5FFWA

Crystal structure of the bromodomain of human brpf1 in complex with h4k5ack8ac histone peptide
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
110
structure length
110
Chain Sequence
LTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Peregrin
publication title Crystal structure of the bromodomain of human BRPF1 in complex with H4K5acK8ac histone peptide
rcsb
source organism Homo sapiens
total genus 38
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5ffwA00
3FKMX 2WP1A 2YW5A 3MB3A 4IR6A 5KTWA 4HXLA 4YC9A 4BJXA 4PCEA 4AKNA 5I7XA 4MR3A 5FBXA 4N4FA 5KTUA 4Q0NA 5FG4A 1JSPB 4QC3A 5HJCA 5L99A 5I86A 5DW2A 4IOOA 3SVHA 3DAIA 5LJ2A 4KV1A 4OGIA 5I29A 4LYIA 5KU3A 4A9OA 4O7BA 4A9HA 3AADA 4O7CA 4NQNA 5FE0A 5CQTA 5CQ6A 5ENBA 5E9MA 5LKZA 4O75A 5L96A 1F68A 5CU8A 3U5NA 4QB3A 4TTEA 4PY6A 5EISA 4YADA 4BHWA 2DVQA 4YBTA 5DBMA 2YELA 5EK9A 5LVRA 2GRCA 4WIVA 4LZSA 5CRZA 5AMFA 5FE9A 4HXRA 4OUFA 2L5EA 5D3HA 5CRMA 5FB1A 5HENA 5FH7A 3UV4A 4MEQA 4UYEA 5DKDA 4ZW1A 4HXNA 3U5KA 4LZRA 5A5QA 5DKCA 5H85A 4A9EA 1E6IA 5EVAA 4Z93A 4E96A 3LJWA 4YYNA 5C87A 5FE7A 5A82A 3IU6A 4CFKA 5EU1A 4MEOA 4J0SA 5BT3A 4Z6HA 5A5OA 5F61A 5BT5A 5LJ0A 2DATA 4NRAA 5ACYA 3P1CA 2DVVA 5CUAA 4ZC9A 5A5RA 5TCMA 5L8TA 2DKWA 5I88A 5FH6A 4NYXA 2E3KA 2RI7A 4QSUA 2OUOA 4YY4A 4QSTA 5I83A 3AQAA 5EPSA 5ENIA 3Q2FA 4PCIA 5DYXA 4YK0A 4FLPA 5LVQA 3O35A 2FSAA 4TU4A 4J0RA 4QEWA 5HFQA 5II2A 4Z1SA 5KO4A 3LQIA 2L84A 4LC2A 4YYHA 5L97A 5D0CA 5LUUA 5LJ1A 2OO1A 5IGNA 5HQ5A 3QZTA 5CQ3A 2R10A 4IORA 5DFCA 5E9YA 5F1LA 5HEMA 5G4SA 1X0JA 3HMEA 5F60A 5IGLA 4XYAA 4QUTA 4TZ2A 4J3IA 5FE5A 3ZYUA 5FE8A 4CUPA 2G4AA 5CQAA 2F6NA 5EI4A 4Z6IA 3U5PA 5D3RA 3UV5A 4CUUA 3MQMA 4QSXA 4TT2A 5J0DA 3IU5A 4TQNA 5CUGA 2LSPB 4IR3A 4NYVA 4QYDA 3G0LA 4F3IA 3SVFA 4UYHA 2I8NA 4TS8A 4XUBA 5F63A 5CS8A 5E3GA 4UIWA 4QSQA 4O72A 4YYIA 2L85A 5EPRA 4QZSA 4A9NA 2YDWA 4Z1QA 5FB0A 2RNWA 5A83A 4OGJA 2N9GA 5COIA 4HXKA 5EGUA 3S92A 3G0JA 3JVJA 4CFLA 4UYFA 4O77A 3I3JA 4O70A 5E0RA 4KV4A 4XUAA 4J1PA 4NR5A 4QNSA 5DW1A 5DYAA 4QR4A 5FG5A 2YEMA 5F62A 3MB4A 3MUKA 4QSPA 4NRCA 4MR5A 5K29A 4YYKA 4NUEA 3U5OA 3UW9A 5C89A 5CFWA 4QR3A 5LKTA 5FE2A 5ENFA 5CPEA 3GG3A 5EPBA 3UV2A 5E73A 5F36A 4A9MA 5CQ5A 4XY8A 3TLPA 4XY9A 5HLSA 5E74A 5F25A 4IR5A 2NXBA 5FE6A 5DLZA 5CGPA 5D26A 5I1QA 5DY7A 4HBVA 4QEUA 5LKXA 5FFYA 2RS9B 3O36A 5IIDA 5C85A 4NUCA 5HQ6A 4NR8A 5ETBA 4NR4A 4N4IA 1WUGA 4YY6A 5CTLA 4NRBA 5EWCA 4HBXA 4QSVA 4YYGA 4ZQLA 3LQJA 4MENA 2H60A 5HRWA 4A9IA 4TZ8A 5EWHA 5JI8A 5KTXA 3O34A 4NR6A 4BW3A 5D3TA 4N4HA 5ENCA 2I7KA 4LDFA 4QSRA 4WHUA 3MULA 4A9KA 4ALGA 5G4RA 5AMEA 5FFWA 4CUSA 5HRVA 4Q0OA 3Q2EA 2DWWA 5EP7A 5CUDA 5CUCA 4HXPA 3JVLA 4YYJA 5FFVA 5EV9A 5A5SA 4QBMA 5D25A 5A85A 3D7CA 2DVRA 4LRGA 4LR6A 4UIZA 4NS5A 3HMHA 5E7DA 3UVYA 5HM0A 4QY4A 4WHWA 5CY9A 2YYNA 5EICA 3U5LA 4HBYA 4O7EA 3LXJA 4UYDA 5EWWA 5CUBA 4X2IA 4C67A 5CUEA 5L98A 3P1EA 5E3DA 3U5MA 5F5ZA 4O76A 2RNXA 4TT4A 4YH3A 5D7XA 3S91A 5A7CA 2R0SA 5A81A 2F6JA 4HXMA 4LYSA 5H1TA 4YBMA 5CP5A 4YATA 4C66A 4UIXA 5ENGA 2R0VA 4IOQA 5CQ4A 5ENJA 2DVSA 4O74A 5KHMA 4TT6A 4UYFB 5F1HA 5E9KA 3LQHA 5H1VA 5C4QA 4N4GA 4YAXA 5FE3A 4CUTA 4BW2A 4MR6A 4RVRA 5F3AA 5DKHA 5HELA 4IR4A 5I7YA 5II1A 1N72A 3DWYA 5I40A 3UVWA 4YYDA 5DYCA 5FG6A 4CL9A 4CURA 4PS5A 5EWDA 3U5JA 4UYGA 5CZGA 2RFJA 4PKLA 5D3JA 3P1FA 5IG6A 4YH4A 5D3SA 4UIYA 5FE4A 5CQ7A 4CUQA 5E9LA 5AD3A 2D82A 4QR5A 3SVGA 5TB6A 3QZVA 5EM3A 4YBSA 3NXBA 5EA1A 4TU6A 4ALHA 1JM4B 5E9IA 3QZSA 5ENEA 5L8UA 3MXFA 4NR9A 5BT4A 2MJVB 2E7NA 4UIUA 5DLXA 4NQMA 5EWVA 4N3WA 4TYLA 4Y03A 1WUMA 4O71A 4NXJA 4UIVA 4A9LA 4YABA 4BW4A 5D3NA 5H1UA 2E7OA 3RCWA 5E9VA 4O7AA 5EQ1A 2WP2A 5AD2A 5HRXA 2KTBB 5ETDA 2R0YA 3ONIA 5I80A 5F2PA 3HMFA 4GPJA 5C7NA 3UVXA 5LKUA 4HXOA 2RNYA 2YQDA 4MR4A 4QSWA 5HCLA 4QUUA 5HQ7A 4NR7A 5DFDA 3UVDA 5DFBA 5DYUA 1ZS5A 5D3PA 5HFRA 5JWMA 4HBWA 4O78A 4DONA 2OSSA 4QC1A 4LZ2A 4NYWA 5D3LA 5FE1A 3P5OA 4UITA 4QYLA 5A5NA 2RO1A 3O33A 4KCXA 5ENHA 4A9JA 5IBNA 4PTBA 5DX4A 4CLBA 2YEKA 5CQ8A 4O7FA 4MEPA 5A5PA 3O37A 4YYMA 4A9FA 2D9EA 5I89A 4HXSA 5IGKA 4NUDA 4BW1A 4LYWA 1EQFA 5FH8A 4QSSA 3JVMA 3JVKA 5D24A 5FDZA 3P1DA 5C8GA 5IGMA 4QEVA 3K2JA
chains in the Genus database with same CATH superfamily
3FKMX 2WP1A 2YW5A 3MB3A 4IR6A 5KTWA 4AKIA 4HXLA 4YC9A 4BJXA 4PCEA 4AKNA 5I7XA 4MR3A 5FBXA 4N4FA 5KTUA 4Q0NA 5FG4A 1JSPB 4QC3A 5HJCA 5L99A 5I86A 5DW2A 4IOOA 3SVHA 3DAIA 5LJ2A 4KV1A 4OGIA 5I29A 4LYIA 5KU3A 4A9OA 4O7BA 4A9HA 3AADA 4O7CA 4NQNA 5FE0A 5CQTA 5CQ6A 5ENBA 5E9MA 5LKZA 4O75A 5L96A 1F68A 5CU8A 3U5NA 4QB3A 4TTEA 4PY6A 5EISA 4YADA 4BHWA 2DVQA 4YBTA 5DBMA 2YELA 5EK9A 5LVRA 2GRCA 4WIVA 4LZSA 5CRZA 5AMFA 5FE9A 4HXRA 4OUFA 2L5EA 5D3HA 5CRMA 5FB1A 5HENA 4AKGA 5FH7A 3UV4A 4MEQA 4UYEA 5DKDA 4ZW1A 4HXNA 3U5KA 4LZRA 5A5QA 5DKCA 5H85A 4A9EA 1E6IA 5EVAA 4Z93A 4E96A 3LJWA 4YYNA 5C87A 5FE7A 5A82A 3IU6A 4CFKA 5EU1A 4MEOA 4J0SA 5BT3A 4Z6HA 5A5OA 5F61A 5BT5A 5LJ0A 2DATA 1ZKRA 4NRAA 5ACYA 3P1CA 2DVVA 5CUAA 4ZC9A 5A5RA 5TCMA 5L8TA 2DKWA 4AI6A 5I88A 5FH6A 4NYXA 2E3KA 2RI7A 4QSUA 2OUOA 4YY4A 4QSTA 5I83A 3AQAA 5EPSA 5ENIA 3Q2FA 4PCIA 5DYXA 4YK0A 4FLPA 5LVQA 3O35A 2FSAA 4TU4A 4J0RA 4QEWA 5HFQA 5II2A 4Z1SA 5KO4A 3LQIA 2L84A 4LC2A 4YYHA 5L97A 5D0CA 5LUUA 5LJ1A 2OO1A 5IGNA 5HQ5A 3QZTA 5CQ3A 2R10A 4IORA 5DFCA 5E9YA 5F1LA 5HEMA 5G4SA 1X0JA 3HMEA 5F60A 5IGLA 4XYAA 4QUTA 4TZ2A 4J3IA 5FE5A 3ZYUA 5FE8A 4CUPA 2G4AA 5CQAA 2F6NA 5EI4A 4Z6IA 3U5PA 5D3RA 3UV5A 4CUUA 2EJNA 3MQMA 4QSXA 4TT2A 5J0DA 3IU5A 4TQNA 5CUGA 2LSPB 4IR3A 4NYVA 4QYDA 3G0LA 4F3IA 3SVFA 4UYHA 2I8NA 4TS8A 4XUBA 5F63A 5CS8A 5E3GA 4UIWA 4QSQA 4O72A 4YYIA 2L85A 5EPRA 4QZSA 4A9NA 2YDWA 4Z1QA 5FB0A 2RNWA 5A83A 4OGJA 2N9GA 5COIA 4HXKA 5EGUA 3S92A 3G0JA 3JVJA 4CFLA 4UYFA 4O77A 3I3JA 4O70A 5E0RA 4KV4A 4XUAA 4J1PA 4NR5A 4QNSA 5DW1A 5DYAA 4QR4A 5FG5A 2YEMA 5F62A 3MB4A 3MUKA 4QSPA 4NRCA 4MR5A 5K29A 4YYKA 4NUEA 3U5OA 3UW9A 5C89A 5CFWA 4QR3A 5LKTA 5FE2A 5ENFA 5CPEA 3GG3A 5EPBA 3UV2A 5E73A 5F36A 4A9MA 5CQ5A 4XY8A 3TLPA 4XY9A 5HLSA 5E74A 5F25A 4IR5A 2NXBA 5FE6A 5DLZA 5CGPA 5D26A 5I1QA 5DY7A 4HBVA 4QEUA 5LKXA 5FFYA 2RS9B 3O36A 5IIDA 5C85A 4NUCA 5HQ6A 4NR8A 5ETBA 4NR4A 4N4IA 1WUGA 4YY6A 5CTLA 4NRBA 3D1DA 5EWCA 4HBXA 4QSVA 4YYGA 4ZQLA 3LQJA 4MENA 2H60A 5HRWA 3D1BA 4A9IA 4TZ8A 5EWHA 5JI8A 5KTXA 3O34A 4NR6A 4BW3A 5D3TA 4N4HA 5ENCA 2I7KA 4LDFA 4QSRA 4WHUA 3MULA 4A9KA 4ALGA 5G4RA 5AMEA 5FFWA 4CUSA 5HRVA 4Q0OA 3Q2EA 2DWWA 5EP7A 5CUDA 5CUCA 4HXPA 3JVLA 4YYJA 5FFVA 5EV9A 5A5SA 4QBMA 5D25A 5A85A 3D7CA 2DVRA 4LRGA 4LR6A 4UIZA 4NS5A 3HMHA 5E7DA 3UVYA 5HM0A 4QY4A 4WHWA 5CY9A 2YYNA 1PUOA 5EICA 3U5LA 4HBYA 4O7EA 3LXJA 4UYDA 5EWWA 5CUBA 4X2IA 4C67A 5CUEA 5L98A 3P1EA 5E3DA 3U5MA 5F5ZA 4O76A 2RNXA 4TT4A 4YH3A 5D7XA 3S91A 5A7CA 2R0SA 5A81A 2F6JA 4HXMA 4LYSA 5H1TA 4YBMA 5CP5A 4YATA 4C66A 4UIXA 5ENGA 2R0VA 4IOQA 5CQ4A 5ENJA 2DVSA 4O74A 5KHMA 4TT6A 4UYFB 5F1HA 5E9KA 3LQHA 5H1VA 5C4QA 4N4GA 4YAXA 5FE3A 4CUTA 4BW2A 4MR6A 4RVRA 5F3AA 5DKHA 5HELA 4IR4A 5I7YA 5II1A 1N72A 4AKHA 3DWYA 5I40A 3UVWA 4YYDA 5DYCA 5FG6A 4CL9A 4CURA 4PS5A 5EWDA 3U5JA 4UYGA 5CZGA 2RFJA 4PKLA 5D3JA 3P1FA 5IG6A 4YH4A 3VKGA 5D3SA 4UIYA 5FE4A 5CQ7A 4CUQA 5E9LA 5AD3A 2D82A 4QR5A 3SVGA 5TB6A 3QZVA 5EM3A 4YBSA 3NXBA 5EA1A 4TU6A 4ALHA 1JM4B 5E9IA 3QZSA 5ENEA 5L8UA 3MXFA 4NR9A 5BT4A 2MJVB 2E7NA 4UIUA 5DLXA 4NQMA 5EWVA 4N3WA 4TYLA 4Y03A 1WUMA 4O71A 4NXJA 4UIVA 4A9LA 4YABA 4BW4A 5D3NA 5H1UA 2E7OA 3RCWA 5E9VA 4O7AA 5EQ1A 2WP2A 5AD2A 5HRXA 2KTBB 5ETDA 2R0YA 3ONIA 5I80A 5F2PA 3HMFA 4GPJA 5C7NA 3UVXA 5LKUA 4HXOA 2RNYA 2YQDA 4MR4A 4QSWA 5HCLA 4QUUA 5HQ7A 4NR7A 5DFDA 3UVDA 5DFBA 5DYUA 1ZS5A 5D3PA 5HFRA 5JWMA 4HBWA 4O78A 4DONA 3VKHA 2OSSA 4QC1A 4LZ2A 4NYWA 5D3LA 5FE1A 3P5OA 4UITA 4QYLA 5A5NA 2RO1A 3O33A 4KCXA 5ENHA 4A9JA 5IBNA 4PTBA 5DX4A 4CLBA 2YEKA 5CQ8A 4O7FA 4MEPA 5A5PA 3O37A 4YYMA 4A9FA 2D9EA 5I89A 4HXSA 5IGKA 4NUDA 4BW1A 4LYWA 1EQFA 3ERRA 5FH8A 4QSSA 3JVMA 3JVKA 5D24A 5FDZA 3P1DA 5C8GA 5IGMA 4QEVA 3K2JA
chains in the Genus database with same CATH topology
3FKMX 2WP1A 2YW5A 3MB3A 4IR6A 5KTWA 4HXLA 4YC9A 4BJXA 4PCEA 4AKNA 5I7XA 4MR3A 5FBXA 4N4FA 5KTUA 4Q0NA 5FG4A 1JSPB 4QC3A 5HJCA 5L99A 5I86A 5DW2A 4IOOA 3SVHA 3DAIA 5LJ2A 4KV1A 4OGIA 5I29A 4LYIA 5KU3A 4A9OA 4O7BA 4A9HA 3AADA 4O7CA 4NQNA 5FE0A 5CQTA 5CQ6A 5ENBA 5E9MA 5LKZA 4O75A 5L96A 1F68A 5CU8A 3U5NA 4QB3A 4TTEA 4PY6A 5EISA 4YADA 4BHWA 2DVQA 4YBTA 5DBMA 2YELA 5EK9A 5LVRA 2GRCA 4WIVA 4LZSA 5CRZA 5AMFA 5FE9A 4HXRA 4OUFA 2L5EA 5D3HA 5CRMA 5FB1A 5HENA 5FH7A 3UV4A 4MEQA 4UYEA 5DKDA 4ZW1A 4HXNA 3U5KA 4LZRA 5A5QA 5DKCA 5H85A 4A9EA 1E6IA 5EVAA 4Z93A 4E96A 3LJWA 4YYNA 5C87A 5FE7A 5A82A 3IU6A 4CFKA 5EU1A 4MEOA 4J0SA 5BT3A 4Z6HA 5A5OA 5F61A 5BT5A 5LJ0A 2DATA 4NRAA 5ACYA 3P1CA 2DVVA 5CUAA 4ZC9A 5A5RA 5TCMA 5L8TA 2DKWA 5I88A 5FH6A 4NYXA 2E3KA 2RI7A 4QSUA 2OUOA 4YY4A 4QSTA 5I83A 3AQAA 5EPSA 5ENIA 3Q2FA 4PCIA 5DYXA 4YK0A 4FLPA 5LVQA 3O35A 2FSAA 4TU4A 4J0RA 4QEWA 5HFQA 5II2A 4Z1SA 5KO4A 3LQIA 2L84A 4LC2A 4YYHA 5L97A 5D0CA 5LUUA 5LJ1A 2OO1A 5IGNA 5HQ5A 3QZTA 5CQ3A 2R10A 4IORA 5DFCA 5E9YA 5F1LA 5HEMA 5G4SA 1X0JA 3HMEA 5F60A 5IGLA 4XYAA 4QUTA 4TZ2A 4J3IA 5FE5A 3ZYUA 5FE8A 4CUPA 2G4AA 5CQAA 2F6NA 5EI4A 4Z6IA 3U5PA 5D3RA 3UV5A 4CUUA 3MQMA 4QSXA 4TT2A 5J0DA 3IU5A 4TQNA 5CUGA 2LSPB 4IR3A 4NYVA 4QYDA 3G0LA 4F3IA 3SVFA 4UYHA 2I8NA 4TS8A 4XUBA 5F63A 5CS8A 5E3GA 4UIWA 4QSQA 4O72A 4YYIA 2L85A 5EPRA 4QZSA 4A9NA 2YDWA 4Z1QA 5FB0A 2RNWA 5A83A 4OGJA 2N9GA 5COIA 4HXKA 5EGUA 3S92A 3G0JA 3JVJA 4CFLA 4UYFA 4O77A 3I3JA 4O70A 5E0RA 4KV4A 4XUAA 4J1PA 4NR5A 4QNSA 5DW1A 5DYAA 4QR4A 5FG5A 2YEMA 5F62A 3MB4A 3MUKA 4QSPA 4NRCA 4MR5A 5K29A 4YYKA 4NUEA 3U5OA 3UW9A 5C89A 5CFWA 4QR3A 5LKTA 5FE2A 5ENFA 5CPEA 3GG3A 5EPBA 3UV2A 5E73A 5F36A 4A9MA 5CQ5A 4XY8A 3TLPA 4XY9A 5HLSA 5E74A 5F25A 4IR5A 2NXBA 5FE6A 5DLZA 5CGPA 5D26A 5I1QA 5DY7A 4HBVA 4QEUA 5LKXA 5FFYA 2RS9B 3O36A 5IIDA 5C85A 4NUCA 5HQ6A 4NR8A 5ETBA 4NR4A 4N4IA 1WUGA 4YY6A 5CTLA 4NRBA 5EWCA 4HBXA 4QSVA 4YYGA 4ZQLA 3LQJA 4MENA 2H60A 5HRWA 4A9IA 4TZ8A 5EWHA 5JI8A 5KTXA 3O34A 4NR6A 4BW3A 5D3TA 4N4HA 5ENCA 2I7KA 4LDFA 4QSRA 4WHUA 3MULA 4A9KA 4ALGA 5G4RA 5AMEA 5FFWA 4CUSA 5HRVA 4Q0OA 3Q2EA 2DWWA 5EP7A 5CUDA 5CUCA 4HXPA 3JVLA 4YYJA 5FFVA 5EV9A 5A5SA 4QBMA 5D25A 5A85A 3D7CA 2DVRA 4LRGA 4LR6A 4UIZA 4NS5A 3HMHA 5E7DA 3UVYA 5HM0A 4QY4A 4WHWA 5CY9A 2YYNA 5EICA 3U5LA 4HBYA 4O7EA 3LXJA 4UYDA 5EWWA 5CUBA 4X2IA 4C67A 5CUEA 5L98A 3P1EA 5E3DA 3U5MA 5F5ZA 4O76A 2RNXA 4TT4A 4YH3A 5D7XA 3S91A 5A7CA 2R0SA 5A81A 2F6JA 4HXMA 4LYSA 5H1TA 4YBMA 5CP5A 4YATA 4C66A 4UIXA 5ENGA 2R0VA 4IOQA 5CQ4A 5ENJA 2DVSA 4O74A 5KHMA 4TT6A 4UYFB 5F1HA 5E9KA 3LQHA 5H1VA 5C4QA 4N4GA 4YAXA 5FE3A 4CUTA 4BW2A 4MR6A 4RVRA 5F3AA 5DKHA 5HELA 4IR4A 5I7YA 5II1A 1N72A 3DWYA 5I40A 3UVWA 4YYDA 5DYCA 5FG6A 4CL9A 4CURA 4PS5A 5EWDA 3U5JA 4UYGA 5CZGA 2RFJA 4PKLA 5D3JA 3P1FA 5IG6A 4YH4A 5D3SA 4UIYA 5FE4A 5CQ7A 4CUQA 5E9LA 5AD3A 2D82A 4QR5A 3SVGA 5TB6A 3QZVA 5EM3A 4YBSA 3NXBA 5EA1A 4TU6A 4ALHA 1JM4B 5E9IA 3QZSA 5ENEA 5L8UA 3MXFA 4NR9A 5BT4A 2MJVB 2E7NA 4UIUA 5DLXA 4NQMA 5EWVA 4N3WA 4TYLA 4Y03A 1WUMA 4O71A 4NXJA 4UIVA 4A9LA 4YABA 4BW4A 5D3NA 5H1UA 2E7OA 3RCWA 5E9VA 4O7AA 5EQ1A 2WP2A 5AD2A 5HRXA 2KTBB 5ETDA 2R0YA 3ONIA 5I80A 5F2PA 3HMFA 4GPJA 5C7NA 3UVXA 5LKUA 4HXOA 2RNYA 2YQDA 4MR4A 4QSWA 5HCLA 4QUUA 5HQ7A 4NR7A 5DFDA 3UVDA 5DFBA 5DYUA 1ZS5A 5D3PA 5HFRA 5JWMA 4HBWA 4O78A 4DONA 2OSSA 4QC1A 4LZ2A 4NYWA 5D3LA 5FE1A 3P5OA 4UITA 4QYLA 5A5NA 2RO1A 3O33A 4KCXA 5ENHA 4A9JA 5IBNA 4PTBA 5DX4A 4CLBA 2YEKA 5CQ8A 4O7FA 4MEPA 5A5PA 3O37A 4YYMA 4A9FA 2D9EA 5I89A 4HXSA 5IGKA 4NUDA 4BW1A 4LYWA 1EQFA 5FH8A 4QSSA 3JVMA 3JVKA 5D24A 5FDZA 3P1DA 5C8GA 5IGMA 4QEVA 3K2JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FKM X;  2WP1 A;  2YW5 A;  3MB3 A;  4IR6 A;  5KTW A;  4HXL A;  4YC9 A;  4BJX A;  4PCE A;  4AKN A;  5I7X A;  4MR3 A;  5FBX A;  4N4F A;  5KTU A;  4Q0N A;  5FG4 A;  1JSP B;  4QC3 A;  5HJC A;  5L99 A;  5I86 A;  5DW2 A;  4IOO A;  3SVH A;  3DAI A;  5LJ2 A;  4KV1 A;  4OGI A;  5I29 A;  4LYI A;  5KU3 A;  4A9O A;  4O7B A;  4A9H A;  3AAD A;  4O7C A;  4NQN A;  5FE0 A;  5CQT A;  5CQ6 A;  5ENB A;  5E9M A;  5LKZ A;  4O75 A;  5L96 A;  1F68 A;  5CU8 A;  3U5N A;  4QB3 A;  4TTE A;  4PY6 A;  5EIS A;  4YAD A;  4BHW A;  2DVQ A;  4YBT A;  5DBM A;  2YEL A;  5EK9 A;  5LVR A;  2GRC A;  4WIV A;  4LZS A;  5CRZ A;  5AMF A;  5FE9 A;  4HXR A;  4OUF A;  2L5E A;  5D3H A;  5CRM A;  5FB1 A;  5HEN A;  5FH7 A;  3UV4 A;  4MEQ A;  4UYE A;  5DKD A;  4ZW1 A;  4HXN A;  3U5K A;  4LZR A;  5A5Q A;  5DKC A;  5H85 A;  4A9E A;  1E6I A;  5EVA A;  4Z93 A;  4E96 A;  3LJW A;  4YYN A;  5C87 A;  5FE7 A;  5A82 A;  3IU6 A;  4CFK A;  5EU1 A;  4MEO A;  4J0S A;  5BT3 A;  4Z6H A;  5A5O A;  5F61 A;  5BT5 A;  5LJ0 A;  2DAT A;  4NRA A;  5ACY A;  3P1C A;  2DVV A;  5CUA A;  4ZC9 A;  5A5R A;  5TCM A;  5L8T A;  2DKW A;  5I88 A;  5FH6 A;  4NYX A;  2E3K A;  2RI7 A;  4QSU A;  2OUO A;  4YY4 A;  4QST A;  5I83 A;  3AQA A;  5EPS A;  5ENI A;  3Q2F A;  4PCI A;  5DYX A;  4YK0 A;  4FLP A;  5LVQ A;  3O35 A;  2FSA A;  4TU4 A;  4J0R A;  4QEW A;  5HFQ A;  5II2 A;  4Z1S A;  5KO4 A;  3LQI A;  2L84 A;  4LC2 A;  4YYH A;  5L97 A;  5D0C A;  5LUU A;  5LJ1 A;  2OO1 A;  5IGN A;  5HQ5 A;  3QZT A;  5CQ3 A;  2R10 A;  4IOR A;  5DFC A;  5E9Y A;  5F1L A;  5HEM A;  5G4S A;  1X0J A;  3HME A;  5F60 A;  5IGL A;  4XYA A;  4QUT A;  4TZ2 A;  4J3I A;  5FE5 A;  3ZYU A;  5FE8 A;  4CUP A;  2G4A A;  5CQA A;  2F6N A;  5EI4 A;  4Z6I A;  3U5P A;  5D3R A;  3UV5 A;  4CUU A;  3MQM A;  4QSX A;  4TT2 A;  5J0D A;  3IU5 A;  4TQN A;  5CUG A;  2LSP B;  4IR3 A;  4NYV A;  4QYD A;  3G0L A;  4F3I A;  3SVF A;  4UYH A;  2I8N A;  4TS8 A;  4XUB A;  5F63 A;  5CS8 A;  5E3G A;  4UIW A;  4QSQ A;  4O72 A;  4YYI A;  2L85 A;  5EPR A;  4QZS A;  4A9N A;  2YDW A;  4Z1Q A;  5FB0 A;  2RNW A;  5A83 A;  4OGJ A;  2N9G A;  5COI A;  4HXK A;  5EGU A;  3S92 A;  3G0J A;  3JVJ A;  4CFL A;  4UYF A;  4O77 A;  3I3J A;  4O70 A;  5E0R A;  4KV4 A;  4XUA A;  4J1P A;  4NR5 A;  4QNS A;  5DW1 A;  5DYA A;  4QR4 A;  5FG5 A;  2YEM A;  5F62 A;  3MB4 A;  3MUK A;  4QSP A;  4NRC A;  4MR5 A;  5K29 A;  4YYK A;  4NUE A;  3U5O A;  3UW9 A;  5C89 A;  5CFW A;  4QR3 A;  5LKT A;  5FE2 A;  5ENF A;  5CPE A;  3GG3 A;  5EPB A;  3UV2 A;  5E73 A;  5F36 A;  4A9M A;  5CQ5 A;  4XY8 A;  3TLP A;  4XY9 A;  5HLS A;  5E74 A;  5F25 A;  4IR5 A;  2NXB A;  5FE6 A;  5DLZ A;  5CGP A;  5D26 A;  5I1Q A;  5DY7 A;  4HBV A;  4QEU A;  5LKX A;  5FFY A;  2RS9 B;  3O36 A;  5IID A;  5C85 A;  4NUC A;  5HQ6 A;  4NR8 A;  5ETB A;  4NR4 A;  4N4I A;  1WUG A;  4YY6 A;  5CTL A;  4NRB A;  5EWC A;  4HBX A;  4QSV A;  4YYG A;  4ZQL A;  3LQJ A;  4MEN A;  2H60 A;  5HRW A;  4A9I A;  4TZ8 A;  5EWH A;  5JI8 A;  5KTX A;  3O34 A;  4NR6 A;  4BW3 A;  5D3T A;  4N4H A;  5ENC A;  2I7K A;  4LDF A;  4QSR A;  4WHU A;  3MUL A;  4A9K A;  4ALG A;  5G4R A;  5AME A;  5FFW A;  4CUS A;  5HRV A;  4Q0O A;  3Q2E A;  2DWW A;  5EP7 A;  5CUD A;  5CUC A;  4HXP A;  3JVL A;  4YYJ A;  5FFV A;  5EV9 A;  5A5S A;  4QBM A;  5D25 A;  5A85 A;  3D7C A;  2DVR A;  4LRG A;  4LR6 A;  4UIZ A;  4NS5 A;  3HMH A;  5E7D A;  3UVY A;  5HM0 A;  4QY4 A;  4WHW A;  5CY9 A;  2YYN A;  5EIC A;  3U5L A;  4HBY A;  4O7E A;  3LXJ A;  4UYD A;  5EWW A;  5CUB A;  4X2I A;  4C67 A;  5CUE A;  5L98 A;  3P1E A;  5E3D A;  3U5M A;  5F5Z A;  4O76 A;  2RNX A;  4TT4 A;  4YH3 A;  5D7X A;  3S91 A;  5A7C A;  2R0S A;  5A81 A;  2F6J A;  4HXM A;  4LYS A;  5H1T A;  4YBM A;  5CP5 A;  4YAT A;  4C66 A;  4UIX A;  5ENG A;  2R0V A;  4IOQ A;  5CQ4 A;  5ENJ A;  2DVS A;  4O74 A;  5KHM A;  4TT6 A;  4UYF B;  5F1H A;  5E9K A;  3LQH A;  5H1V A;  5C4Q A;  4N4G A;  4YAX A;  5FE3 A;  4CUT A;  4BW2 A;  4MR6 A;  4RVR A;  5F3A A;  5DKH A;  5HEL A;  4IR4 A;  5I7Y A;  5II1 A;  1N72 A;  3DWY A;  5I40 A;  3UVW A;  4YYD A;  5DYC A;  5FG6 A;  4CL9 A;  4CUR A;  4PS5 A;  5EWD A;  3U5J A;  4UYG A;  5CZG A;  2RFJ A;  4PKL A;  5D3J A;  3P1F A;  5IG6 A;  4YH4 A;  5D3S A;  4UIY A;  5FE4 A;  5CQ7 A;  4CUQ A;  5E9L A;  5AD3 A;  2D82 A;  4QR5 A;  3SVG A;  5TB6 A;  3QZV A;  5EM3 A;  4YBS A;  3NXB A;  5EA1 A;  4TU6 A;  4ALH A;  1JM4 B;  5E9I A;  3QZS A;  5ENE A;  5L8U A;  3MXF A;  4NR9 A;  5BT4 A;  2MJV B;  2E7N A;  4UIU A;  5DLX A;  4NQM A;  5EWV A;  4N3W A;  4TYL A;  4Y03 A;  1WUM A;  4O71 A;  4NXJ A;  4UIV A;  4A9L A;  4YAB A;  4BW4 A;  5D3N A;  5H1U A;  2E7O A;  3RCW A;  5E9V A;  4O7A A;  5EQ1 A;  2WP2 A;  5AD2 A;  5HRX A;  2KTB B;  5ETD A;  2R0Y A;  3ONI A;  5I80 A;  5F2P A;  3HMF A;  4GPJ A;  5C7N A;  3UVX A;  5LKU A;  4HXO A;  2RNY A;  2YQD A;  4MR4 A;  4QSW A;  5HCL A;  4QUU A;  5HQ7 A;  4NR7 A;  5DFD A;  3UVD A;  5DFB A;  5DYU A;  1ZS5 A;  5D3P A;  5HFR A;  5JWM A;  4HBW A;  4O78 A;  4DON A;  2OSS A;  4QC1 A;  4LZ2 A;  4NYW A;  5D3L A;  5FE1 A;  3P5O A;  4UIT A;  4QYL A;  5A5N A;  2RO1 A;  3O33 A;  4KCX A;  5ENH A;  4A9J A;  5IBN A;  4PTB A;  5DX4 A;  4CLB A;  2YEK A;  5CQ8 A;  4O7F A;  4MEP A;  5A5P A;  3O37 A;  4YYM A;  4A9F A;  2D9E A;  5I89 A;  4HXS A;  5IGK A;  4NUD A;  4BW1 A;  4LYW A;  1EQF A;  5FH8 A;  4QSS A;  3JVM A;  3JVK A;  5D24 A;  5FDZ A;  3P1D A;  5C8G A;  5IGM A;  4QEV A;  3K2J A; 
#chains in the Genus database with same CATH topology
 3FKM X;  2WP1 A;  2YW5 A;  3MB3 A;  4IR6 A;  5KTW A;  4AKI A;  4HXL A;  4YC9 A;  4BJX A;  4PCE A;  4AKN A;  5I7X A;  4MR3 A;  5FBX A;  4N4F A;  5KTU A;  4Q0N A;  5FG4 A;  1JSP B;  4QC3 A;  5HJC A;  5L99 A;  5I86 A;  5DW2 A;  4IOO A;  3SVH A;  3DAI A;  5LJ2 A;  4KV1 A;  4OGI A;  5I29 A;  4LYI A;  5KU3 A;  4A9O A;  4O7B A;  4A9H A;  3AAD A;  4O7C A;  4NQN A;  5FE0 A;  5CQT A;  5CQ6 A;  5ENB A;  5E9M A;  5LKZ A;  4O75 A;  5L96 A;  1F68 A;  5CU8 A;  3U5N A;  4QB3 A;  4TTE A;  4PY6 A;  5EIS A;  4YAD A;  4BHW A;  2DVQ A;  4YBT A;  5DBM A;  2YEL A;  5EK9 A;  5LVR A;  2GRC A;  4WIV A;  4LZS A;  5CRZ A;  5AMF A;  5FE9 A;  4HXR A;  4OUF A;  2L5E A;  5D3H A;  5CRM A;  5FB1 A;  5HEN A;  4AKG A;  5FH7 A;  3UV4 A;  4MEQ A;  4UYE A;  5DKD A;  4ZW1 A;  4HXN A;  3U5K A;  4LZR A;  5A5Q A;  5DKC A;  5H85 A;  4A9E A;  1E6I A;  5EVA A;  4Z93 A;  4E96 A;  3LJW A;  4YYN A;  5C87 A;  5FE7 A;  5A82 A;  3IU6 A;  4CFK A;  5EU1 A;  4MEO A;  4J0S A;  5BT3 A;  4Z6H A;  5A5O A;  5F61 A;  5BT5 A;  5LJ0 A;  2DAT A;  1ZKR A;  4NRA A;  5ACY A;  3P1C A;  2DVV A;  5CUA A;  4ZC9 A;  5A5R A;  5TCM A;  5L8T A;  2DKW A;  4AI6 A;  5I88 A;  5FH6 A;  4NYX A;  2E3K A;  2RI7 A;  4QSU A;  2OUO A;  4YY4 A;  4QST A;  5I83 A;  3AQA A;  5EPS A;  5ENI A;  3Q2F A;  4PCI A;  5DYX A;  4YK0 A;  4FLP A;  5LVQ A;  3O35 A;  2FSA A;  4TU4 A;  4J0R A;  4QEW A;  5HFQ A;  5II2 A;  4Z1S A;  5KO4 A;  3LQI A;  2L84 A;  4LC2 A;  4YYH A;  5L97 A;  5D0C A;  5LUU A;  5LJ1 A;  2OO1 A;  5IGN A;  5HQ5 A;  3QZT A;  5CQ3 A;  2R10 A;  4IOR A;  5DFC A;  5E9Y A;  5F1L A;  5HEM A;  5G4S A;  1X0J A;  3HME A;  5F60 A;  5IGL A;  4XYA A;  4QUT A;  4TZ2 A;  4J3I A;  5FE5 A;  3ZYU A;  5FE8 A;  4CUP A;  2G4A A;  5CQA A;  2F6N A;  5EI4 A;  4Z6I A;  3U5P A;  5D3R A;  3UV5 A;  4CUU A;  2EJN A;  3MQM A;  4QSX A;  4TT2 A;  5J0D A;  3IU5 A;  4TQN A;  5CUG A;  2LSP B;  4IR3 A;  4NYV A;  4QYD A;  3G0L A;  4F3I A;  3SVF A;  4UYH A;  2I8N A;  4TS8 A;  4XUB A;  5F63 A;  5CS8 A;  5E3G A;  4UIW A;  4QSQ A;  4O72 A;  4YYI A;  2L85 A;  5EPR A;  4QZS A;  4A9N A;  2YDW A;  4Z1Q A;  5FB0 A;  2RNW A;  5A83 A;  4OGJ A;  2N9G A;  5COI A;  4HXK A;  5EGU A;  3S92 A;  3G0J A;  3JVJ A;  4CFL A;  4UYF A;  4O77 A;  3I3J A;  4O70 A;  5E0R A;  4KV4 A;  4XUA A;  4J1P A;  4NR5 A;  4QNS A;  5DW1 A;  5DYA A;  4QR4 A;  5FG5 A;  2YEM A;  5F62 A;  3MB4 A;  3MUK A;  4QSP A;  4NRC A;  4MR5 A;  5K29 A;  4YYK A;  4NUE A;  3U5O A;  3UW9 A;  5C89 A;  5CFW A;  4QR3 A;  5LKT A;  5FE2 A;  5ENF A;  5CPE A;  3GG3 A;  5EPB A;  3UV2 A;  5E73 A;  5F36 A;  4A9M A;  5CQ5 A;  4XY8 A;  3TLP A;  4XY9 A;  5HLS A;  5E74 A;  5F25 A;  4IR5 A;  2NXB A;  5FE6 A;  5DLZ A;  5CGP A;  5D26 A;  5I1Q A;  5DY7 A;  4HBV A;  4QEU A;  5LKX A;  5FFY A;  2RS9 B;  3O36 A;  5IID A;  5C85 A;  4NUC A;  5HQ6 A;  4NR8 A;  5ETB A;  4NR4 A;  4N4I A;  1WUG A;  4YY6 A;  5CTL A;  4NRB A;  3D1D A;  5EWC A;  4HBX A;  4QSV A;  4YYG A;  4ZQL A;  3LQJ A;  4MEN A;  2H60 A;  5HRW A;  3D1B A;  4A9I A;  4TZ8 A;  5EWH A;  5JI8 A;  5KTX A;  3O34 A;  4NR6 A;  4BW3 A;  5D3T A;  4N4H A;  5ENC A;  2I7K A;  4LDF A;  4QSR A;  4WHU A;  3MUL A;  4A9K A;  4ALG A;  5G4R A;  5AME A;  5FFW A;  4CUS A;  5HRV A;  4Q0O A;  3Q2E A;  2DWW A;  5EP7 A;  5CUD A;  5CUC A;  4HXP A;  3JVL A;  4YYJ A;  5FFV A;  5EV9 A;  5A5S A;  4QBM A;  5D25 A;  5A85 A;  3D7C A;  2DVR A;  4LRG A;  4LR6 A;  4UIZ A;  4NS5 A;  3HMH A;  5E7D A;  3UVY A;  5HM0 A;  4QY4 A;  4WHW A;  5CY9 A;  2YYN A;  1PUO A;  5EIC A;  3U5L A;  4HBY A;  4O7E A;  3LXJ A;  4UYD A;  5EWW A;  5CUB A;  4X2I A;  4C67 A;  5CUE A;  5L98 A;  3P1E A;  5E3D A;  3U5M A;  5F5Z A;  4O76 A;  2RNX A;  4TT4 A;  4YH3 A;  5D7X A;  3S91 A;  5A7C A;  2R0S A;  5A81 A;  2F6J A;  4HXM A;  4LYS A;  5H1T A;  4YBM A;  5CP5 A;  4YAT A;  4C66 A;  4UIX A;  5ENG A;  2R0V A;  4IOQ A;  5CQ4 A;  5ENJ A;  2DVS A;  4O74 A;  5KHM A;  4TT6 A;  4UYF B;  5F1H A;  5E9K A;  3LQH A;  5H1V A;  5C4Q A;  4N4G A;  4YAX A;  5FE3 A;  4CUT A;  4BW2 A;  4MR6 A;  4RVR A;  5F3A A;  5DKH A;  5HEL A;  4IR4 A;  5I7Y A;  5II1 A;  1N72 A;  4AKH A;  3DWY A;  5I40 A;  3UVW A;  4YYD A;  5DYC A;  5FG6 A;  4CL9 A;  4CUR A;  4PS5 A;  5EWD A;  3U5J A;  4UYG A;  5CZG A;  2RFJ A;  4PKL A;  5D3J A;  3P1F A;  5IG6 A;  4YH4 A;  3VKG A;  5D3S A;  4UIY A;  5FE4 A;  5CQ7 A;  4CUQ A;  5E9L A;  5AD3 A;  2D82 A;  4QR5 A;  3SVG A;  5TB6 A;  3QZV A;  5EM3 A;  4YBS A;  3NXB A;  5EA1 A;  4TU6 A;  4ALH A;  1JM4 B;  5E9I A;  3QZS A;  5ENE A;  5L8U A;  3MXF A;  4NR9 A;  5BT4 A;  2MJV B;  2E7N A;  4UIU A;  5DLX A;  4NQM A;  5EWV A;  4N3W A;  4TYL A;  4Y03 A;  1WUM A;  4O71 A;  4NXJ A;  4UIV A;  4A9L A;  4YAB A;  4BW4 A;  5D3N A;  5H1U A;  2E7O A;  3RCW A;  5E9V A;  4O7A A;  5EQ1 A;  2WP2 A;  5AD2 A;  5HRX A;  2KTB B;  5ETD A;  2R0Y A;  3ONI A;  5I80 A;  5F2P A;  3HMF A;  4GPJ A;  5C7N A;  3UVX A;  5LKU A;  4HXO A;  2RNY A;  2YQD A;  4MR4 A;  4QSW A;  5HCL A;  4QUU A;  5HQ7 A;  4NR7 A;  5DFD A;  3UVD A;  5DFB A;  5DYU A;  1ZS5 A;  5D3P A;  5HFR A;  5JWM A;  4HBW A;  4O78 A;  4DON A;  3VKH A;  2OSS A;  4QC1 A;  4LZ2 A;  4NYW A;  5D3L A;  5FE1 A;  3P5O A;  4UIT A;  4QYL A;  5A5N A;  2RO1 A;  3O33 A;  4KCX A;  5ENH A;  4A9J A;  5IBN A;  4PTB A;  5DX4 A;  4CLB A;  2YEK A;  5CQ8 A;  4O7F A;  4MEP A;  5A5P A;  3O37 A;  4YYM A;  4A9F A;  2D9E A;  5I89 A;  4HXS A;  5IGK A;  4NUD A;  4BW1 A;  4LYW A;  1EQF A;  3ERR A;  5FH8 A;  4QSS A;  3JVM A;  3JVK A;  5D24 A;  5FDZ A;  3P1D A;  5C8G A;  5IGM A;  4QEV A;  3K2J A; 
#chains in the Genus database with same CATH homology
 3FKM X;  2WP1 A;  2YW5 A;  3MB3 A;  4IR6 A;  5KTW A;  4HXL A;  4YC9 A;  4BJX A;  4PCE A;  4AKN A;  5I7X A;  4MR3 A;  5FBX A;  4N4F A;  5KTU A;  4Q0N A;  5FG4 A;  1JSP B;  4QC3 A;  5HJC A;  5L99 A;  5I86 A;  5DW2 A;  4IOO A;  3SVH A;  3DAI A;  5LJ2 A;  4KV1 A;  4OGI A;  5I29 A;  4LYI A;  5KU3 A;  4A9O A;  4O7B A;  4A9H A;  3AAD A;  4O7C A;  4NQN A;  5FE0 A;  5CQT A;  5CQ6 A;  5ENB A;  5E9M A;  5LKZ A;  4O75 A;  5L96 A;  1F68 A;  5CU8 A;  3U5N A;  4QB3 A;  4TTE A;  4PY6 A;  5EIS A;  4YAD A;  4BHW A;  2DVQ A;  4YBT A;  5DBM A;  2YEL A;  5EK9 A;  5LVR A;  2GRC A;  4WIV A;  4LZS A;  5CRZ A;  5AMF A;  5FE9 A;  4HXR A;  4OUF A;  2L5E A;  5D3H A;  5CRM A;  5FB1 A;  5HEN A;  5FH7 A;  3UV4 A;  4MEQ A;  4UYE A;  5DKD A;  4ZW1 A;  4HXN A;  3U5K A;  4LZR A;  5A5Q A;  5DKC A;  5H85 A;  4A9E A;  1E6I A;  5EVA A;  4Z93 A;  4E96 A;  3LJW A;  4YYN A;  5C87 A;  5FE7 A;  5A82 A;  3IU6 A;  4CFK A;  5EU1 A;  4MEO A;  4J0S A;  5BT3 A;  4Z6H A;  5A5O A;  5F61 A;  5BT5 A;  5LJ0 A;  2DAT A;  4NRA A;  5ACY A;  3P1C A;  2DVV A;  5CUA A;  4ZC9 A;  5A5R A;  5TCM A;  5L8T A;  2DKW A;  5I88 A;  5FH6 A;  4NYX A;  2E3K A;  2RI7 A;  4QSU A;  2OUO A;  4YY4 A;  4QST A;  5I83 A;  3AQA A;  5EPS A;  5ENI A;  3Q2F A;  4PCI A;  5DYX A;  4YK0 A;  4FLP A;  5LVQ A;  3O35 A;  2FSA A;  4TU4 A;  4J0R A;  4QEW A;  5HFQ A;  5II2 A;  4Z1S A;  5KO4 A;  3LQI A;  2L84 A;  4LC2 A;  4YYH A;  5L97 A;  5D0C A;  5LUU A;  5LJ1 A;  2OO1 A;  5IGN A;  5HQ5 A;  3QZT A;  5CQ3 A;  2R10 A;  4IOR A;  5DFC A;  5E9Y A;  5F1L A;  5HEM A;  5G4S A;  1X0J A;  3HME A;  5F60 A;  5IGL A;  4XYA A;  4QUT A;  4TZ2 A;  4J3I A;  5FE5 A;  3ZYU A;  5FE8 A;  4CUP A;  2G4A A;  5CQA A;  2F6N A;  5EI4 A;  4Z6I A;  3U5P A;  5D3R A;  3UV5 A;  4CUU A;  3MQM A;  4QSX A;  4TT2 A;  5J0D A;  3IU5 A;  4TQN A;  5CUG A;  2LSP B;  4IR3 A;  4NYV A;  4QYD A;  3G0L A;  4F3I A;  3SVF A;  4UYH A;  2I8N A;  4TS8 A;  4XUB A;  5F63 A;  5CS8 A;  5E3G A;  4UIW A;  4QSQ A;  4O72 A;  4YYI A;  2L85 A;  5EPR A;  4QZS A;  4A9N A;  2YDW A;  4Z1Q A;  5FB0 A;  2RNW A;  5A83 A;  4OGJ A;  2N9G A;  5COI A;  4HXK A;  5EGU A;  3S92 A;  3G0J A;  3JVJ A;  4CFL A;  4UYF A;  4O77 A;  3I3J A;  4O70 A;  5E0R A;  4KV4 A;  4XUA A;  4J1P A;  4NR5 A;  4QNS A;  5DW1 A;  5DYA A;  4QR4 A;  5FG5 A;  2YEM A;  5F62 A;  3MB4 A;  3MUK A;  4QSP A;  4NRC A;  4MR5 A;  5K29 A;  4YYK A;  4NUE A;  3U5O A;  3UW9 A;  5C89 A;  5CFW A;  4QR3 A;  5LKT A;  5FE2 A;  5ENF A;  5CPE A;  3GG3 A;  5EPB A;  3UV2 A;  5E73 A;  5F36 A;  4A9M A;  5CQ5 A;  4XY8 A;  3TLP A;  4XY9 A;  5HLS A;  5E74 A;  5F25 A;  4IR5 A;  2NXB A;  5FE6 A;  5DLZ A;  5CGP A;  5D26 A;  5I1Q A;  5DY7 A;  4HBV A;  4QEU A;  5LKX A;  5FFY A;  2RS9 B;  3O36 A;  5IID A;  5C85 A;  4NUC A;  5HQ6 A;  4NR8 A;  5ETB A;  4NR4 A;  4N4I A;  1WUG A;  4YY6 A;  5CTL A;  4NRB A;  5EWC A;  4HBX A;  4QSV A;  4YYG A;  4ZQL A;  3LQJ A;  4MEN A;  2H60 A;  5HRW A;  4A9I A;  4TZ8 A;  5EWH A;  5JI8 A;  5KTX A;  3O34 A;  4NR6 A;  4BW3 A;  5D3T A;  4N4H A;  5ENC A;  2I7K A;  4LDF A;  4QSR A;  4WHU A;  3MUL A;  4A9K A;  4ALG A;  5G4R A;  5AME A;  5FFW A;  4CUS A;  5HRV A;  4Q0O A;  3Q2E A;  2DWW A;  5EP7 A;  5CUD A;  5CUC A;  4HXP A;  3JVL A;  4YYJ A;  5FFV A;  5EV9 A;  5A5S A;  4QBM A;  5D25 A;  5A85 A;  3D7C A;  2DVR A;  4LRG A;  4LR6 A;  4UIZ A;  4NS5 A;  3HMH A;  5E7D A;  3UVY A;  5HM0 A;  4QY4 A;  4WHW A;  5CY9 A;  2YYN A;  5EIC A;  3U5L A;  4HBY A;  4O7E A;  3LXJ A;  4UYD A;  5EWW A;  5CUB A;  4X2I A;  4C67 A;  5CUE A;  5L98 A;  3P1E A;  5E3D A;  3U5M A;  5F5Z A;  4O76 A;  2RNX A;  4TT4 A;  4YH3 A;  5D7X A;  3S91 A;  5A7C A;  2R0S A;  5A81 A;  2F6J A;  4HXM A;  4LYS A;  5H1T A;  4YBM A;  5CP5 A;  4YAT A;  4C66 A;  4UIX A;  5ENG A;  2R0V A;  4IOQ A;  5CQ4 A;  5ENJ A;  2DVS A;  4O74 A;  5KHM A;  4TT6 A;  4UYF B;  5F1H A;  5E9K A;  3LQH A;  5H1V A;  5C4Q A;  4N4G A;  4YAX A;  5FE3 A;  4CUT A;  4BW2 A;  4MR6 A;  4RVR A;  5F3A A;  5DKH A;  5HEL A;  4IR4 A;  5I7Y A;  5II1 A;  1N72 A;  3DWY A;  5I40 A;  3UVW A;  4YYD A;  5DYC A;  5FG6 A;  4CL9 A;  4CUR A;  4PS5 A;  5EWD A;  3U5J A;  4UYG A;  5CZG A;  2RFJ A;  4PKL A;  5D3J A;  3P1F A;  5IG6 A;  4YH4 A;  5D3S A;  4UIY A;  5FE4 A;  5CQ7 A;  4CUQ A;  5E9L A;  5AD3 A;  2D82 A;  4QR5 A;  3SVG A;  5TB6 A;  3QZV A;  5EM3 A;  4YBS A;  3NXB A;  5EA1 A;  4TU6 A;  4ALH A;  1JM4 B;  5E9I A;  3QZS A;  5ENE A;  5L8U A;  3MXF A;  4NR9 A;  5BT4 A;  2MJV B;  2E7N A;  4UIU A;  5DLX A;  4NQM A;  5EWV A;  4N3W A;  4TYL A;  4Y03 A;  1WUM A;  4O71 A;  4NXJ A;  4UIV A;  4A9L A;  4YAB A;  4BW4 A;  5D3N A;  5H1U A;  2E7O A;  3RCW A;  5E9V A;  4O7A A;  5EQ1 A;  2WP2 A;  5AD2 A;  5HRX A;  2KTB B;  5ETD A;  2R0Y A;  3ONI A;  5I80 A;  5F2P A;  3HMF A;  4GPJ A;  5C7N A;  3UVX A;  5LKU A;  4HXO A;  2RNY A;  2YQD A;  4MR4 A;  4QSW A;  5HCL A;  4QUU A;  5HQ7 A;  4NR7 A;  5DFD A;  3UVD A;  5DFB A;  5DYU A;  1ZS5 A;  5D3P A;  5HFR A;  5JWM A;  4HBW A;  4O78 A;  4DON A;  2OSS A;  4QC1 A;  4LZ2 A;  4NYW A;  5D3L A;  5FE1 A;  3P5O A;  4UIT A;  4QYL A;  5A5N A;  2RO1 A;  3O33 A;  4KCX A;  5ENH A;  4A9J A;  5IBN A;  4PTB A;  5DX4 A;  4CLB A;  2YEK A;  5CQ8 A;  4O7F A;  4MEP A;  5A5P A;  3O37 A;  4YYM A;  4A9F A;  2D9E A;  5I89 A;  4HXS A;  5IGK A;  4NUD A;  4BW1 A;  4LYW A;  1EQF A;  5FH8 A;  4QSS A;  3JVM A;  3JVK A;  5D24 A;  5FDZ A;  3P1D A;  5C8G A;  5IGM A;  4QEV A;  3K2J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...