5FFWA

Crystal structure of the bromodomain of human brpf1 in complex with h4k5ack8ac histone peptide
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
110
structure length
110
Chain Sequence
LTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Peregrin
publication title Crystal structure of the bromodomain of human BRPF1 in complex with H4K5acK8ac histone peptide
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 38
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5ffwA00
4N4HA 5D3SA 2N9GA 2RO1A 5ACYA 4Q0OA 3JVMA 4UITA 5D24A 4UYGA 4MEOA 5ENEA 5C85A 2YYNA 2I7KA 4HBVA 3UW9A 4WHWA 4UIYA 4NYXA 5EQ1A 5CY9A 5KO4A 5CUAA 4YC9A 4CLBA 5LJ0A 5DLXA 5I40A 5ENCA 3JVLA 5FH8A 5H1VA 3MXFA 4XY9A 3O33A 5ENJA 4O7FA 4QUUA 5FE3A 5F1HA 5HQ5A 4A9MA 4NR7A 3U5MA 3LQHA 4UYFB 5ETBA 4MENA 3G0JA 5CQAA 3U5JA 5DFBA 5BT5A 4MEQA 5CUEA 5ENHA 4YY4A 5EK9A 5EP7A 4DONA 5DBMA 5DX4A 4IOOA 1WUGA 5F36A 5DLZA 5KU3A 4N4GA 4FLPA 4C67A 4UYDA 4HXSA 4J1PA 3P5OA 4LYIA 5IGLA 3UVYA 4PY6A 5E0RA 4NUDA 4O7AA 3MQMA 4A9EA 3Q2FA 4PCIA 5IIDA 4UYEA 5D7XA 2L5EA 3QZSA 5I86A 4YYKA 4YYDA 3DWYA 4O72A 5DYXA 4MR5A 2DVRA 4O70A 5DFCA 5A5QA 5E73A 4NR4A 5CRZA 5F1LA 3UV5A 5E9MA 3O34A 4HXPA 5AMFA 4LZ2A 4LYWA 5L99A 5FFWA 5I89A 5II2A 2MJVB 4NRCA 5HJCA 3U5LA 4IR5A 2R0VA 2OUOA 4PCEA 5FE1A 5LKTA 5ENGA 4O78A 5EPSA 4NS5A 5CTLA 4NXJA 5A85A 4HXOA 5AD3A 4TT6A 3MB4A 5KTUA 3LXJA 3O35A 5EWDA 5CRMA 2YEMA 4PTBA 5K29A 4ALHA 4YH4A 5L96A 5DYUA 5FE8A 2DATA 4ZW1A 4CUUA 5A5RA 1WUMA 5I29A 5D3JA 4YBMA 4QSRA 2E3KA 5DKCA 5FE0A 4QSQA 4A9JA 5C4QA 5EM3A 5H1UA 5DKDA 4BJXA 3K2JA 2KTBB 4QSWA 5CQ8A 5F63A 5I80A 2R0YA 4Y03A 2E7NA 5D3HA 4KV4A 5A7CA 5HFQA 3P1CA 2F6JA 4A9HA 5EWVA 5AMEA 5HM0A 5FG5A 4LRGA 3SVFA 3UVDA 4IORA 5I7XA 4HXNA 4IR4A 4ZC9A 5A5NA 4YADA 4QBMA 4X2IA 4NYWA 4O74A 4UIZA 5KHMA 1N72A 2H60A 3UV4A 5BT4A 2E7OA 5EA1A 5CFWA 5JWMA 5HCLA 5ENFA 5HQ7A 2OO1A 4A9NA 4TQNA 5II1A 3AADA 5C87A 4CFLA 5CQ3A 5AD2A 5HENA 4PKLA 3U5KA 5I88A 3SVGA 2DVQA 1X0JA 5E9KA 3QZTA 5IG6A 3LJWA 4QUTA 2F6NA 5CUDA 3HMEA 2R10A 4XUBA 4NRAA 5D3RA 5FFYA 5BT3A 5HQ6A 5D3TA 5G4SA 5L98A 3NXBA 4CUSA 2GRCA 5E74A 5E9LA 5E3DA 4QZSA 4YK0A 2FSAA 5FE2A 5CQ4A 4NR6A 4UIWA 4UYFA 4WIVA 5F60A 3JVKA 3GG3A 4O77A 4NR8A 5A82A 5D26A 4XUAA 5TCMA 4QSSA 4UIVA 5I7YA 5F2PA 2YELA 5DYAA 3U5NA 2L84A 5HRXA 5CQTA 5CUCA 2LSPB 3LQJA 5LKXA 4NRBA 4QR4A 5DFDA 4YYIA 4HXMA 4N3WA 5CP5A 4HXRA 4OGIA 4C66A 4QR5A 4BW2A 1EQFA 4TU4A 1F68A 2D9EA 3UVWA 5H1TA 5EV9A 3UVXA 4IOQA 5F62A 2RI7A 3QZVA 4O76A 4PS5A 5FDZA 5LKUA 4NQNA 5HRWA 3RCWA 4A9LA 4Z6IA 4O75A 4XY8A 5LJ1A 3MB3A 4NR9A 5L8TA 3S92A 5DYCA 5JI8A 4QSTA 4TTEA 5FE4A 4CUPA 5LVRA 5A5PA 4YYGA 4IR3A 5C89A 4AKNA 3O37A 5LUUA 4J0SA 2YDWA 5LJ2A 4LZSA 4QEVA 3DAIA 3TLPA 3P1EA 4GPJA 3IU5A 3U5OA 3G0LA 4Z93A 4RVRA 3O36A 4YYHA 5FB0A 1ZS5A 4HBYA 4HBWA 5E9VA 4CURA 5G4RA 5CPEA 5CQ5A 2RNXA 4QSXA 4YBTA 5EPBA 4XYAA 4BW1A 5ENIA 3AQAA 2RFJA 4J0RA 4QSUA 4MEPA 5A81A 2R0SA 4TT2A 5F25A 5FE6A 4O7CA 4BHWA 4LC2A 5ENBA 4QC3A 3SVHA 4HXLA 2DKWA 2WP1A 4LYSA 5EWWA 5A5SA 5EPRA 5LKZA 3Q2EA 4IR6A 2RS9B 2I8NA 4TT4A 5FE9A 4Q0NA 5H85A 4TZ8A 3ZYUA 4CUTA 3IU6A 4TZ2A 5FH7A 5E7DA 4J3IA 4NR5A 5IBNA 5CQ6A 2DVVA 2G4AA 4TYLA 5CU8A 4CFKA 4UIUA 4BW3A 1E6IA 4OUFA 5FBXA 4KV1A 4ZQLA 5HRVA 5EU1A 4UIXA 3P1DA 5KTXA 4A9KA 4MR3A 2OSSA 4MR6A 4KCXA 2WP2A 5C7NA 5IGNA 4QNSA 2DWWA 4O7BA 5CGPA 5DKHA 5FG6A 4HBXA 5FG4A 4YAXA 4CL9A 4ALGA 4BW4A 5IGMA 4WHUA 5IGKA 2RNWA 4NQMA 5J0DA 4YYJA 4TS8A 5ETDA 4LR6A 5FE5A 3MUKA 5HELA 2L85A 4QSPA 4YY6A 5E3GA 5HLSA 4YYNA 2D82A 4CUQA 5CUBA 5FB1A 4QYLA 5EICA 4Z6HA 5EGUA 4A9OA 4QR3A 5EWCA 4N4FA 5LVQA 5F3AA 4YBSA 4Z1QA 2RNYA 5E9IA 3U5PA 5DW1A 5KTWA 4QEWA 5CS8A 4NUCA 4N4IA 2DVSA 5D3NA 4QEUA 5TB6A 3UV2A 4A9FA 5HEMA 4F3IA 4QC1A 4OGJA 5D25A 4LDFA 3D7CA 3HMHA 3P1FA 4MR4A 5COIA 3JVJA 4O7EA 3S91A 5A5OA 4YATA 3MULA 5DW2A 5E9YA 4YABA 5D3LA 5CUGA 5L8UA 5EI4A 4NYVA 4O71A 5FH6A 4YYMA 4QYDA 4HXKA 5EWHA 5F5ZA 2YEKA 5D0CA 5I1QA 5HFRA 5CQ7A 5DY7A 2NXBA 1JSPB 5A83A 4UYHA 2YQDA 5L97A 5I83A 4A9IA 4LZRA 1JM4B 5EISA 3FKMX 3LQIA 4QB3A 4QY4A 4TU6A 4Z1SA 3HMFA 5FE7A 5EVAA 5F61A 4NUEA 4E96A 5D3PA 5CZGA 5C8GA 3I3JA 5FFVA 4QSVA 4YH3A 3ONIA 2YW5A
chains in the Genus database with same CATH superfamily
4N4HA 5D3SA 2N9GA 2RO1A 5ACYA 4Q0OA 2EJNA 3JVMA 4UITA 5D24A 4UYGA 4MEOA 5ENEA 5C85A 2YYNA 2I7KA 4HBVA 3UW9A 4WHWA 4UIYA 4NYXA 5EQ1A 5CY9A 5KO4A 5CUAA 4YC9A 4CLBA 5LJ0A 5DLXA 5I40A 5ENCA 3JVLA 5FH8A 5H1VA 3MXFA 4XY9A 3O33A 5ENJA 4O7FA 4QUUA 5FE3A 5F1HA 5HQ5A 4A9MA 4NR7A 3U5MA 3LQHA 4UYFB 5ETBA 4MENA 3G0JA 5CQAA 3U5JA 5DFBA 5BT5A 4MEQA 5CUEA 5ENHA 4YY4A 5EK9A 5EP7A 4DONA 5DBMA 3ERRA 5DX4A 4IOOA 1WUGA 5F36A 5DLZA 5KU3A 4N4GA 4FLPA 4C67A 4UYDA 4HXSA 4J1PA 3P5OA 4LYIA 5IGLA 3UVYA 4PY6A 5E0RA 4NUDA 4O7AA 3MQMA 4A9EA 3Q2FA 4PCIA 5IIDA 4UYEA 5D7XA 2L5EA 3QZSA 5I86A 4YYKA 4YYDA 3DWYA 4O72A 5DYXA 4MR5A 2DVRA 4O70A 5DFCA 5A5QA 5E73A 4NR4A 5CRZA 5F1LA 3UV5A 5E9MA 3O34A 4AI6A 4HXPA 5AMFA 4LZ2A 4LYWA 5L99A 5FFWA 5I89A 5II2A 2MJVB 4NRCA 5HJCA 3U5LA 4IR5A 2R0VA 2OUOA 4AKGA 4PCEA 5FE1A 5LKTA 5ENGA 4O78A 5EPSA 4NS5A 3VKHA 5CTLA 4NXJA 5A85A 4HXOA 5AD3A 4TT6A 3MB4A 5KTUA 3LXJA 3O35A 5EWDA 5CRMA 2YEMA 4PTBA 5K29A 4ALHA 4YH4A 5L96A 5DYUA 5FE8A 2DATA 4ZW1A 4CUUA 5A5RA 1WUMA 5I29A 5D3JA 4YBMA 4QSRA 2E3KA 5DKCA 5FE0A 4QSQA 4A9JA 5C4QA 5EM3A 5H1UA 5DKDA 4BJXA 3K2JA 2KTBB 4QSWA 5CQ8A 5F63A 5I80A 2R0YA 4Y03A 2E7NA 5D3HA 4KV4A 5A7CA 5HFQA 3VKGA 3P1CA 2F6JA 4A9HA 5EWVA 5AMEA 5HM0A 5FG5A 4LRGA 3SVFA 3UVDA 4IORA 5I7XA 4HXNA 4IR4A 4ZC9A 5A5NA 4YADA 4QBMA 4X2IA 4NYWA 4O74A 4UIZA 5KHMA 1N72A 2H60A 3UV4A 5BT4A 2E7OA 5EA1A 5CFWA 5JWMA 5HCLA 5ENFA 5HQ7A 2OO1A 4A9NA 4TQNA 5II1A 3AADA 5C87A 4CFLA 5CQ3A 5AD2A 5HENA 4PKLA 3U5KA 5I88A 3SVGA 2DVQA 1X0JA 5E9KA 3QZTA 5IG6A 3LJWA 4QUTA 2F6NA 5CUDA 3HMEA 2R10A 4XUBA 4NRAA 5D3RA 5FFYA 5BT3A 5HQ6A 5D3TA 5G4SA 1ZKRA 5L98A 3NXBA 4CUSA 2GRCA 5E74A 5E9LA 5E3DA 4QZSA 4YK0A 2FSAA 5FE2A 1PUOA 5CQ4A 4NR6A 4UIWA 4UYFA 4WIVA 5F60A 3JVKA 3D1BA 3GG3A 4O77A 4NR8A 5A82A 5D26A 4XUAA 5TCMA 4QSSA 4UIVA 5I7YA 5F2PA 2YELA 5DYAA 3U5NA 2L84A 5HRXA 5CQTA 5CUCA 2LSPB 3LQJA 5LKXA 4NRBA 4QR4A 5DFDA 4YYIA 4HXMA 4N3WA 5CP5A 4HXRA 4OGIA 4C66A 4QR5A 4BW2A 1EQFA 4TU4A 1F68A 2D9EA 3UVWA 5H1TA 4AKHA 5EV9A 3UVXA 4IOQA 5F62A 3D1DA 2RI7A 3QZVA 4O76A 4PS5A 5FDZA 5LKUA 4NQNA 5HRWA 3RCWA 4A9LA 4Z6IA 4O75A 4XY8A 5LJ1A 3MB3A 4NR9A 5L8TA 3S92A 5DYCA 5JI8A 4QSTA 4TTEA 4AKIA 5FE4A 4CUPA 5LVRA 5A5PA 4YYGA 4IR3A 5C89A 4AKNA 3O37A 5LUUA 4J0SA 2YDWA 5LJ2A 4LZSA 4QEVA 3DAIA 3TLPA 3P1EA 4GPJA 3IU5A 3U5OA 3G0LA 4Z93A 4RVRA 3O36A 4YYHA 5FB0A 1ZS5A 4HBYA 4HBWA 5E9VA 4CURA 5G4RA 5CPEA 5CQ5A 2RNXA 4QSXA 4YBTA 5EPBA 4XYAA 4BW1A 5ENIA 3AQAA 2RFJA 4J0RA 4QSUA 4MEPA 5A81A 2R0SA 4TT2A 5F25A 5FE6A 4O7CA 4BHWA 4LC2A 5ENBA 4QC3A 3SVHA 4HXLA 2DKWA 2WP1A 4LYSA 5EWWA 5A5SA 5EPRA 5LKZA 3Q2EA 4IR6A 2RS9B 2I8NA 4TT4A 5FE9A 4Q0NA 5H85A 4TZ8A 3ZYUA 4CUTA 3IU6A 4TZ2A 5FH7A 5E7DA 4J3IA 4NR5A 5IBNA 5CQ6A 2DVVA 2G4AA 4TYLA 5CU8A 4CFKA 4UIUA 4BW3A 1E6IA 4OUFA 5FBXA 4KV1A 4ZQLA 5HRVA 5EU1A 4UIXA 3P1DA 5KTXA 4A9KA 4MR3A 2OSSA 4MR6A 4KCXA 2WP2A 5C7NA 5IGNA 4QNSA 2DWWA 4O7BA 5CGPA 5DKHA 5FG6A 4HBXA 5FG4A 4YAXA 4CL9A 4ALGA 4BW4A 5IGMA 4WHUA 5IGKA 2RNWA 4NQMA 5J0DA 4YYJA 4TS8A 5ETDA 4LR6A 5FE5A 3MUKA 5HELA 2L85A 4QSPA 4YY6A 5E3GA 5HLSA 4YYNA 2D82A 4CUQA 5CUBA 5FB1A 4QYLA 5EICA 4Z6HA 5EGUA 4A9OA 4QR3A 5EWCA 4N4FA 5LVQA 5F3AA 4YBSA 4Z1QA 2RNYA 5E9IA 3U5PA 5DW1A 5KTWA 4QEWA 5CS8A 4NUCA 4N4IA 2DVSA 5D3NA 4QEUA 5TB6A 3UV2A 4A9FA 5HEMA 4F3IA 4QC1A 4OGJA 5D25A 4LDFA 3D7CA 3HMHA 3P1FA 4MR4A 5COIA 3JVJA 4O7EA 3S91A 5A5OA 4YATA 3MULA 5DW2A 5E9YA 4YABA 5D3LA 5CUGA 5L8UA 5EI4A 4NYVA 4O71A 5FH6A 4YYMA 4QYDA 4HXKA 5EWHA 5F5ZA 2YEKA 5D0CA 5I1QA 5HFRA 5CQ7A 5DY7A 2NXBA 1JSPB 5A83A 4UYHA 2YQDA 5L97A 5I83A 4A9IA 4LZRA 1JM4B 5EISA 3FKMX 3LQIA 4QB3A 4QY4A 4TU6A 4Z1SA 3HMFA 5FE7A 5EVAA 5F61A 4NUEA 4E96A 5D3PA 5CZGA 5C8GA 3I3JA 5FFVA 4QSVA 4YH3A 3ONIA 2YW5A
chains in the Genus database with same CATH topology
4N4HA 5D3SA 2N9GA 2RO1A 5ACYA 4Q0OA 3JVMA 4UITA 5D24A 4UYGA 4MEOA 5ENEA 5C85A 2YYNA 2I7KA 4HBVA 3UW9A 4WHWA 4UIYA 4NYXA 5EQ1A 5CY9A 5KO4A 5CUAA 4YC9A 4CLBA 5LJ0A 5DLXA 5I40A 5ENCA 3JVLA 5FH8A 5H1VA 3MXFA 4XY9A 3O33A 5ENJA 4O7FA 4QUUA 5FE3A 5F1HA 5HQ5A 4A9MA 4NR7A 3U5MA 3LQHA 4UYFB 5ETBA 4MENA 3G0JA 5CQAA 3U5JA 5DFBA 5BT5A 4MEQA 5CUEA 5ENHA 4YY4A 5EK9A 5EP7A 4DONA 5DBMA 5DX4A 4IOOA 1WUGA 5F36A 5DLZA 5KU3A 4N4GA 4FLPA 4C67A 4UYDA 4HXSA 4J1PA 3P5OA 4LYIA 5IGLA 3UVYA 4PY6A 5E0RA 4NUDA 4O7AA 3MQMA 4A9EA 3Q2FA 4PCIA 5IIDA 4UYEA 5D7XA 2L5EA 3QZSA 5I86A 4YYKA 4YYDA 3DWYA 4O72A 5DYXA 4MR5A 2DVRA 4O70A 5DFCA 5A5QA 5E73A 4NR4A 5CRZA 5F1LA 3UV5A 5E9MA 3O34A 4HXPA 5AMFA 4LZ2A 4LYWA 5L99A 5FFWA 5I89A 5II2A 2MJVB 4NRCA 5HJCA 3U5LA 4IR5A 2R0VA 2OUOA 4PCEA 5FE1A 5LKTA 5ENGA 4O78A 5EPSA 4NS5A 5CTLA 4NXJA 5A85A 4HXOA 5AD3A 4TT6A 3MB4A 5KTUA 3LXJA 3O35A 5EWDA 5CRMA 2YEMA 4PTBA 5K29A 4ALHA 4YH4A 5L96A 5DYUA 5FE8A 2DATA 4ZW1A 4CUUA 5A5RA 1WUMA 5I29A 5D3JA 4YBMA 4QSRA 2E3KA 5DKCA 5FE0A 4QSQA 4A9JA 5C4QA 5EM3A 5H1UA 5DKDA 4BJXA 3K2JA 2KTBB 4QSWA 5CQ8A 5F63A 5I80A 2R0YA 4Y03A 2E7NA 5D3HA 4KV4A 5A7CA 5HFQA 3P1CA 2F6JA 4A9HA 5EWVA 5AMEA 5HM0A 5FG5A 4LRGA 3SVFA 3UVDA 4IORA 5I7XA 4HXNA 4IR4A 4ZC9A 5A5NA 4YADA 4QBMA 4X2IA 4NYWA 4O74A 4UIZA 5KHMA 1N72A 2H60A 3UV4A 5BT4A 2E7OA 5EA1A 5CFWA 5JWMA 5HCLA 5ENFA 5HQ7A 2OO1A 4A9NA 4TQNA 5II1A 3AADA 5C87A 4CFLA 5CQ3A 5AD2A 5HENA 4PKLA 3U5KA 5I88A 3SVGA 2DVQA 1X0JA 5E9KA 3QZTA 5IG6A 3LJWA 4QUTA 2F6NA 5CUDA 3HMEA 2R10A 4XUBA 4NRAA 5D3RA 5FFYA 5BT3A 5HQ6A 5D3TA 5G4SA 5L98A 3NXBA 4CUSA 2GRCA 5E74A 5E9LA 5E3DA 4QZSA 4YK0A 2FSAA 5FE2A 5CQ4A 4NR6A 4UIWA 4UYFA 4WIVA 5F60A 3JVKA 3GG3A 4O77A 4NR8A 5A82A 5D26A 4XUAA 5TCMA 4QSSA 4UIVA 5I7YA 5F2PA 2YELA 5DYAA 3U5NA 2L84A 5HRXA 5CQTA 5CUCA 2LSPB 3LQJA 5LKXA 4NRBA 4QR4A 5DFDA 4YYIA 4HXMA 4N3WA 5CP5A 4HXRA 4OGIA 4C66A 4QR5A 4BW2A 1EQFA 4TU4A 1F68A 2D9EA 3UVWA 5H1TA 5EV9A 3UVXA 4IOQA 5F62A 2RI7A 3QZVA 4O76A 4PS5A 5FDZA 5LKUA 4NQNA 5HRWA 3RCWA 4A9LA 4Z6IA 4O75A 4XY8A 5LJ1A 3MB3A 4NR9A 5L8TA 3S92A 5DYCA 5JI8A 4QSTA 4TTEA 5FE4A 4CUPA 5LVRA 5A5PA 4YYGA 4IR3A 5C89A 4AKNA 3O37A 5LUUA 4J0SA 2YDWA 5LJ2A 4LZSA 4QEVA 3DAIA 3TLPA 3P1EA 4GPJA 3IU5A 3U5OA 3G0LA 4Z93A 4RVRA 3O36A 4YYHA 5FB0A 1ZS5A 4HBYA 4HBWA 5E9VA 4CURA 5G4RA 5CPEA 5CQ5A 2RNXA 4QSXA 4YBTA 5EPBA 4XYAA 4BW1A 5ENIA 3AQAA 2RFJA 4J0RA 4QSUA 4MEPA 5A81A 2R0SA 4TT2A 5F25A 5FE6A 4O7CA 4BHWA 4LC2A 5ENBA 4QC3A 3SVHA 4HXLA 2DKWA 2WP1A 4LYSA 5EWWA 5A5SA 5EPRA 5LKZA 3Q2EA 4IR6A 2RS9B 2I8NA 4TT4A 5FE9A 4Q0NA 5H85A 4TZ8A 3ZYUA 4CUTA 3IU6A 4TZ2A 5FH7A 5E7DA 4J3IA 4NR5A 5IBNA 5CQ6A 2DVVA 2G4AA 4TYLA 5CU8A 4CFKA 4UIUA 4BW3A 1E6IA 4OUFA 5FBXA 4KV1A 4ZQLA 5HRVA 5EU1A 4UIXA 3P1DA 5KTXA 4A9KA 4MR3A 2OSSA 4MR6A 4KCXA 2WP2A 5C7NA 5IGNA 4QNSA 2DWWA 4O7BA 5CGPA 5DKHA 5FG6A 4HBXA 5FG4A 4YAXA 4CL9A 4ALGA 4BW4A 5IGMA 4WHUA 5IGKA 2RNWA 4NQMA 5J0DA 4YYJA 4TS8A 5ETDA 4LR6A 5FE5A 3MUKA 5HELA 2L85A 4QSPA 4YY6A 5E3GA 5HLSA 4YYNA 2D82A 4CUQA 5CUBA 5FB1A 4QYLA 5EICA 4Z6HA 5EGUA 4A9OA 4QR3A 5EWCA 4N4FA 5LVQA 5F3AA 4YBSA 4Z1QA 2RNYA 5E9IA 3U5PA 5DW1A 5KTWA 4QEWA 5CS8A 4NUCA 4N4IA 2DVSA 5D3NA 4QEUA 5TB6A 3UV2A 4A9FA 5HEMA 4F3IA 4QC1A 4OGJA 5D25A 4LDFA 3D7CA 3HMHA 3P1FA 4MR4A 5COIA 3JVJA 4O7EA 3S91A 5A5OA 4YATA 3MULA 5DW2A 5E9YA 4YABA 5D3LA 5CUGA 5L8UA 5EI4A 4NYVA 4O71A 5FH6A 4YYMA 4QYDA 4HXKA 5EWHA 5F5ZA 2YEKA 5D0CA 5I1QA 5HFRA 5CQ7A 5DY7A 2NXBA 1JSPB 5A83A 4UYHA 2YQDA 5L97A 5I83A 4A9IA 4LZRA 1JM4B 5EISA 3FKMX 3LQIA 4QB3A 4QY4A 4TU6A 4Z1SA 3HMFA 5FE7A 5EVAA 5F61A 4NUEA 4E96A 5D3PA 5CZGA 5C8GA 3I3JA 5FFVA 4QSVA 4YH3A 3ONIA 2YW5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N4H A;  5D3S A;  2N9G A;  2RO1 A;  5ACY A;  4Q0O A;  3JVM A;  4UIT A;  5D24 A;  4UYG A;  4MEO A;  5ENE A;  5C85 A;  2YYN A;  2I7K A;  4HBV A;  3UW9 A;  4WHW A;  4UIY A;  4NYX A;  5EQ1 A;  5CY9 A;  5KO4 A;  5CUA A;  4YC9 A;  4CLB A;  5LJ0 A;  5DLX A;  5I40 A;  5ENC A;  3JVL A;  5FH8 A;  5H1V A;  3MXF A;  4XY9 A;  3O33 A;  5ENJ A;  4O7F A;  4QUU A;  5FE3 A;  5F1H A;  5HQ5 A;  4A9M A;  4NR7 A;  3U5M A;  3LQH A;  4UYF B;  5ETB A;  4MEN A;  3G0J A;  5CQA A;  3U5J A;  5DFB A;  5BT5 A;  4MEQ A;  5CUE A;  5ENH A;  4YY4 A;  5EK9 A;  5EP7 A;  4DON A;  5DBM A;  5DX4 A;  4IOO A;  1WUG A;  5F36 A;  5DLZ A;  5KU3 A;  4N4G A;  4FLP A;  4C67 A;  4UYD A;  4HXS A;  4J1P A;  3P5O A;  4LYI A;  5IGL A;  3UVY A;  4PY6 A;  5E0R A;  4NUD A;  4O7A A;  3MQM A;  4A9E A;  3Q2F A;  4PCI A;  5IID A;  4UYE A;  5D7X A;  2L5E A;  3QZS A;  5I86 A;  4YYK A;  4YYD A;  3DWY A;  4O72 A;  5DYX A;  4MR5 A;  2DVR A;  4O70 A;  5DFC A;  5A5Q A;  5E73 A;  4NR4 A;  5CRZ A;  5F1L A;  3UV5 A;  5E9M A;  3O34 A;  4HXP A;  5AMF A;  4LZ2 A;  4LYW A;  5L99 A;  5FFW A;  5I89 A;  5II2 A;  2MJV B;  4NRC A;  5HJC A;  3U5L A;  4IR5 A;  2R0V A;  2OUO A;  4PCE A;  5FE1 A;  5LKT A;  5ENG A;  4O78 A;  5EPS A;  4NS5 A;  5CTL A;  4NXJ A;  5A85 A;  4HXO A;  5AD3 A;  4TT6 A;  3MB4 A;  5KTU A;  3LXJ A;  3O35 A;  5EWD A;  5CRM A;  2YEM A;  4PTB A;  5K29 A;  4ALH A;  4YH4 A;  5L96 A;  5DYU A;  5FE8 A;  2DAT A;  4ZW1 A;  4CUU A;  5A5R A;  1WUM A;  5I29 A;  5D3J A;  4YBM A;  4QSR A;  2E3K A;  5DKC A;  5FE0 A;  4QSQ A;  4A9J A;  5C4Q A;  5EM3 A;  5H1U A;  5DKD A;  4BJX A;  3K2J A;  2KTB B;  4QSW A;  5CQ8 A;  5F63 A;  5I80 A;  2R0Y A;  4Y03 A;  2E7N A;  5D3H A;  4KV4 A;  5A7C A;  5HFQ A;  3P1C A;  2F6J A;  4A9H A;  5EWV A;  5AME A;  5HM0 A;  5FG5 A;  4LRG A;  3SVF A;  3UVD A;  4IOR A;  5I7X A;  4HXN A;  4IR4 A;  4ZC9 A;  5A5N A;  4YAD A;  4QBM A;  4X2I A;  4NYW A;  4O74 A;  4UIZ A;  5KHM A;  1N72 A;  2H60 A;  3UV4 A;  5BT4 A;  2E7O A;  5EA1 A;  5CFW A;  5JWM A;  5HCL A;  5ENF A;  5HQ7 A;  2OO1 A;  4A9N A;  4TQN A;  5II1 A;  3AAD A;  5C87 A;  4CFL A;  5CQ3 A;  5AD2 A;  5HEN A;  4PKL A;  3U5K A;  5I88 A;  3SVG A;  2DVQ A;  1X0J A;  5E9K A;  3QZT A;  5IG6 A;  3LJW A;  4QUT A;  2F6N A;  5CUD A;  3HME A;  2R10 A;  4XUB A;  4NRA A;  5D3R A;  5FFY A;  5BT3 A;  5HQ6 A;  5D3T A;  5G4S A;  5L98 A;  3NXB A;  4CUS A;  2GRC A;  5E74 A;  5E9L A;  5E3D A;  4QZS A;  4YK0 A;  2FSA A;  5FE2 A;  5CQ4 A;  4NR6 A;  4UIW A;  4UYF A;  4WIV A;  5F60 A;  3JVK A;  3GG3 A;  4O77 A;  4NR8 A;  5A82 A;  5D26 A;  4XUA A;  5TCM A;  4QSS A;  4UIV A;  5I7Y A;  5F2P A;  2YEL A;  5DYA A;  3U5N A;  2L84 A;  5HRX A;  5CQT A;  5CUC A;  2LSP B;  3LQJ A;  5LKX A;  4NRB A;  4QR4 A;  5DFD A;  4YYI A;  4HXM A;  4N3W A;  5CP5 A;  4HXR A;  4OGI A;  4C66 A;  4QR5 A;  4BW2 A;  1EQF A;  4TU4 A;  1F68 A;  2D9E A;  3UVW A;  5H1T A;  5EV9 A;  3UVX A;  4IOQ A;  5F62 A;  2RI7 A;  3QZV A;  4O76 A;  4PS5 A;  5FDZ A;  5LKU A;  4NQN A;  5HRW A;  3RCW A;  4A9L A;  4Z6I A;  4O75 A;  4XY8 A;  5LJ1 A;  3MB3 A;  4NR9 A;  5L8T A;  3S92 A;  5DYC A;  5JI8 A;  4QST A;  4TTE A;  5FE4 A;  4CUP A;  5LVR A;  5A5P A;  4YYG A;  4IR3 A;  5C89 A;  4AKN A;  3O37 A;  5LUU A;  4J0S A;  2YDW A;  5LJ2 A;  4LZS A;  4QEV A;  3DAI A;  3TLP A;  3P1E A;  4GPJ A;  3IU5 A;  3U5O A;  3G0L A;  4Z93 A;  4RVR A;  3O36 A;  4YYH A;  5FB0 A;  1ZS5 A;  4HBY A;  4HBW A;  5E9V A;  4CUR A;  5G4R A;  5CPE A;  5CQ5 A;  2RNX A;  4QSX A;  4YBT A;  5EPB A;  4XYA A;  4BW1 A;  5ENI A;  3AQA A;  2RFJ A;  4J0R A;  4QSU A;  4MEP A;  5A81 A;  2R0S A;  4TT2 A;  5F25 A;  5FE6 A;  4O7C A;  4BHW A;  4LC2 A;  5ENB A;  4QC3 A;  3SVH A;  4HXL A;  2DKW A;  2WP1 A;  4LYS A;  5EWW A;  5A5S A;  5EPR A;  5LKZ A;  3Q2E A;  4IR6 A;  2RS9 B;  2I8N A;  4TT4 A;  5FE9 A;  4Q0N A;  5H85 A;  4TZ8 A;  3ZYU A;  4CUT A;  3IU6 A;  4TZ2 A;  5FH7 A;  5E7D A;  4J3I A;  4NR5 A;  5IBN A;  5CQ6 A;  2DVV A;  2G4A A;  4TYL A;  5CU8 A;  4CFK A;  4UIU A;  4BW3 A;  1E6I A;  4OUF A;  5FBX A;  4KV1 A;  4ZQL A;  5HRV A;  5EU1 A;  4UIX A;  3P1D A;  5KTX A;  4A9K A;  4MR3 A;  2OSS A;  4MR6 A;  4KCX A;  2WP2 A;  5C7N A;  5IGN A;  4QNS A;  2DWW A;  4O7B A;  5CGP A;  5DKH A;  5FG6 A;  4HBX A;  5FG4 A;  4YAX A;  4CL9 A;  4ALG A;  4BW4 A;  5IGM A;  4WHU A;  5IGK A;  2RNW A;  4NQM A;  5J0D A;  4YYJ A;  4TS8 A;  5ETD A;  4LR6 A;  5FE5 A;  3MUK A;  5HEL A;  2L85 A;  4QSP A;  4YY6 A;  5E3G A;  5HLS A;  4YYN A;  2D82 A;  4CUQ A;  5CUB A;  5FB1 A;  4QYL A;  5EIC A;  4Z6H A;  5EGU A;  4A9O A;  4QR3 A;  5EWC A;  4N4F A;  5LVQ A;  5F3A A;  4YBS A;  4Z1Q A;  2RNY A;  5E9I A;  3U5P A;  5DW1 A;  5KTW A;  4QEW A;  5CS8 A;  4NUC A;  4N4I A;  2DVS A;  5D3N A;  4QEU A;  5TB6 A;  3UV2 A;  4A9F A;  5HEM A;  4F3I A;  4QC1 A;  4OGJ A;  5D25 A;  4LDF A;  3D7C A;  3HMH A;  3P1F A;  4MR4 A;  5COI A;  3JVJ A;  4O7E A;  3S91 A;  5A5O A;  4YAT A;  3MUL A;  5DW2 A;  5E9Y A;  4YAB A;  5D3L A;  5CUG A;  5L8U A;  5EI4 A;  4NYV A;  4O71 A;  5FH6 A;  4YYM A;  4QYD A;  4HXK A;  5EWH A;  5F5Z A;  2YEK A;  5D0C A;  5I1Q A;  5HFR A;  5CQ7 A;  5DY7 A;  2NXB A;  1JSP B;  5A83 A;  4UYH A;  2YQD A;  5L97 A;  5I83 A;  4A9I A;  4LZR A;  1JM4 B;  5EIS A;  3FKM X;  3LQI A;  4QB3 A;  4QY4 A;  4TU6 A;  4Z1S A;  3HMF A;  5FE7 A;  5EVA A;  5F61 A;  4NUE A;  4E96 A;  5D3P A;  5CZG A;  5C8G A;  3I3J A;  5FFV A;  4QSV A;  4YH3 A;  3ONI A;  2YW5 A; 
#chains in the Genus database with same CATH topology
 4N4H A;  5D3S A;  2N9G A;  2RO1 A;  5ACY A;  4Q0O A;  2EJN A;  3JVM A;  4UIT A;  5D24 A;  4UYG A;  4MEO A;  5ENE A;  5C85 A;  2YYN A;  2I7K A;  4HBV A;  3UW9 A;  4WHW A;  4UIY A;  4NYX A;  5EQ1 A;  5CY9 A;  5KO4 A;  5CUA A;  4YC9 A;  4CLB A;  5LJ0 A;  5DLX A;  5I40 A;  5ENC A;  3JVL A;  5FH8 A;  5H1V A;  3MXF A;  4XY9 A;  3O33 A;  5ENJ A;  4O7F A;  4QUU A;  5FE3 A;  5F1H A;  5HQ5 A;  4A9M A;  4NR7 A;  3U5M A;  3LQH A;  4UYF B;  5ETB A;  4MEN A;  3G0J A;  5CQA A;  3U5J A;  5DFB A;  5BT5 A;  4MEQ A;  5CUE A;  5ENH A;  4YY4 A;  5EK9 A;  5EP7 A;  4DON A;  5DBM A;  3ERR A;  5DX4 A;  4IOO A;  1WUG A;  5F36 A;  5DLZ A;  5KU3 A;  4N4G A;  4FLP A;  4C67 A;  4UYD A;  4HXS A;  4J1P A;  3P5O A;  4LYI A;  5IGL A;  3UVY A;  4PY6 A;  5E0R A;  4NUD A;  4O7A A;  3MQM A;  4A9E A;  3Q2F A;  4PCI A;  5IID A;  4UYE A;  5D7X A;  2L5E A;  3QZS A;  5I86 A;  4YYK A;  4YYD A;  3DWY A;  4O72 A;  5DYX A;  4MR5 A;  2DVR A;  4O70 A;  5DFC A;  5A5Q A;  5E73 A;  4NR4 A;  5CRZ A;  5F1L A;  3UV5 A;  5E9M A;  3O34 A;  4AI6 A;  4HXP A;  5AMF A;  4LZ2 A;  4LYW A;  5L99 A;  5FFW A;  5I89 A;  5II2 A;  2MJV B;  4NRC A;  5HJC A;  3U5L A;  4IR5 A;  2R0V A;  2OUO A;  4AKG A;  4PCE A;  5FE1 A;  5LKT A;  5ENG A;  4O78 A;  5EPS A;  4NS5 A;  3VKH A;  5CTL A;  4NXJ A;  5A85 A;  4HXO A;  5AD3 A;  4TT6 A;  3MB4 A;  5KTU A;  3LXJ A;  3O35 A;  5EWD A;  5CRM A;  2YEM A;  4PTB A;  5K29 A;  4ALH A;  4YH4 A;  5L96 A;  5DYU A;  5FE8 A;  2DAT A;  4ZW1 A;  4CUU A;  5A5R A;  1WUM A;  5I29 A;  5D3J A;  4YBM A;  4QSR A;  2E3K A;  5DKC A;  5FE0 A;  4QSQ A;  4A9J A;  5C4Q A;  5EM3 A;  5H1U A;  5DKD A;  4BJX A;  3K2J A;  2KTB B;  4QSW A;  5CQ8 A;  5F63 A;  5I80 A;  2R0Y A;  4Y03 A;  2E7N A;  5D3H A;  4KV4 A;  5A7C A;  5HFQ A;  3VKG A;  3P1C A;  2F6J A;  4A9H A;  5EWV A;  5AME A;  5HM0 A;  5FG5 A;  4LRG A;  3SVF A;  3UVD A;  4IOR A;  5I7X A;  4HXN A;  4IR4 A;  4ZC9 A;  5A5N A;  4YAD A;  4QBM A;  4X2I A;  4NYW A;  4O74 A;  4UIZ A;  5KHM A;  1N72 A;  2H60 A;  3UV4 A;  5BT4 A;  2E7O A;  5EA1 A;  5CFW A;  5JWM A;  5HCL A;  5ENF A;  5HQ7 A;  2OO1 A;  4A9N A;  4TQN A;  5II1 A;  3AAD A;  5C87 A;  4CFL A;  5CQ3 A;  5AD2 A;  5HEN A;  4PKL A;  3U5K A;  5I88 A;  3SVG A;  2DVQ A;  1X0J A;  5E9K A;  3QZT A;  5IG6 A;  3LJW A;  4QUT A;  2F6N A;  5CUD A;  3HME A;  2R10 A;  4XUB A;  4NRA A;  5D3R A;  5FFY A;  5BT3 A;  5HQ6 A;  5D3T A;  5G4S A;  1ZKR A;  5L98 A;  3NXB A;  4CUS A;  2GRC A;  5E74 A;  5E9L A;  5E3D A;  4QZS A;  4YK0 A;  2FSA A;  5FE2 A;  1PUO A;  5CQ4 A;  4NR6 A;  4UIW A;  4UYF A;  4WIV A;  5F60 A;  3JVK A;  3D1B A;  3GG3 A;  4O77 A;  4NR8 A;  5A82 A;  5D26 A;  4XUA A;  5TCM A;  4QSS A;  4UIV A;  5I7Y A;  5F2P A;  2YEL A;  5DYA A;  3U5N A;  2L84 A;  5HRX A;  5CQT A;  5CUC A;  2LSP B;  3LQJ A;  5LKX A;  4NRB A;  4QR4 A;  5DFD A;  4YYI A;  4HXM A;  4N3W A;  5CP5 A;  4HXR A;  4OGI A;  4C66 A;  4QR5 A;  4BW2 A;  1EQF A;  4TU4 A;  1F68 A;  2D9E A;  3UVW A;  5H1T A;  4AKH A;  5EV9 A;  3UVX A;  4IOQ A;  5F62 A;  3D1D A;  2RI7 A;  3QZV A;  4O76 A;  4PS5 A;  5FDZ A;  5LKU A;  4NQN A;  5HRW A;  3RCW A;  4A9L A;  4Z6I A;  4O75 A;  4XY8 A;  5LJ1 A;  3MB3 A;  4NR9 A;  5L8T A;  3S92 A;  5DYC A;  5JI8 A;  4QST A;  4TTE A;  4AKI A;  5FE4 A;  4CUP A;  5LVR A;  5A5P A;  4YYG A;  4IR3 A;  5C89 A;  4AKN A;  3O37 A;  5LUU A;  4J0S A;  2YDW A;  5LJ2 A;  4LZS A;  4QEV A;  3DAI A;  3TLP A;  3P1E A;  4GPJ A;  3IU5 A;  3U5O A;  3G0L A;  4Z93 A;  4RVR A;  3O36 A;  4YYH A;  5FB0 A;  1ZS5 A;  4HBY A;  4HBW A;  5E9V A;  4CUR A;  5G4R A;  5CPE A;  5CQ5 A;  2RNX A;  4QSX A;  4YBT A;  5EPB A;  4XYA A;  4BW1 A;  5ENI A;  3AQA A;  2RFJ A;  4J0R A;  4QSU A;  4MEP A;  5A81 A;  2R0S A;  4TT2 A;  5F25 A;  5FE6 A;  4O7C A;  4BHW A;  4LC2 A;  5ENB A;  4QC3 A;  3SVH A;  4HXL A;  2DKW A;  2WP1 A;  4LYS A;  5EWW A;  5A5S A;  5EPR A;  5LKZ A;  3Q2E A;  4IR6 A;  2RS9 B;  2I8N A;  4TT4 A;  5FE9 A;  4Q0N A;  5H85 A;  4TZ8 A;  3ZYU A;  4CUT A;  3IU6 A;  4TZ2 A;  5FH7 A;  5E7D A;  4J3I A;  4NR5 A;  5IBN A;  5CQ6 A;  2DVV A;  2G4A A;  4TYL A;  5CU8 A;  4CFK A;  4UIU A;  4BW3 A;  1E6I A;  4OUF A;  5FBX A;  4KV1 A;  4ZQL A;  5HRV A;  5EU1 A;  4UIX A;  3P1D A;  5KTX A;  4A9K A;  4MR3 A;  2OSS A;  4MR6 A;  4KCX A;  2WP2 A;  5C7N A;  5IGN A;  4QNS A;  2DWW A;  4O7B A;  5CGP A;  5DKH A;  5FG6 A;  4HBX A;  5FG4 A;  4YAX A;  4CL9 A;  4ALG A;  4BW4 A;  5IGM A;  4WHU A;  5IGK A;  2RNW A;  4NQM A;  5J0D A;  4YYJ A;  4TS8 A;  5ETD A;  4LR6 A;  5FE5 A;  3MUK A;  5HEL A;  2L85 A;  4QSP A;  4YY6 A;  5E3G A;  5HLS A;  4YYN A;  2D82 A;  4CUQ A;  5CUB A;  5FB1 A;  4QYL A;  5EIC A;  4Z6H A;  5EGU A;  4A9O A;  4QR3 A;  5EWC A;  4N4F A;  5LVQ A;  5F3A A;  4YBS A;  4Z1Q A;  2RNY A;  5E9I A;  3U5P A;  5DW1 A;  5KTW A;  4QEW A;  5CS8 A;  4NUC A;  4N4I A;  2DVS A;  5D3N A;  4QEU A;  5TB6 A;  3UV2 A;  4A9F A;  5HEM A;  4F3I A;  4QC1 A;  4OGJ A;  5D25 A;  4LDF A;  3D7C A;  3HMH A;  3P1F A;  4MR4 A;  5COI A;  3JVJ A;  4O7E A;  3S91 A;  5A5O A;  4YAT A;  3MUL A;  5DW2 A;  5E9Y A;  4YAB A;  5D3L A;  5CUG A;  5L8U A;  5EI4 A;  4NYV A;  4O71 A;  5FH6 A;  4YYM A;  4QYD A;  4HXK A;  5EWH A;  5F5Z A;  2YEK A;  5D0C A;  5I1Q A;  5HFR A;  5CQ7 A;  5DY7 A;  2NXB A;  1JSP B;  5A83 A;  4UYH A;  2YQD A;  5L97 A;  5I83 A;  4A9I A;  4LZR A;  1JM4 B;  5EIS A;  3FKM X;  3LQI A;  4QB3 A;  4QY4 A;  4TU6 A;  4Z1S A;  3HMF A;  5FE7 A;  5EVA A;  5F61 A;  4NUE A;  4E96 A;  5D3P A;  5CZG A;  5C8G A;  3I3J A;  5FFV A;  4QSV A;  4YH3 A;  3ONI A;  2YW5 A; 
#chains in the Genus database with same CATH homology
 4N4H A;  5D3S A;  2N9G A;  2RO1 A;  5ACY A;  4Q0O A;  3JVM A;  4UIT A;  5D24 A;  4UYG A;  4MEO A;  5ENE A;  5C85 A;  2YYN A;  2I7K A;  4HBV A;  3UW9 A;  4WHW A;  4UIY A;  4NYX A;  5EQ1 A;  5CY9 A;  5KO4 A;  5CUA A;  4YC9 A;  4CLB A;  5LJ0 A;  5DLX A;  5I40 A;  5ENC A;  3JVL A;  5FH8 A;  5H1V A;  3MXF A;  4XY9 A;  3O33 A;  5ENJ A;  4O7F A;  4QUU A;  5FE3 A;  5F1H A;  5HQ5 A;  4A9M A;  4NR7 A;  3U5M A;  3LQH A;  4UYF B;  5ETB A;  4MEN A;  3G0J A;  5CQA A;  3U5J A;  5DFB A;  5BT5 A;  4MEQ A;  5CUE A;  5ENH A;  4YY4 A;  5EK9 A;  5EP7 A;  4DON A;  5DBM A;  5DX4 A;  4IOO A;  1WUG A;  5F36 A;  5DLZ A;  5KU3 A;  4N4G A;  4FLP A;  4C67 A;  4UYD A;  4HXS A;  4J1P A;  3P5O A;  4LYI A;  5IGL A;  3UVY A;  4PY6 A;  5E0R A;  4NUD A;  4O7A A;  3MQM A;  4A9E A;  3Q2F A;  4PCI A;  5IID A;  4UYE A;  5D7X A;  2L5E A;  3QZS A;  5I86 A;  4YYK A;  4YYD A;  3DWY A;  4O72 A;  5DYX A;  4MR5 A;  2DVR A;  4O70 A;  5DFC A;  5A5Q A;  5E73 A;  4NR4 A;  5CRZ A;  5F1L A;  3UV5 A;  5E9M A;  3O34 A;  4HXP A;  5AMF A;  4LZ2 A;  4LYW A;  5L99 A;  5FFW A;  5I89 A;  5II2 A;  2MJV B;  4NRC A;  5HJC A;  3U5L A;  4IR5 A;  2R0V A;  2OUO A;  4PCE A;  5FE1 A;  5LKT A;  5ENG A;  4O78 A;  5EPS A;  4NS5 A;  5CTL A;  4NXJ A;  5A85 A;  4HXO A;  5AD3 A;  4TT6 A;  3MB4 A;  5KTU A;  3LXJ A;  3O35 A;  5EWD A;  5CRM A;  2YEM A;  4PTB A;  5K29 A;  4ALH A;  4YH4 A;  5L96 A;  5DYU A;  5FE8 A;  2DAT A;  4ZW1 A;  4CUU A;  5A5R A;  1WUM A;  5I29 A;  5D3J A;  4YBM A;  4QSR A;  2E3K A;  5DKC A;  5FE0 A;  4QSQ A;  4A9J A;  5C4Q A;  5EM3 A;  5H1U A;  5DKD A;  4BJX A;  3K2J A;  2KTB B;  4QSW A;  5CQ8 A;  5F63 A;  5I80 A;  2R0Y A;  4Y03 A;  2E7N A;  5D3H A;  4KV4 A;  5A7C A;  5HFQ A;  3P1C A;  2F6J A;  4A9H A;  5EWV A;  5AME A;  5HM0 A;  5FG5 A;  4LRG A;  3SVF A;  3UVD A;  4IOR A;  5I7X A;  4HXN A;  4IR4 A;  4ZC9 A;  5A5N A;  4YAD A;  4QBM A;  4X2I A;  4NYW A;  4O74 A;  4UIZ A;  5KHM A;  1N72 A;  2H60 A;  3UV4 A;  5BT4 A;  2E7O A;  5EA1 A;  5CFW A;  5JWM A;  5HCL A;  5ENF A;  5HQ7 A;  2OO1 A;  4A9N A;  4TQN A;  5II1 A;  3AAD A;  5C87 A;  4CFL A;  5CQ3 A;  5AD2 A;  5HEN A;  4PKL A;  3U5K A;  5I88 A;  3SVG A;  2DVQ A;  1X0J A;  5E9K A;  3QZT A;  5IG6 A;  3LJW A;  4QUT A;  2F6N A;  5CUD A;  3HME A;  2R10 A;  4XUB A;  4NRA A;  5D3R A;  5FFY A;  5BT3 A;  5HQ6 A;  5D3T A;  5G4S A;  5L98 A;  3NXB A;  4CUS A;  2GRC A;  5E74 A;  5E9L A;  5E3D A;  4QZS A;  4YK0 A;  2FSA A;  5FE2 A;  5CQ4 A;  4NR6 A;  4UIW A;  4UYF A;  4WIV A;  5F60 A;  3JVK A;  3GG3 A;  4O77 A;  4NR8 A;  5A82 A;  5D26 A;  4XUA A;  5TCM A;  4QSS A;  4UIV A;  5I7Y A;  5F2P A;  2YEL A;  5DYA A;  3U5N A;  2L84 A;  5HRX A;  5CQT A;  5CUC A;  2LSP B;  3LQJ A;  5LKX A;  4NRB A;  4QR4 A;  5DFD A;  4YYI A;  4HXM A;  4N3W A;  5CP5 A;  4HXR A;  4OGI A;  4C66 A;  4QR5 A;  4BW2 A;  1EQF A;  4TU4 A;  1F68 A;  2D9E A;  3UVW A;  5H1T A;  5EV9 A;  3UVX A;  4IOQ A;  5F62 A;  2RI7 A;  3QZV A;  4O76 A;  4PS5 A;  5FDZ A;  5LKU A;  4NQN A;  5HRW A;  3RCW A;  4A9L A;  4Z6I A;  4O75 A;  4XY8 A;  5LJ1 A;  3MB3 A;  4NR9 A;  5L8T A;  3S92 A;  5DYC A;  5JI8 A;  4QST A;  4TTE A;  5FE4 A;  4CUP A;  5LVR A;  5A5P A;  4YYG A;  4IR3 A;  5C89 A;  4AKN A;  3O37 A;  5LUU A;  4J0S A;  2YDW A;  5LJ2 A;  4LZS A;  4QEV A;  3DAI A;  3TLP A;  3P1E A;  4GPJ A;  3IU5 A;  3U5O A;  3G0L A;  4Z93 A;  4RVR A;  3O36 A;  4YYH A;  5FB0 A;  1ZS5 A;  4HBY A;  4HBW A;  5E9V A;  4CUR A;  5G4R A;  5CPE A;  5CQ5 A;  2RNX A;  4QSX A;  4YBT A;  5EPB A;  4XYA A;  4BW1 A;  5ENI A;  3AQA A;  2RFJ A;  4J0R A;  4QSU A;  4MEP A;  5A81 A;  2R0S A;  4TT2 A;  5F25 A;  5FE6 A;  4O7C A;  4BHW A;  4LC2 A;  5ENB A;  4QC3 A;  3SVH A;  4HXL A;  2DKW A;  2WP1 A;  4LYS A;  5EWW A;  5A5S A;  5EPR A;  5LKZ A;  3Q2E A;  4IR6 A;  2RS9 B;  2I8N A;  4TT4 A;  5FE9 A;  4Q0N A;  5H85 A;  4TZ8 A;  3ZYU A;  4CUT A;  3IU6 A;  4TZ2 A;  5FH7 A;  5E7D A;  4J3I A;  4NR5 A;  5IBN A;  5CQ6 A;  2DVV A;  2G4A A;  4TYL A;  5CU8 A;  4CFK A;  4UIU A;  4BW3 A;  1E6I A;  4OUF A;  5FBX A;  4KV1 A;  4ZQL A;  5HRV A;  5EU1 A;  4UIX A;  3P1D A;  5KTX A;  4A9K A;  4MR3 A;  2OSS A;  4MR6 A;  4KCX A;  2WP2 A;  5C7N A;  5IGN A;  4QNS A;  2DWW A;  4O7B A;  5CGP A;  5DKH A;  5FG6 A;  4HBX A;  5FG4 A;  4YAX A;  4CL9 A;  4ALG A;  4BW4 A;  5IGM A;  4WHU A;  5IGK A;  2RNW A;  4NQM A;  5J0D A;  4YYJ A;  4TS8 A;  5ETD A;  4LR6 A;  5FE5 A;  3MUK A;  5HEL A;  2L85 A;  4QSP A;  4YY6 A;  5E3G A;  5HLS A;  4YYN A;  2D82 A;  4CUQ A;  5CUB A;  5FB1 A;  4QYL A;  5EIC A;  4Z6H A;  5EGU A;  4A9O A;  4QR3 A;  5EWC A;  4N4F A;  5LVQ A;  5F3A A;  4YBS A;  4Z1Q A;  2RNY A;  5E9I A;  3U5P A;  5DW1 A;  5KTW A;  4QEW A;  5CS8 A;  4NUC A;  4N4I A;  2DVS A;  5D3N A;  4QEU A;  5TB6 A;  3UV2 A;  4A9F A;  5HEM A;  4F3I A;  4QC1 A;  4OGJ A;  5D25 A;  4LDF A;  3D7C A;  3HMH A;  3P1F A;  4MR4 A;  5COI A;  3JVJ A;  4O7E A;  3S91 A;  5A5O A;  4YAT A;  3MUL A;  5DW2 A;  5E9Y A;  4YAB A;  5D3L A;  5CUG A;  5L8U A;  5EI4 A;  4NYV A;  4O71 A;  5FH6 A;  4YYM A;  4QYD A;  4HXK A;  5EWH A;  5F5Z A;  2YEK A;  5D0C A;  5I1Q A;  5HFR A;  5CQ7 A;  5DY7 A;  2NXB A;  1JSP B;  5A83 A;  4UYH A;  2YQD A;  5L97 A;  5I83 A;  4A9I A;  4LZR A;  1JM4 B;  5EIS A;  3FKM X;  3LQI A;  4QB3 A;  4QY4 A;  4TU6 A;  4Z1S A;  3HMF A;  5FE7 A;  5EVA A;  5F61 A;  4NUE A;  4E96 A;  5D3P A;  5CZG A;  5C8G A;  3I3J A;  5FFV A;  4QSV A;  4YH3 A;  3ONI A;  2YW5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...