 4YY4A 5E9LA 4QEWA 3Q2EA 4IORA 4OUFA 1EQFA 4O74A 5CQ5A 4CLBA 5FFVA 5FE6A 4LDFA 5KHMA 1X0JA 3MQMA 2F6NA 3IU6A 5HQ7A 4TTEA 4Y03A 4PS5A 5I80A 4UYDA 3QZTA 5COIA 5G4SA 5I29A 5A5OA 4HXOA 5KTUA 4O72A 5IGNA 5HM0A 4HXMA 4N4IA 5TCMA 5A5RA 2DVQA 4O7BA 5EWHA 5AD2A 5C4QA 5ENHA 4YBMA 5DW2A 5DLZA 3MB4A 3IU5A 5D0CA 4BHWA 3UV4A 5CU8A 4NRCA 2WP1A 1ZS5A 5FDZA 4QSSA 4NYWA 3JVMA 5CRZA 4Q0NA 4LYSA 5IBNA 5A5PA 2E7NA 3D7CA 5FB1A 1JSPB 5D3PA 4CFLA 5J0DA 5E3GA 5EVAA 4PY6A 3AADA 4BW1A 4QY4A 3P1CA 5ENFA 4A9HA 4Z1SA 5KTXA 2RI7A 4WIVA 4O77A 4IOOA 4PTBA 5L96A 5ENJA 4ALGA 4QYLA 3ZYUA 4A9NA 4OGIA 4YH4A 5E73A 4XYAA 4YYKA 4CL9A 4UIVA 4CFKA 5DW1A 5F5ZA 1WUGA 4O7CA 5D3LA 3O36A 4MEPA 5EP7A 4Z6HA 5E9MA 4UYHA 4A9KA 4QZSA 4HXPA 5BT4A 5ACYA 5IGKA 4DONA 5CUCA 5FG5A 4YY6A 2R10A 5CS8A 5D24A 5E0RA 4NQMA 5D3RA 5DKHA 5I7XA 4A9MA 5F2PA 3MUKA 4O7AA 5CZGA 4QC1A 5F25A 5LKUA 5FH7A 2YEMA 4QSUA 5FH6A 3HMHA 2H60A 2L5EA 2G4AA 5ETBA 3DWYA 3U5LA 4LC2A 5CQ7A 5ENEA 5A82A 4QB3A 5ETDA 5HQ5A 5LUUA 4KV4A 4YYNA 5A85A 5CP5A 5JI8A 2MJVB 4F3IA 5E3DA 5KU3A 5DFCA 4J3IA 3P1FA 5KTWA 5FG4A 4A9FA 5A7CA 4MR3A 2GRCA 4TT6A 5F1LA 4NR8A
chains in the Genus database with same CATH superfamily
4TS8A 4O71A 4QSQA 5EI4A 5LKTA 2OUOA 4NR4A 3QZSA 4XY9A 4YC9A 5EV9A 4A9LA 4YABA 4TYLA 5E9YA 4RVRA 4NRBA 5DBMA 4CURA 5D3HA 4LRGA 3UVWA 4LYWA 3U5PA 4FLPA 2FSAA 4PCEA 4NUEA 5CUBA 4YYJA 5IGLA 5EGUA 5L8TA 5E7DA 4CUUA 2DVRA 4QUTA 3MB3A 4NR9A 5DKDA 4TZ8A 4QC3A 3MXFA 4YYMA 4J0RA 5EK9A 5CUEA 4MR4A 4HXLA 5FE4A 4IR5A 5JWMA 4TT4A 5AMFA 5FFYA 5HFRA 4LZSA 4HXKA 3HMEA 5I88A 3UV5A 2F6JA 5CGPA 4QEUA 5I40A 5EA1A 3U5KA 5FE5A 4NR6A 5EWDA 4O78A 4YYDA 5EPBA 5L99A 5DFBA 5LVRA 5EICA 2E3KA 5A5SA 5LKXA 3I3JA 5IIDA 4QUUA 5LVQA 5FE0A 5LJ0A 3Q2FA 5F62A 5HENA 5CUAA 5DX4A 4QEVA 4KCXA 4A9EA 5HRVA 5II2A 3JVJA 5I7YA 5EU1A 5I83A 2LSPB 4J1PA 4N4GA 2YDWA 2L85A 3O35A 2R0VA 4O70A 5A83A 4UIXA 4WHWA 2KTBB 4NXJA 4IOQA 5ENIA 2DATA 3S91A 4N4FA 5C89A 1JM4B 3O37A 5EWVA 5F36A 4TQNA 5EPRA 1E6IA 4UYEA 4Z6IA 5HLSA 5TB6A 4CUQA 5HQ6A 3JVLA 4XUAA 4HXSA 5CY9A 2L84A 5E9VA 5FG6A 5IG6A 5CQTA 5EISA 3UW9A 4X2IA 3FKMX 4HBYA 3GG3A 4HBWA 5EM3A 5CFWA 3S92A 4TU4A 5DLXA 5FE1A 5A5NA 5CQAA 5G4RA 4C66A 3LJWA 4BJXA 5D3JA 4BW3A 5K29A 4ZQLA 4QSVA 4NR7A 5C7NA 2YEKA 4QSTA 5LJ1A 5D26A 5KO4A 5FE7A 5DFDA 5HRXA 5CRMA 5CPEA 3TLPA 5ENBA 4Z93A 2RNWA 4UYGA 2DKWA 4ZC9A 5HFQA 4CUPA 4AI6A 3U5NA 5FBXA 3UV2A 5ENCA 5CUGA 1F68A 3QZVA 5F63A 5CQ6A 5LJ2A 3SVHA 4NYXA 5II1A 5H1TA 5A81A 4YATA 3P1DA 4J0SA 5D25A 5D7XA 3U5OA 3D1BA 3K2JA 5A5QA 5DYCA 1N72A 4HBXA 4YK0A 3ERRA 5E9KA 4AKNA 2E7OA 4MR5A 5DYXA 4NUDA 4YYGA 4MEOA 4C67A 5BT3A 3LQJA 4N4HA 4UYFA 3UVDA 4NR5A 4YYIA 4MEQA 4UIZA 2R0YA 3MULA 4IR3A 5I1QA 4IR6A 2WP2A 4QSXA 5DYUA 4A9IA 5C87A 2YW5A 2D82A 5HCLA 3UVXA 5FE2A 4PKLA 3VKGA 4NYVA 4NUCA 5CQ3A 4XUBA 2RS9B 4QSWA 4QSRA 4YADA 5L98A 3ONIA 5FH8A 4QR4A 4E96A 5F3AA 5CQ8A 3NXBA 4KV1A 5HEMA 4YH3A 3D1DA 5IGMA 5L97A 4O76A 5AD3A 3P1EA 4BW4A 4OGJA 3P5OA 4NS5A 4ALHA 2YELA 4UIYA 5D3TA 5C85A 4QR5A 4AKIA 2EJNA 3G0JA 2DWWA 3HMFA 3O34A 4UIUA 5FE9A 5F1HA 4A9OA 5ENGA 4CUTA 2YYNA 2N9GA 4MENA 5HELA 4LR6A 4NQNA 5H85A 5EQ1A 3U5MA 3LXJA 5EPSA 4HXRA 2NXBA 2RNYA 4Q0OA 4LZ2A 2D9EA 5E9IA 3SVGA 4QNSA 4N3WA 3G0LA 2DVSA 1WUMA 4LYIA 5D3SA 5CTLA 2RFJA 5HRWA 2OSSA 4IR4A 5CQ4A 4A9JA 4YAXA 1PUOA 4YYHA 5I86A 3U5JA 5EWCA 5E74A 4HXNA 5F61A 4PCIA 4QSPA 4BW2A 2RNXA 5LKZA 5H1UA 5BT5A 5C8GA 5FE8A 5I89A 4QYDA 5L8UA 3LQHA 5EWWA 4TT2A 5HJCA 4YBTA 5F60A 4O7FA 4MR6A 3O33A 4UYFB 3DAIA 5AMEA 2RO1A 2R0SA 4HBVA 4TU6A 4CUSA 5FFWA 4UIWA 5FB0A 5DYAA 2OO1A 4XY8A 3RCWA 5FE3A 4QR3A 3AQAA 4UITA 2DVVA 4TZ2A 3UVYA 4GPJA 4Z1QA 2I7KA 4O7EA 2I8NA 3JVKA 5D3NA 4QBMA 5DKCA 5DY7A 4WHUA 4O75A 3SVFA 5CUDA 4YBSA 4NRAA 3LQIA 4LZRA 5H1VA 4ZW1A 2YQDA 4YY4A 5E9LA 4QEWA 3Q2EA 4IORA 4OUFA 1EQFA 4O74A 5CQ5A 4CLBA 5FFVA 3VKHA 5FE6A 4LDFA 5KHMA 1X0JA 3MQMA 2F6NA 3IU6A 5HQ7A 4TTEA 4Y03A 4PS5A 5I80A 4AKHA 4UYDA 3QZTA 5COIA 5G4SA 5I29A 5A5OA 4HXOA 5KTUA 4O72A 5IGNA 5HM0A 4HXMA 4N4IA 5TCMA 5A5RA 2DVQA 4O7BA 5EWHA 5AD2A 5C4QA 5ENHA 4YBMA 5DW2A 5DLZA 3MB4A 3IU5A 5D0CA 4BHWA 3UV4A 5CU8A 4NRCA 2WP1A 1ZS5A 5FDZA 4QSSA 4NYWA 3JVMA 5CRZA 4Q0NA 4LYSA 5IBNA 5A5PA 2E7NA 3D7CA 5FB1A 1JSPB 5D3PA 4CFLA 5J0DA 5E3GA 5EVAA 4PY6A 3AADA 4BW1A 4QY4A 3P1CA 5ENFA 4A9HA 4Z1SA 5KTXA 2RI7A 4WIVA 4O77A 4IOOA 4PTBA 5L96A 5ENJA 4ALGA 4QYLA 3ZYUA 4A9NA 4OGIA 4YH4A 5E73A 1ZKRA 4XYAA 4YYKA 4CL9A 4UIVA 4CFKA 5DW1A 5F5ZA 1WUGA 4O7CA 5D3LA 3O36A 4MEPA 5EP7A 4Z6HA 5E9MA 4UYHA 4A9KA 4QZSA 4HXPA 5BT4A 5ACYA 5IGKA 4DONA 5CUCA 5FG5A 4YY6A 2R10A 5CS8A 5D24A 5E0RA 4NQMA 5D3RA 5DKHA 5I7XA 4A9MA 5F2PA 3MUKA 4O7AA 5CZGA 4QC1A 5F25A 5LKUA 5FH7A 2YEMA 4QSUA 5FH6A 3HMHA 2H60A 2L5EA 2G4AA 5ETBA 3DWYA 3U5LA 4LC2A 5CQ7A 5ENEA 5A82A 4QB3A 5ETDA 5HQ5A 5LUUA 4KV4A 4YYNA 4AKGA 5A85A 5CP5A 5JI8A 2MJVB 4F3IA 5E3DA 5KU3A 5DFCA 4J3IA 3P1FA 5KTWA 5FG4A 4A9FA 5A7CA 4MR3A 2GRCA 4TT6A 5F1LA 4NR8A
chains in the Genus database with same CATH topology
4TS8A 4O71A 4QSQA 5EI4A 5LKTA 2OUOA 4NR4A 3QZSA 4XY9A 4YC9A 5EV9A 4A9LA 4YABA 4TYLA 5E9YA 4RVRA 4NRBA 5DBMA 4CURA 5D3HA 4LRGA 3UVWA 4LYWA 3U5PA 4FLPA 2FSAA 4PCEA 4NUEA 5CUBA 4YYJA 5IGLA 5EGUA 5L8TA 5E7DA 4CUUA 2DVRA 4QUTA 3MB3A 4NR9A 5DKDA 4TZ8A 4QC3A 3MXFA 4YYMA 4J0RA 5EK9A 5CUEA 4MR4A 4HXLA 5FE4A 4IR5A 5JWMA 4TT4A 5AMFA 5FFYA 5HFRA 4LZSA 4HXKA 3HMEA 5I88A 3UV5A 2F6JA 5CGPA 4QEUA 5I40A 5EA1A 3U5KA 5FE5A 4NR6A 5EWDA 4O78A 4YYDA 5EPBA 5L99A 5DFBA 5LVRA 5EICA 2E3KA 5A5SA 5LKXA 3I3JA 5IIDA 4QUUA 5LVQA 5FE0A 5LJ0A 3Q2FA 5F62A 5HENA 5CUAA 5DX4A 4QEVA 4KCXA 4A9EA 5HRVA 5II2A 3JVJA 5I7YA 5EU1A 5I83A 2LSPB 4J1PA 4N4GA 2YDWA 2L85A 3O35A 2R0VA 4O70A 5A83A 4UIXA 4WHWA 2KTBB 4NXJA 4IOQA 5ENIA 2DATA 3S91A 4N4FA 5C89A 1JM4B 3O37A 5EWVA 5F36A 4TQNA 5EPRA 1E6IA 4UYEA 4Z6IA 5HLSA 5TB6A 4CUQA 5HQ6A 3JVLA 4XUAA 4HXSA 5CY9A 2L84A 5E9VA 5FG6A 5IG6A 5CQTA 5EISA 3UW9A 4X2IA 3FKMX 4HBYA 3GG3A 4HBWA 5EM3A 5CFWA 3S92A 4TU4A 5DLXA 5FE1A 5A5NA 5CQAA 5G4RA 4C66A 3LJWA 4BJXA 5D3JA 4BW3A 5K29A 4ZQLA 4QSVA 4NR7A 5C7NA 2YEKA 4QSTA 5LJ1A 5D26A 5KO4A 5FE7A 5DFDA 5HRXA 5CRMA 5CPEA 3TLPA 5ENBA 4Z93A 2RNWA 4UYGA 2DKWA 4ZC9A 5HFQA 4CUPA 3U5NA 5FBXA 3UV2A 5ENCA 5CUGA 1F68A 3QZVA 5F63A 5CQ6A 5LJ2A 3SVHA 4NYXA 5II1A 5H1TA 5A81A 4YATA 3P1DA 4J0SA 5D25A 5D7XA 3U5OA 3K2JA 5A5QA 5DYCA 1N72A 4HBXA 4YK0A 5E9KA 4AKNA 2E7OA 4MR5A 5DYXA 4NUDA 4YYGA 4MEOA 4C67A 5BT3A 3LQJA 4N4HA 4UYFA 3UVDA 4NR5A 4YYIA 4MEQA 4UIZA 2R0YA 3MULA 4IR3A 5I1QA 4IR6A 2WP2A 4QSXA 5DYUA 4A9IA 5C87A 2YW5A 2D82A 5HCLA 3UVXA 5FE2A 4PKLA 4NYVA 4NUCA 5CQ3A 4XUBA 2RS9B 4QSWA 4QSRA 4YADA 5L98A 3ONIA 5FH8A 4QR4A 4E96A 5F3AA 5CQ8A 3NXBA 4KV1A 5HEMA 4YH3A 5IGMA 5L97A 4O76A 5AD3A 3P1EA 4BW4A 4OGJA 3P5OA 4NS5A 4ALHA 2YELA 4UIYA 5D3TA 5C85A 4QR5A 3G0JA 2DWWA 3HMFA 3O34A 4UIUA 5FE9A 5F1HA 4A9OA 5ENGA 4CUTA 2YYNA 2N9GA 4MENA 5HELA 4LR6A 4NQNA 5H85A 5EQ1A 3U5MA 3LXJA 5EPSA 4HXRA 2NXBA 2RNYA 4Q0OA 4LZ2A 2D9EA 5E9IA 3SVGA 4QNSA 4N3WA 3G0LA 2DVSA 1WUMA 4LYIA 5D3SA 5CTLA 2RFJA 5HRWA 2OSSA 4IR4A 5CQ4A 4A9JA 4YAXA 4YYHA 5I86A 3U5JA 5EWCA 5E74A 4HXNA 5F61A 4PCIA 4QSPA 4BW2A 2RNXA 5LKZA 5H1UA 5BT5A 5C8GA 5FE8A 5I89A 4QYDA 5L8UA 3LQHA 5EWWA 4TT2A 5HJCA 4YBTA 5F60A 4O7FA 4MR6A 3O33A 4UYFB 3DAIA 5AMEA 2RO1A 2R0SA 4HBVA 4TU6A 4CUSA 5FFWA 4UIWA 5FB0A 5DYAA 2OO1A 4XY8A 3RCWA 5FE3A 4QR3A 3AQAA 4UITA 2DVVA 4TZ2A 3UVYA 4GPJA 4Z1QA 2I7KA 4O7EA 2I8NA 3JVKA 5D3NA 4QBMA 5DKCA 5DY7A 4WHUA 4O75A 3SVFA 5CUDA 4YBSA 4NRAA 3LQIA 4LZRA 5H1VA 4ZW1A 2YQDA 4YY4A 5E9LA 4QEWA 3Q2EA 4IORA 4OUFA 1EQFA 4O74A 5CQ5A 4CLBA 5FFVA 5FE6A 4LDFA 5KHMA 1X0JA 3MQMA 2F6NA 3IU6A 5HQ7A 4TTEA 4Y03A 4PS5A 5I80A 4UYDA 3QZTA 5COIA 5G4SA 5I29A 5A5OA 4HXOA 5KTUA 4O72A 5IGNA 5HM0A 4HXMA 4N4IA 5TCMA 5A5RA 2DVQA 4O7BA 5EWHA 5AD2A 5C4QA 5ENHA 4YBMA 5DW2A 5DLZA 3MB4A 3IU5A 5D0CA 4BHWA 3UV4A 5CU8A 4NRCA 2WP1A 1ZS5A 5FDZA 4QSSA 4NYWA 3JVMA 5CRZA 4Q0NA 4LYSA 5IBNA 5A5PA 2E7NA 3D7CA 5FB1A 1JSPB 5D3PA 4CFLA 5J0DA 5E3GA 5EVAA 4PY6A 3AADA 4BW1A 4QY4A 3P1CA 5ENFA 4A9HA 4Z1SA 5KTXA 2RI7A 4WIVA 4O77A 4IOOA 4PTBA 5L96A 5ENJA 4ALGA 4QYLA 3ZYUA 4A9NA 4OGIA 4YH4A 5E73A 4XYAA 4YYKA 4CL9A 4UIVA 4CFKA 5DW1A 5F5ZA 1WUGA 4O7CA 5D3LA 3O36A 4MEPA 5EP7A 4Z6HA 5E9MA 4UYHA 4A9KA 4QZSA 4HXPA 5BT4A 5ACYA 5IGKA 4DONA 5CUCA 5FG5A 4YY6A 2R10A 5CS8A 5D24A 5E0RA 4NQMA 5D3RA 5DKHA 5I7XA 4A9MA 5F2PA 3MUKA 4O7AA 5CZGA 4QC1A 5F25A 5LKUA 5FH7A 2YEMA 4QSUA 5FH6A 3HMHA 2H60A 2L5EA 2G4AA 5ETBA 3DWYA 3U5LA 4LC2A 5CQ7A 5ENEA 5A82A 4QB3A 5ETDA 5HQ5A 5LUUA 4KV4A 4YYNA 5A85A 5CP5A 5JI8A 2MJVB 4F3IA 5E3DA 5KU3A 5DFCA 4J3IA 3P1FA 5KTWA 5FG4A 4A9FA 5A7CA 4MR3A 2GRCA 4TT6A 5F1LA 4NR8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TS8 A;  4O71 A;  4QSQ A;  5EI4 A;  5LKT A;  2OUO A;  4NR4 A;  3QZS A;  4XY9 A;  4YC9 A;  5EV9 A;  4A9L A;  4YAB A;  4TYL A;  5E9Y A;  4RVR A;  4NRB A;  5DBM A;  4CUR A;  5D3H A;  4LRG A;  3UVW A;  4LYW A;  3U5P A;  4FLP A;  2FSA A;  4PCE A;  4NUE A;  5CUB A;  4YYJ A;  5IGL A;  5EGU A;  5L8T A;  5E7D A;  4CUU A;  2DVR A;  4QUT A;  3MB3 A;  4NR9 A;  5DKD A;  4TZ8 A;  4QC3 A;  3MXF A;  4YYM A;  4J0R A;  5EK9 A;  5CUE A;  4MR4 A;  4HXL A;  5FE4 A;  4IR5 A;  5JWM A;  4TT4 A;  5AMF A;  5FFY A;  5HFR A;  4LZS A;  4HXK A;  3HME A;  5I88 A;  3UV5 A;  2F6J A;  5CGP A;  4QEU A;  5I40 A;  5EA1 A;  3U5K A;  5FE5 A;  4NR6 A;  5EWD A;  4O78 A;  4YYD A;  5EPB A;  5L99 A;  5DFB A;  5LVR A;  5EIC A;  2E3K A;  5A5S A;  5LKX A;  3I3J A;  5IID A;  4QUU A;  5LVQ A;  5FE0 A;  5LJ0 A;  3Q2F A;  5F62 A;  5HEN A;  5CUA A;  5DX4 A;  4QEV A;  4KCX A;  4A9E A;  5HRV A;  5II2 A;  3JVJ A;  5I7Y A;  5EU1 A;  5I83 A;  2LSP B;  4J1P A;  4N4G A;  2YDW A;  2L85 A;  3O35 A;  2R0V A;  4O70 A;  5A83 A;  4UIX A;  4WHW A;  2KTB B;  4NXJ A;  4IOQ A;  5ENI A;  2DAT A;  3S91 A;  4N4F A;  5C89 A;  1JM4 B;  3O37 A;  5EWV A;  5F36 A;  4TQN A;  5EPR A;  1E6I A;  4UYE A;  4Z6I A;  5HLS A;  5TB6 A;  4CUQ A;  5HQ6 A;  3JVL A;  4XUA A;  4HXS A;  5CY9 A;  2L84 A;  5E9V A;  5FG6 A;  5IG6 A;  5CQT A;  5EIS A;  3UW9 A;  4X2I A;  3FKM X;  4HBY A;  3GG3 A;  4HBW A;  5EM3 A;  5CFW A;  3S92 A;  4TU4 A;  5DLX A;  5FE1 A;  5A5N A;  5CQA A;  5G4R A;  4C66 A;  3LJW A;  4BJX A;  5D3J A;  4BW3 A;  5K29 A;  4ZQL A;  4QSV A;  4NR7 A;  5C7N A;  2YEK A;  4QST A;  5LJ1 A;  5D26 A;  5KO4 A;  5FE7 A;  5DFD A;  5HRX A;  5CRM A;  5CPE A;  3TLP A;  5ENB A;  4Z93 A;  2RNW A;  4UYG A;  2DKW A;  4ZC9 A;  5HFQ A;  4CUP A;  3U5N A;  5FBX A;  3UV2 A;  5ENC A;  5CUG A;  1F68 A;  3QZV A;  5F63 A;  5CQ6 A;  5LJ2 A;  3SVH A;  4NYX A;  5II1 A;  5H1T A;  5A81 A;  4YAT A;  3P1D A;  4J0S A;  5D25 A;  5D7X A;  3U5O A;  3K2J A;  5A5Q A;  5DYC A;  1N72 A;  4HBX A;  4YK0 A;  5E9K A;  4AKN A;  2E7O A;  4MR5 A;  5DYX A;  4NUD A;  4YYG A;  4MEO A;  4C67 A;  5BT3 A;  3LQJ A;  4N4H A;  4UYF A;  3UVD A;  4NR5 A;  4YYI A;  4MEQ A;  4UIZ A;  2R0Y A;  3MUL A;  4IR3 A;  5I1Q A;  4IR6 A;  2WP2 A;  4QSX A;  5DYU A;  4A9I A;  5C87 A;  2YW5 A;  2D82 A;  5HCL A;  3UVX A;  5FE2 A;  4PKL A;  4NYV A;  4NUC A;  5CQ3 A;  4XUB A;  2RS9 B;  4QSW A;  4QSR A;  4YAD A;  5L98 A;  3ONI A;  5FH8 A;  4QR4 A;  4E96 A;  5F3A A;  5CQ8 A;  3NXB A;  4KV1 A;  5HEM A;  4YH3 A;  5IGM A;  5L97 A;  4O76 A;  5AD3 A;  3P1E A;  4BW4 A;  4OGJ A;  3P5O A;  4NS5 A;  4ALH A;  2YEL A;  4UIY A;  5D3T A;  5C85 A;  4QR5 A;  3G0J A;  2DWW A;  3HMF A;  3O34 A;  4UIU A;  5FE9 A;  5F1H A;  4A9O A;  5ENG A;  4CUT A;  2YYN A;  2N9G A;  4MEN A;  5HEL A;  4LR6 A;  4NQN A;  5H85 A;  5EQ1 A;  3U5M A;  3LXJ A;  5EPS A;  4HXR A;  2NXB A;  2RNY A;  4Q0O A;  4LZ2 A;  2D9E A;  5E9I A;  3SVG A;  4QNS A;  4N3W A;  3G0L A;  2DVS A;  1WUM A;  4LYI A;  5D3S A;  5CTL A;  2RFJ A;  5HRW A;  2OSS A;  4IR4 A;  5CQ4 A;  4A9J A;  4YAX A;  4YYH A;  5I86 A;  3U5J A;  5EWC A;  5E74 A;  4HXN A;  5F61 A;  4PCI A;  4QSP A;  4BW2 A;  2RNX A;  5LKZ A;  5H1U A;  5BT5 A;  5C8G A;  5FE8 A;  5I89 A;  4QYD A;  5L8U A;  3LQH A;  5EWW A;  4TT2 A;  5HJC A;  4YBT A;  5F60 A;  4O7F A;  4MR6 A;  3O33 A;  4UYF B;  3DAI A;  5AME A;  2RO1 A;  2R0S A;  4HBV A;  4TU6 A;  4CUS A;  5FFW A;  4UIW A;  5FB0 A;  5DYA A;  2OO1 A;  4XY8 A;  3RCW A;  5FE3 A;  4QR3 A;  3AQA A;  4UIT A;  2DVV A;  4TZ2 A;  3UVY A;  4GPJ A;  4Z1Q A;  2I7K A;  4O7E A;  2I8N A;  3JVK A;  5D3N A;  4QBM A;  5DKC A;  5DY7 A;  4WHU A;  4O75 A;  3SVF A;  5CUD A;  4YBS A;  4NRA A;  3LQI A;  4LZR A;  5H1V A;  4ZW1 A;  2YQD A;  4YY4 A;  5E9L A;  4QEW A;  3Q2E A;  4IOR A;  4OUF A;  1EQF A;  4O74 A;  5CQ5 A;  4CLB A;  5FFV A;  5FE6 A;  4LDF A;  5KHM A;  1X0J A;  3MQM A;  2F6N A;  3IU6 A;  5HQ7 A;  4TTE A;  4Y03 A;  4PS5 A;  5I80 A;  4UYD A;  3QZT A;  5COI A;  5G4S A;  5I29 A;  5A5O A;  4HXO A;  5KTU A;  4O72 A;  5IGN A;  5HM0 A;  4HXM A;  4N4I A;  5TCM A;  5A5R A;  2DVQ A;  4O7B A;  5EWH A;  5AD2 A;  5C4Q A;  5ENH A;  4YBM A;  5DW2 A;  5DLZ A;  3MB4 A;  3IU5 A;  5D0C A;  4BHW A;  3UV4 A;  5CU8 A;  4NRC A;  2WP1 A;  1ZS5 A;  5FDZ A;  4QSS A;  4NYW A;  3JVM A;  5CRZ A;  4Q0N A;  4LYS A;  5IBN A;  5A5P A;  2E7N A;  3D7C A;  5FB1 A;  1JSP B;  5D3P A;  4CFL A;  5J0D A;  5E3G A;  5EVA A;  4PY6 A;  3AAD A;  4BW1 A;  4QY4 A;  3P1C A;  5ENF A;  4A9H A;  4Z1S A;  5KTX A;  2RI7 A;  4WIV A;  4O77 A;  4IOO A;  4PTB A;  5L96 A;  5ENJ A;  4ALG A;  4QYL A;  3ZYU A;  4A9N A;  4OGI A;  4YH4 A;  5E73 A;  4XYA A;  4YYK A;  4CL9 A;  4UIV A;  4CFK A;  5DW1 A;  5F5Z A;  1WUG A;  4O7C A;  5D3L A;  3O36 A;  4MEP A;  5EP7 A;  4Z6H A;  5E9M A;  4UYH A;  4A9K A;  4QZS A;  4HXP A;  5BT4 A;  5ACY A;  5IGK A;  4DON A;  5CUC A;  5FG5 A;  4YY6 A;  2R10 A;  5CS8 A;  5D24 A;  5E0R A;  4NQM A;  5D3R A;  5DKH A;  5I7X A;  4A9M A;  5F2P A;  3MUK A;  4O7A A;  5CZG A;  4QC1 A;  5F25 A;  5LKU A;  5FH7 A;  2YEM A;  4QSU A;  5FH6 A;  3HMH A;  2H60 A;  2L5E A;  2G4A A;  5ETB A;  3DWY A;  3U5L A;  4LC2 A;  5CQ7 A;  5ENE A;  5A82 A;  4QB3 A;  5ETD A;  5HQ5 A;  5LUU A;  4KV4 A;  4YYN A;  5A85 A;  5CP5 A;  5JI8 A;  2MJV B;  4F3I A;  5E3D A;  5KU3 A;  5DFC A;  4J3I A;  3P1F A;  5KTW A;  5FG4 A;  4A9F A;  5A7C A;  4MR3 A;  2GRC A;  4TT6 A;  5F1L A;  4NR8 A; 
#chains in the Genus database with same CATH topology
 4TS8 A;  4O71 A;  4QSQ A;  5EI4 A;  5LKT A;  2OUO A;  4NR4 A;  3QZS A;  4XY9 A;  4YC9 A;  5EV9 A;  4A9L A;  4YAB A;  4TYL A;  5E9Y A;  4RVR A;  4NRB A;  5DBM A;  4CUR A;  5D3H A;  4LRG A;  3UVW A;  4LYW A;  3U5P A;  4FLP A;  2FSA A;  4PCE A;  4NUE A;  5CUB A;  4YYJ A;  5IGL A;  5EGU A;  5L8T A;  5E7D A;  4CUU A;  2DVR A;  4QUT A;  3MB3 A;  4NR9 A;  5DKD A;  4TZ8 A;  4QC3 A;  3MXF A;  4YYM A;  4J0R A;  5EK9 A;  5CUE A;  4MR4 A;  4HXL A;  5FE4 A;  4IR5 A;  5JWM A;  4TT4 A;  5AMF A;  5FFY A;  5HFR A;  4LZS A;  4HXK A;  3HME A;  5I88 A;  3UV5 A;  2F6J A;  5CGP A;  4QEU A;  5I40 A;  5EA1 A;  3U5K A;  5FE5 A;  4NR6 A;  5EWD A;  4O78 A;  4YYD A;  5EPB A;  5L99 A;  5DFB A;  5LVR A;  5EIC A;  2E3K A;  5A5S A;  5LKX A;  3I3J A;  5IID A;  4QUU A;  5LVQ A;  5FE0 A;  5LJ0 A;  3Q2F A;  5F62 A;  5HEN A;  5CUA A;  5DX4 A;  4QEV A;  4KCX A;  4A9E A;  5HRV A;  5II2 A;  3JVJ A;  5I7Y A;  5EU1 A;  5I83 A;  2LSP B;  4J1P A;  4N4G A;  2YDW A;  2L85 A;  3O35 A;  2R0V A;  4O70 A;  5A83 A;  4UIX A;  4WHW A;  2KTB B;  4NXJ A;  4IOQ A;  5ENI A;  2DAT A;  3S91 A;  4N4F A;  5C89 A;  1JM4 B;  3O37 A;  5EWV A;  5F36 A;  4TQN A;  5EPR A;  1E6I A;  4UYE A;  4Z6I A;  5HLS A;  5TB6 A;  4CUQ A;  5HQ6 A;  3JVL A;  4XUA A;  4HXS A;  5CY9 A;  2L84 A;  5E9V A;  5FG6 A;  5IG6 A;  5CQT A;  5EIS A;  3UW9 A;  4X2I A;  3FKM X;  4HBY A;  3GG3 A;  4HBW A;  5EM3 A;  5CFW A;  3S92 A;  4TU4 A;  5DLX A;  5FE1 A;  5A5N A;  5CQA A;  5G4R A;  4C66 A;  3LJW A;  4BJX A;  5D3J A;  4BW3 A;  5K29 A;  4ZQL A;  4QSV A;  4NR7 A;  5C7N A;  2YEK A;  4QST A;  5LJ1 A;  5D26 A;  5KO4 A;  5FE7 A;  5DFD A;  5HRX A;  5CRM A;  5CPE A;  3TLP A;  5ENB A;  4Z93 A;  2RNW A;  4UYG A;  2DKW A;  4ZC9 A;  5HFQ A;  4CUP A;  4AI6 A;  3U5N A;  5FBX A;  3UV2 A;  5ENC A;  5CUG A;  1F68 A;  3QZV A;  5F63 A;  5CQ6 A;  5LJ2 A;  3SVH A;  4NYX A;  5II1 A;  5H1T A;  5A81 A;  4YAT A;  3P1D A;  4J0S A;  5D25 A;  5D7X A;  3U5O A;  3D1B A;  3K2J A;  5A5Q A;  5DYC A;  1N72 A;  4HBX A;  4YK0 A;  3ERR A;  5E9K A;  4AKN A;  2E7O A;  4MR5 A;  5DYX A;  4NUD A;  4YYG A;  4MEO A;  4C67 A;  5BT3 A;  3LQJ A;  4N4H A;  4UYF A;  3UVD A;  4NR5 A;  4YYI A;  4MEQ A;  4UIZ A;  2R0Y A;  3MUL A;  4IR3 A;  5I1Q A;  4IR6 A;  2WP2 A;  4QSX A;  5DYU A;  4A9I A;  5C87 A;  2YW5 A;  2D82 A;  5HCL A;  3UVX A;  5FE2 A;  4PKL A;  3VKG A;  4NYV A;  4NUC A;  5CQ3 A;  4XUB A;  2RS9 B;  4QSW A;  4QSR A;  4YAD A;  5L98 A;  3ONI A;  5FH8 A;  4QR4 A;  4E96 A;  5F3A A;  5CQ8 A;  3NXB A;  4KV1 A;  5HEM A;  4YH3 A;  3D1D A;  5IGM A;  5L97 A;  4O76 A;  5AD3 A;  3P1E A;  4BW4 A;  4OGJ A;  3P5O A;  4NS5 A;  4ALH A;  2YEL A;  4UIY A;  5D3T A;  5C85 A;  4QR5 A;  4AKI A;  2EJN A;  3G0J A;  2DWW A;  3HMF A;  3O34 A;  4UIU A;  5FE9 A;  5F1H A;  4A9O A;  5ENG A;  4CUT A;  2YYN A;  2N9G A;  4MEN A;  5HEL A;  4LR6 A;  4NQN A;  5H85 A;  5EQ1 A;  3U5M A;  3LXJ A;  5EPS A;  4HXR A;  2NXB A;  2RNY A;  4Q0O A;  4LZ2 A;  2D9E A;  5E9I A;  3SVG A;  4QNS A;  4N3W A;  3G0L A;  2DVS A;  1WUM A;  4LYI A;  5D3S A;  5CTL A;  2RFJ A;  5HRW A;  2OSS A;  4IR4 A;  5CQ4 A;  4A9J A;  4YAX A;  1PUO A;  4YYH A;  5I86 A;  3U5J A;  5EWC A;  5E74 A;  4HXN A;  5F61 A;  4PCI A;  4QSP A;  4BW2 A;  2RNX A;  5LKZ A;  5H1U A;  5BT5 A;  5C8G A;  5FE8 A;  5I89 A;  4QYD A;  5L8U A;  3LQH A;  5EWW A;  4TT2 A;  5HJC A;  4YBT A;  5F60 A;  4O7F A;  4MR6 A;  3O33 A;  4UYF B;  3DAI A;  5AME A;  2RO1 A;  2R0S A;  4HBV A;  4TU6 A;  4CUS A;  5FFW A;  4UIW A;  5FB0 A;  5DYA A;  2OO1 A;  4XY8 A;  3RCW A;  5FE3 A;  4QR3 A;  3AQA A;  4UIT A;  2DVV A;  4TZ2 A;  3UVY A;  4GPJ A;  4Z1Q A;  2I7K A;  4O7E A;  2I8N A;  3JVK A;  5D3N A;  4QBM A;  5DKC A;  5DY7 A;  4WHU A;  4O75 A;  3SVF A;  5CUD A;  4YBS A;  4NRA A;  3LQI A;  4LZR A;  5H1V A;  4ZW1 A;  2YQD A;  4YY4 A;  5E9L A;  4QEW A;  3Q2E A;  4IOR A;  4OUF A;  1EQF A;  4O74 A;  5CQ5 A;  4CLB A;  5FFV A;  3VKH A;  5FE6 A;  4LDF A;  5KHM A;  1X0J A;  3MQM A;  2F6N A;  3IU6 A;  5HQ7 A;  4TTE A;  4Y03 A;  4PS5 A;  5I80 A;  4AKH A;  4UYD A;  3QZT A;  5COI A;  5G4S A;  5I29 A;  5A5O A;  4HXO A;  5KTU A;  4O72 A;  5IGN A;  5HM0 A;  4HXM A;  4N4I A;  5TCM A;  5A5R A;  2DVQ A;  4O7B A;  5EWH A;  5AD2 A;  5C4Q A;  5ENH A;  4YBM A;  5DW2 A;  5DLZ A;  3MB4 A;  3IU5 A;  5D0C A;  4BHW A;  3UV4 A;  5CU8 A;  4NRC A;  2WP1 A;  1ZS5 A;  5FDZ A;  4QSS A;  4NYW A;  3JVM A;  5CRZ A;  4Q0N A;  4LYS A;  5IBN A;  5A5P A;  2E7N A;  3D7C A;  5FB1 A;  1JSP B;  5D3P A;  4CFL A;  5J0D A;  5E3G A;  5EVA A;  4PY6 A;  3AAD A;  4BW1 A;  4QY4 A;  3P1C A;  5ENF A;  4A9H A;  4Z1S A;  5KTX A;  2RI7 A;  4WIV A;  4O77 A;  4IOO A;  4PTB A;  5L96 A;  5ENJ A;  4ALG A;  4QYL A;  3ZYU A;  4A9N A;  4OGI A;  4YH4 A;  5E73 A;  1ZKR A;  4XYA A;  4YYK A;  4CL9 A;  4UIV A;  4CFK A;  5DW1 A;  5F5Z A;  1WUG A;  4O7C A;  5D3L A;  3O36 A;  4MEP A;  5EP7 A;  4Z6H A;  5E9M A;  4UYH A;  4A9K A;  4QZS A;  4HXP A;  5BT4 A;  5ACY A;  5IGK A;  4DON A;  5CUC A;  5FG5 A;  4YY6 A;  2R10 A;  5CS8 A;  5D24 A;  5E0R A;  4NQM A;  5D3R A;  5DKH A;  5I7X A;  4A9M A;  5F2P A;  3MUK A;  4O7A A;  5CZG A;  4QC1 A;  5F25 A;  5LKU A;  5FH7 A;  2YEM A;  4QSU A;  5FH6 A;  3HMH A;  2H60 A;  2L5E A;  2G4A A;  5ETB A;  3DWY A;  3U5L A;  4LC2 A;  5CQ7 A;  5ENE A;  5A82 A;  4QB3 A;  5ETD A;  5HQ5 A;  5LUU A;  4KV4 A;  4YYN A;  4AKG A;  5A85 A;  5CP5 A;  5JI8 A;  2MJV B;  4F3I A;  5E3D A;  5KU3 A;  5DFC A;  4J3I A;  3P1F A;  5KTW A;  5FG4 A;  4A9F A;  5A7C A;  4MR3 A;  2GRC A;  4TT6 A;  5F1L A;  4NR8 A; 
#chains in the Genus database with same CATH homology
 4TS8 A;  4O71 A;  4QSQ A;  5EI4 A;  5LKT A;  2OUO A;  4NR4 A;  3QZS A;  4XY9 A;  4YC9 A;  5EV9 A;  4A9L A;  4YAB A;  4TYL A;  5E9Y A;  4RVR A;  4NRB A;  5DBM A;  4CUR A;  5D3H A;  4LRG A;  3UVW A;  4LYW A;  3U5P A;  4FLP A;  2FSA A;  4PCE A;  4NUE A;  5CUB A;  4YYJ A;  5IGL A;  5EGU A;  5L8T A;  5E7D A;  4CUU A;  2DVR A;  4QUT A;  3MB3 A;  4NR9 A;  5DKD A;  4TZ8 A;  4QC3 A;  3MXF A;  4YYM A;  4J0R A;  5EK9 A;  5CUE A;  4MR4 A;  4HXL A;  5FE4 A;  4IR5 A;  5JWM A;  4TT4 A;  5AMF A;  5FFY A;  5HFR A;  4LZS A;  4HXK A;  3HME A;  5I88 A;  3UV5 A;  2F6J A;  5CGP A;  4QEU A;  5I40 A;  5EA1 A;  3U5K A;  5FE5 A;  4NR6 A;  5EWD A;  4O78 A;  4YYD A;  5EPB A;  5L99 A;  5DFB A;  5LVR A;  5EIC A;  2E3K A;  5A5S A;  5LKX A;  3I3J A;  5IID A;  4QUU A;  5LVQ A;  5FE0 A;  5LJ0 A;  3Q2F A;  5F62 A;  5HEN A;  5CUA A;  5DX4 A;  4QEV A;  4KCX A;  4A9E A;  5HRV A;  5II2 A;  3JVJ A;  5I7Y A;  5EU1 A;  5I83 A;  2LSP B;  4J1P A;  4N4G A;  2YDW A;  2L85 A;  3O35 A;  2R0V A;  4O70 A;  5A83 A;  4UIX A;  4WHW A;  2KTB B;  4NXJ A;  4IOQ A;  5ENI A;  2DAT A;  3S91 A;  4N4F A;  5C89 A;  1JM4 B;  3O37 A;  5EWV A;  5F36 A;  4TQN A;  5EPR A;  1E6I A;  4UYE A;  4Z6I A;  5HLS A;  5TB6 A;  4CUQ A;  5HQ6 A;  3JVL A;  4XUA A;  4HXS A;  5CY9 A;  2L84 A;  5E9V A;  5FG6 A;  5IG6 A;  5CQT A;  5EIS A;  3UW9 A;  4X2I A;  3FKM X;  4HBY A;  3GG3 A;  4HBW A;  5EM3 A;  5CFW A;  3S92 A;  4TU4 A;  5DLX A;  5FE1 A;  5A5N A;  5CQA A;  5G4R A;  4C66 A;  3LJW A;  4BJX A;  5D3J A;  4BW3 A;  5K29 A;  4ZQL A;  4QSV A;  4NR7 A;  5C7N A;  2YEK A;  4QST A;  5LJ1 A;  5D26 A;  5KO4 A;  5FE7 A;  5DFD A;  5HRX A;  5CRM A;  5CPE A;  3TLP A;  5ENB A;  4Z93 A;  2RNW A;  4UYG A;  2DKW A;  4ZC9 A;  5HFQ A;  4CUP A;  3U5N A;  5FBX A;  3UV2 A;  5ENC A;  5CUG A;  1F68 A;  3QZV A;  5F63 A;  5CQ6 A;  5LJ2 A;  3SVH A;  4NYX A;  5II1 A;  5H1T A;  5A81 A;  4YAT A;  3P1D A;  4J0S A;  5D25 A;  5D7X A;  3U5O A;  3K2J A;  5A5Q A;  5DYC A;  1N72 A;  4HBX A;  4YK0 A;  5E9K A;  4AKN A;  2E7O A;  4MR5 A;  5DYX A;  4NUD A;  4YYG A;  4MEO A;  4C67 A;  5BT3 A;  3LQJ A;  4N4H A;  4UYF A;  3UVD A;  4NR5 A;  4YYI A;  4MEQ A;  4UIZ A;  2R0Y A;  3MUL A;  4IR3 A;  5I1Q A;  4IR6 A;  2WP2 A;  4QSX A;  5DYU A;  4A9I A;  5C87 A;  2YW5 A;  2D82 A;  5HCL A;  3UVX A;  5FE2 A;  4PKL A;  4NYV A;  4NUC A;  5CQ3 A;  4XUB A;  2RS9 B;  4QSW A;  4QSR A;  4YAD A;  5L98 A;  3ONI A;  5FH8 A;  4QR4 A;  4E96 A;  5F3A A;  5CQ8 A;  3NXB A;  4KV1 A;  5HEM A;  4YH3 A;  5IGM A;  5L97 A;  4O76 A;  5AD3 A;  3P1E A;  4BW4 A;  4OGJ A;  3P5O A;  4NS5 A;  4ALH A;  2YEL A;  4UIY A;  5D3T A;  5C85 A;  4QR5 A;  3G0J A;  2DWW A;  3HMF A;  3O34 A;  4UIU A;  5FE9 A;  5F1H A;  4A9O A;  5ENG A;  4CUT A;  2YYN A;  2N9G A;  4MEN A;  5HEL A;  4LR6 A;  4NQN A;  5H85 A;  5EQ1 A;  3U5M A;  3LXJ A;  5EPS A;  4HXR A;  2NXB A;  2RNY A;  4Q0O A;  4LZ2 A;  2D9E A;  5E9I A;  3SVG A;  4QNS A;  4N3W A;  3G0L A;  2DVS A;  1WUM A;  4LYI A;  5D3S A;  5CTL A;  2RFJ A;  5HRW A;  2OSS A;  4IR4 A;  5CQ4 A;  4A9J A;  4YAX A;  4YYH A;  5I86 A;  3U5J A;  5EWC A;  5E74 A;  4HXN A;  5F61 A;  4PCI A;  4QSP A;  4BW2 A;  2RNX A;  5LKZ A;  5H1U A;  5BT5 A;  5C8G A;  5FE8 A;  5I89 A;  4QYD A;  5L8U A;  3LQH A;  5EWW A;  4TT2 A;  5HJC A;  4YBT A;  5F60 A;  4O7F A;  4MR6 A;  3O33 A;  4UYF B;  3DAI A;  5AME A;  2RO1 A;  2R0S A;  4HBV A;  4TU6 A;  4CUS A;  5FFW A;  4UIW A;  5FB0 A;  5DYA A;  2OO1 A;  4XY8 A;  3RCW A;  5FE3 A;  4QR3 A;  3AQA A;  4UIT A;  2DVV A;  4TZ2 A;  3UVY A;  4GPJ A;  4Z1Q A;  2I7K A;  4O7E A;  2I8N A;  3JVK A;  5D3N A;  4QBM A;  5DKC A;  5DY7 A;  4WHU A;  4O75 A;  3SVF A;  5CUD A;  4YBS A;  4NRA A;  3LQI A;  4LZR A;  5H1V A;  4ZW1 A;  2YQD A;  4YY4 A;  5E9L A;  4QEW A;  3Q2E A;  4IOR A;  4OUF A;  1EQF A;  4O74 A;  5CQ5 A;  4CLB A;  5FFV A;  5FE6 A;  4LDF A;  5KHM A;  1X0J A;  3MQM A;  2F6N A;  3IU6 A;  5HQ7 A;  4TTE A;  4Y03 A;  4PS5 A;  5I80 A;  4UYD A;  3QZT A;  5COI A;  5G4S A;  5I29 A;  5A5O A;  4HXO A;  5KTU A;  4O72 A;  5IGN A;  5HM0 A;  4HXM A;  4N4I A;  5TCM A;  5A5R A;  2DVQ A;  4O7B A;  5EWH A;  5AD2 A;  5C4Q A;  5ENH A;  4YBM A;  5DW2 A;  5DLZ A;  3MB4 A;  3IU5 A;  5D0C A;  4BHW A;  3UV4 A;  5CU8 A;  4NRC A;  2WP1 A;  1ZS5 A;  5FDZ A;  4QSS A;  4NYW A;  3JVM A;  5CRZ A;  4Q0N A;  4LYS A;  5IBN A;  5A5P A;  2E7N A;  3D7C A;  5FB1 A;  1JSP B;  5D3P A;  4CFL A;  5J0D A;  5E3G A;  5EVA A;  4PY6 A;  3AAD A;  4BW1 A;  4QY4 A;  3P1C A;  5ENF A;  4A9H A;  4Z1S A;  5KTX A;  2RI7 A;  4WIV A;  4O77 A;  4IOO A;  4PTB A;  5L96 A;  5ENJ A;  4ALG A;  4QYL A;  3ZYU A;  4A9N A;  4OGI A;  4YH4 A;  5E73 A;  4XYA A;  4YYK A;  4CL9 A;  4UIV A;  4CFK A;  5DW1 A;  5F5Z A;  1WUG A;  4O7C A;  5D3L A;  3O36 A;  4MEP A;  5EP7 A;  4Z6H A;  5E9M A;  4UYH A;  4A9K A;  4QZS A;  4HXP A;  5BT4 A;  5ACY A;  5IGK A;  4DON A;  5CUC A;  5FG5 A;  4YY6 A;  2R10 A;  5CS8 A;  5D24 A;  5E0R A;  4NQM A;  5D3R A;  5DKH A;  5I7X A;  4A9M A;  5F2P A;  3MUK A;  4O7A A;  5CZG A;  4QC1 A;  5F25 A;  5LKU A;  5FH7 A;  2YEM A;  4QSU A;  5FH6 A;  3HMH A;  2H60 A;  2L5E A;  2G4A A;  5ETB A;  3DWY A;  3U5L A;  4LC2 A;  5CQ7 A;  5ENE A;  5A82 A;  4QB3 A;  5ETD A;  5HQ5 A;  5LUU A;  4KV4 A;  4YYN A;  5A85 A;  5CP5 A;  5JI8 A;  2MJV B;  4F3I A;  5E3D A;  5KU3 A;  5DFC A;  4J3I A;  3P1F A;  5KTW A;  5FG4 A;  4A9F A;  5A7C A;  4MR3 A;  2GRC A;  4TT6 A;  5F1L A;  4NR8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...