4NXJA

Crystal structure of pf3d7_1475600, a bromodomain from plasmodium falciparum
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
118
structure length
118
Chain Sequence
GYDEIEELKSKNEVLTNLLNKLIAFDKKRIFLYPVNVQLVPDYLNVIKEPMDFTTMKQKLQNFKYKSFQEFEKDVLLIINNCYTYNDPSTIYYKFAEDIETYYKKLNIKIQTKYMNIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bromodomain protein
publication title Crystal Structure of PF3D7_1475600, a bromodomain from Plasmodium Falciparum
rcsb
source organism Plasmodium falciparum
molecule tags Dna binding protein
total genus 43
structure length 118
sequence length 118
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4nxjA00
4LYIA 4J3IA 5I83A 4XYAA 4XUAA 5I7YA 3LQIA 4YY6A 5H1UA 4A9HA 3SVHA 4X2IA 2D82A 5EISA 4QC1A 4E96A 5I1QA 4UYHA 4NUDA 4NXJA 5E9LA 5ENCA 4NR7A 3UV2A 3DWYA 1WUMA 4IR6A 3U5LA 5HCLA 5CUGA 4ZW1A 4TZ2A 5H1VA 3QZVA 2I7KA 4CFKA 4NRBA 4HXKA 5FFYA 3HMHA 5EM3A 4QEVA 2D9EA 5EP7A 4QSXA 5CUEA 4CL9A 5F25A 4TQNA 5A5NA 5HEMA 5EGUA 4BW3A 4HBXA 2L5EA 2RFJA 3U5OA 3O36A 5E7DA 4BJXA 3K2JA 5TB6A 4NR4A 5KTWA 5D3TA 4J0RA 4PKLA 3I3JA 5EK9A 3QZTA 3NXBA 5F61A 5A83A 4HBVA 4O7AA 5I7XA 5DFCA 3UVXA 2NXBA 2DWWA 5LVRA 4YBMA 4UIYA 4LDFA 4MEPA 5ENEA 4O78A 4F3IA 4MENA 5IGNA 4UITA 2I8NA 4ZC9A 5FE6A 5FG6A 2YDWA 5C85A 4O7BA 5L8UA 4Z93A 4CLBA 2E3KA 4C66A 2L85A 4CUQA 3JVMA 5F2PA 2YEMA 4UIUA 5BT5A 4NRCA 4O77A 4UYFB 4BW1A 4ALHA 4IR3A 5II2A 3MB4A 4LYSA 4QUTA 4MR3A 4PCIA 5CQ7A 1EQFA 5AD3A 5I80A 4RVRA 4NQNA 4A9LA 2F6NA 4QSUA 5FB0A 5DYUA 5J0DA 3MULA 4ZQLA 2G4AA 3AADA 5C4QA 5FE7A 5ENBA 3UVYA 4NQMA 3P1CA 4HXLA 5G4SA 4QR5A 1ZS5A 5E9KA 5EV9A 5EVAA 4OGJA 4UYGA 5EU1A 5CZGA 5AMFA 4KV1A 5LJ2A 2L84A 4NR5A 5CTLA 4XUBA 4A9FA 5LJ0A 4TT2A 5DKCA 4NR6A 4HXMA 5I89A 4MR4A 4O7EA 3G0LA 4NS5A 4Z6IA 4UYDA 4QSTA 5KU3A 5IG6A 5CUBA 5DYXA 5FH8A 3Q2EA 4UIWA 5LVQA 2YEKA 5C87A 2DKWA 5A82A 5AD2A 3O33A 5D24A 4LZSA 3U5KA 2OSSA 5A7CA 5CFWA 2F6JA 3P1FA 4TT4A 4YH3A 5IGKA 5E9YA 5DKDA 5E9VA 4UYEA 5A5PA 3ONIA 3TLPA 5DKHA 1WUGA 4IOOA 2OUOA 3JVJA 4HXNA 2LSPB 4QYLA 4TTEA 5D3JA 2R10A 3Q2FA 5F5ZA 5EI4A 4Z1SA 4QEUA 4IR5A 4Q0OA 5E9MA 4A9NA 4C67A 5F60A 3LQHA 5EWCA 5CRMA 5II1A 5L97A 5CRZA 4WIVA 3GG3A 2DVRA 3O35A 4N4FA 3QZSA 4TU4A 3P1EA 4QEWA 3P5OA 2RO1A 4O74A 2E7NA 4TYLA 5CPEA 5HRXA 5D3PA 5FE0A 5ENFA 5HLSA 4O70A 4J0SA 5D7XA 3MQMA 5JI8A 4TS8A 2KTBB 5E3DA 5D3HA 5CS8A 2R0YA 2RNXA 4YYHA 5EPRA 5HQ5A 1F68A 4HBYA 4CFLA 4KV4A 5EWWA 4UIXA 4QZSA 4J1PA 4N4IA 4YY4A 5CQ5A 3MB3A 1X0JA 5FB1A 4Q0NA 5EPBA 3UVDA 5CQTA 5A85A 2RNYA 4OUFA 2RNWA 2DVSA 5LKZA 5D3LA 5CQ8A 4NUEA 5LKXA 5CP5A 3U5PA 4A9MA 2FSAA 4LR6A 5KHMA 2WP2A 4QBMA 2MJVB 1JM4B 2DVQA 5ACYA 2YELA 4LRGA 4QC3A 4KCXA 5C89A 4DONA 4QSWA 4NYVA 4YH4A 4MR6A 5KTUA 2YQDA 5BT4A 4PCEA 4Z1QA 5FE4A 5I88A 5CGPA 3SVFA 3P1DA 4WHUA 4CUUA 5BT3A 4UIVA 4A9OA 5C7NA 3UV4A 5D26A 5D0CA 5EQ1A 4NYWA 5A5QA 4HXPA 4HXOA 4QUUA 4O72A 4YYDA 5D3NA 5IBNA 5E3GA 4YC9A 2OO1A 2WP1A 5ENHA 5FG5A 4PS5A 5FBXA 5L96A 5CQ4A 5LUUA 5F1LA 5JWMA 4PY6A 5CU8A 5F63A 5HELA 3RCWA 3UVWA 4CUTA 4QNSA 5L99A 4MEOA 5DFBA 3ZYUA 5A5OA 4YABA 2YYNA 3D7CA 5E9IA 5E0RA 4AKNA 5ENJA 4Y03A 4LC2A 5IGMA 5EPSA 3O37A 5H1TA 4QSRA 4QYDA 5I29A 4QSPA 4A9EA 5A5SA 4A9IA 5HQ6A 5FE3A 5CQ6A 5K29A 5HRVA 3HMEA 5G4RA 5F62A 4CURA 5FE1A 4LZRA 5DLXA 5A5RA 4YYKA 4WHWA 3LXJA 4O75A 5EA1A 5ENGA 2DATA 5CY9A 5D3SA 5A81A 4O7CA 4NYXA 4BW4A 4BHWA 3UV5A 3IU5A 5DW1A 4UYFA 4YYGA 1E6IA 4QB3A 5DBMA 5EWDA 4HBWA 5DLZA 4CUSA 4TT6A 1N72A 4OGIA 4UIZA 4HXRA 5FH7A 4NR8A 5ETDA 5F1HA 2N9GA 4TU6A 5I86A 3U5MA 5DFDA 4N3WA 5DYCA 5D3RA 5CQ3A 4O76A 2DVVA 5FE9A 5E73A 5EWHA 4QY4A 5D25A 4YAXA 5HFRA 3S92A 3MXFA 3DAIA 5HENA 4A9JA 4IOQA 2GRCA 4BW2A 5LKTA 5L8TA 4LYWA 4O7FA 2R0SA 4YK0A 5CUCA 5DY7A 3G0JA 4XY8A 4YBSA 4YYNA 5FH6A 3FKMX 2H60A 4Z6HA 5IIDA 4YATA 4YYMA 4XY9A 5HRWA 3U5NA 4QSVA 4N4HA 3S91A 3JVLA 4HXSA 3SVGA 5C8GA 4NR9A 4LZ2A 4FLPA 5L98A 5FFVA 5F36A 4YYJA 1JSPB 5E74A 4A9KA 4GPJA 5FG4A 4MEQA 5DW2A 4QSSA 5CQAA 5EICA 5HM0A 2RI7A 5KTXA 4NUCA 4PTBA 3LQJA 5HFQA 3UW9A 3JVKA 2E7OA 5FE8A 4IR4A 5FE2A 5KO4A 4QR4A 5FE5A 2R0VA 5HQ7A 5H85A 4O71A 5LJ1A 5ENIA 4QR3A 5CUAA 5LKUA 3AQAA 5DX4A 4TZ8A 2YW5A 3O34A 3IU6A 5COIA 4MR5A 5CUDA 3HMFA 5I40A 4QSQA 4IORA 5FFWA 3LJWA 4CUPA 4N4GA 2RS9B 4YADA 5EWVA 5FDZA 4NRAA 5IGLA 5TCMA 3U5JA 5HJCA 5AMEA 4ALGA 3MUKA 5ETBA 4YYIA 4YBTA 5F3AA 5DYAA
chains in the Genus database with same CATH superfamily
4LYIA 4J3IA 3VKHA 5I83A 4XYAA 4XUAA 5I7YA 3LQIA 4YY6A 5H1UA 4A9HA 3SVHA 4X2IA 2D82A 5EISA 4QC1A 4E96A 5I1QA 4UYHA 4NUDA 4NXJA 5E9LA 5ENCA 4NR7A 3UV2A 3DWYA 1WUMA 4IR6A 3U5LA 5HCLA 5CUGA 4ZW1A 4TZ2A 5H1VA 3QZVA 2I7KA 4CFKA 4NRBA 4HXKA 5FFYA 3HMHA 5EM3A 4QEVA 2D9EA 5EP7A 4QSXA 5CUEA 4CL9A 5F25A 4TQNA 5A5NA 5HEMA 5EGUA 4BW3A 4HBXA 2L5EA 2RFJA 3U5OA 3O36A 5E7DA 4BJXA 3K2JA 5TB6A 4NR4A 5KTWA 5D3TA 4J0RA 4PKLA 3I3JA 5EK9A 3QZTA 3NXBA 5F61A 5A83A 4HBVA 4O7AA 5I7XA 5DFCA 3UVXA 2NXBA 2DWWA 5LVRA 4YBMA 4UIYA 4LDFA 4MEPA 5ENEA 4O78A 4F3IA 4MENA 5IGNA 4UITA 2I8NA 4ZC9A 5FE6A 5FG6A 2YDWA 5C85A 4O7BA 5L8UA 4Z93A 4CLBA 2E3KA 4C66A 2L85A 4CUQA 3JVMA 5F2PA 2YEMA 4UIUA 5BT5A 4NRCA 4O77A 4UYFB 4BW1A 4ALHA 4IR3A 5II2A 3MB4A 4LYSA 4QUTA 4MR3A 4PCIA 5CQ7A 1EQFA 5AD3A 3ERRA 5I80A 4RVRA 4NQNA 4A9LA 2F6NA 4QSUA 5FB0A 5DYUA 5J0DA 3MULA 4ZQLA 2G4AA 3AADA 5C4QA 5FE7A 5ENBA 3UVYA 4NQMA 3P1CA 4HXLA 5G4SA 4QR5A 1ZS5A 5E9KA 5EV9A 5EVAA 4OGJA 4UYGA 5EU1A 5CZGA 5AMFA 4KV1A 5LJ2A 2L84A 4NR5A 5CTLA 4XUBA 4A9FA 5LJ0A 4TT2A 5DKCA 4NR6A 4HXMA 5I89A 4MR4A 4O7EA 3G0LA 4NS5A 4Z6IA 4UYDA 4QSTA 5KU3A 5IG6A 5CUBA 5DYXA 5FH8A 3Q2EA 4UIWA 5LVQA 2YEKA 5C87A 2DKWA 5A82A 5AD2A 3O33A 5D24A 4LZSA 3U5KA 2OSSA 5A7CA 5CFWA 2F6JA 3P1FA 4TT4A 4YH3A 5IGKA 5E9YA 5DKDA 5E9VA 4UYEA 5A5PA 3ONIA 3TLPA 5DKHA 1WUGA 4IOOA 2OUOA 3JVJA 4HXNA 2LSPB 4QYLA 4TTEA 5D3JA 2R10A 3Q2FA 5F5ZA 5EI4A 4Z1SA 4QEUA 4IR5A 4Q0OA 5E9MA 4A9NA 4C67A 5F60A 1PUOA 3LQHA 5EWCA 5CRMA 5II1A 5L97A 5CRZA 4WIVA 3GG3A 2DVRA 3O35A 4N4FA 3QZSA 4TU4A 3P1EA 4QEWA 3P5OA 2RO1A 4O74A 2E7NA 4TYLA 5CPEA 5HRXA 5D3PA 5FE0A 3D1DA 5ENFA 5HLSA 4O70A 4J0SA 5D7XA 3MQMA 5JI8A 4TS8A 2KTBB 5E3DA 5D3HA 5CS8A 2R0YA 2RNXA 4YYHA 5EPRA 5HQ5A 1F68A 4HBYA 4CFLA 4KV4A 5EWWA 4UIXA 4QZSA 4J1PA 4N4IA 4YY4A 5CQ5A 3MB3A 1X0JA 5FB1A 4Q0NA 5EPBA 3UVDA 5CQTA 5A85A 2RNYA 4OUFA 2RNWA 2DVSA 5LKZA 5D3LA 5CQ8A 4NUEA 5LKXA 5CP5A 3U5PA 4A9MA 2FSAA 4LR6A 5KHMA 2WP2A 4QBMA 2MJVB 1JM4B 2DVQA 5ACYA 2YELA 4LRGA 4QC3A 4KCXA 5C89A 4DONA 4QSWA 4NYVA 4YH4A 4MR6A 5KTUA 2YQDA 5BT4A 1ZKRA 4PCEA 4Z1QA 5FE4A 5I88A 5CGPA 3SVFA 3P1DA 4WHUA 4CUUA 5BT3A 4UIVA 4A9OA 5C7NA 3UV4A 5D26A 5D0CA 5EQ1A 4NYWA 5A5QA 4HXPA 4AI6A 4HXOA 4QUUA 4O72A 4YYDA 5D3NA 5IBNA 5E3GA 4YC9A 2OO1A 2WP1A 5ENHA 5FG5A 4PS5A 5FBXA 5L96A 5CQ4A 5LUUA 5F1LA 5JWMA 4PY6A 5CU8A 5F63A 5HELA 3RCWA 3UVWA 4CUTA 4QNSA 5L99A 4MEOA 5DFBA 3ZYUA 5A5OA 4YABA 2YYNA 3D7CA 5E9IA 5E0RA 4AKNA 5ENJA 4Y03A 4LC2A 5IGMA 5EPSA 3O37A 5H1TA 4QSRA 4QYDA 5I29A 4QSPA 4A9EA 5A5SA 4A9IA 5HQ6A 5FE3A 5CQ6A 5K29A 5HRVA 3HMEA 5G4RA 5F62A 4CURA 5FE1A 4LZRA 5DLXA 5A5RA 4YYKA 4WHWA 3LXJA 4O75A 5EA1A 5ENGA 2DATA 5CY9A 5D3SA 5A81A 4O7CA 4NYXA 4BW4A 4BHWA 3UV5A 3IU5A 5DW1A 4UYFA 4YYGA 1E6IA 4QB3A 5DBMA 5EWDA 4HBWA 5DLZA 4CUSA 4TT6A 1N72A 4OGIA 4UIZA 4HXRA 5FH7A 4NR8A 4AKHA 3D1BA 5ETDA 5F1HA 2N9GA 4TU6A 5I86A 3U5MA 5DFDA 4N3WA 5DYCA 4AKGA 5D3RA 5CQ3A 4O76A 2DVVA 3VKGA 5FE9A 5E73A 5EWHA 4QY4A 2EJNA 5D25A 4AKIA 4YAXA 5HFRA 3S92A 3MXFA 3DAIA 5HENA 4A9JA 4IOQA 2GRCA 4BW2A 5LKTA 5L8TA 4LYWA 4O7FA 2R0SA 4YK0A 5CUCA 5DY7A 3G0JA 4XY8A 4YBSA 4YYNA 5FH6A 3FKMX 2H60A 4Z6HA 5IIDA 4YATA 4YYMA 4XY9A 5HRWA 3U5NA 4QSVA 4N4HA 3S91A 3JVLA 4HXSA 3SVGA 5C8GA 4NR9A 4LZ2A 4FLPA 5L98A 5FFVA 5F36A 4YYJA 1JSPB 5E74A 4A9KA 4GPJA 5FG4A 4MEQA 5DW2A 4QSSA 5CQAA 5EICA 5HM0A 2RI7A 5KTXA 4NUCA 4PTBA 3LQJA 5HFQA 3UW9A 3JVKA 2E7OA 5FE8A 4IR4A 5FE2A 5KO4A 4QR4A 5FE5A 2R0VA 5HQ7A 5H85A 4O71A 5LJ1A 5ENIA 4QR3A 5CUAA 5LKUA 3AQAA 5DX4A 4TZ8A 2YW5A 3O34A 3IU6A 5COIA 4MR5A 5CUDA 3HMFA 5I40A 4QSQA 4IORA 5FFWA 3LJWA 4CUPA 4N4GA 2RS9B 4YADA 5EWVA 5FDZA 4NRAA 5IGLA 5TCMA 3U5JA 5HJCA 5AMEA 4ALGA 3MUKA 5ETBA 4YYIA 4YBTA 5F3AA 5DYAA
chains in the Genus database with same CATH topology
4LYIA 4J3IA 5I83A 4XYAA 4XUAA 5I7YA 3LQIA 4YY6A 5H1UA 4A9HA 3SVHA 4X2IA 2D82A 5EISA 4QC1A 4E96A 5I1QA 4UYHA 4NUDA 4NXJA 5E9LA 5ENCA 4NR7A 3UV2A 3DWYA 1WUMA 4IR6A 3U5LA 5HCLA 5CUGA 4ZW1A 4TZ2A 5H1VA 3QZVA 2I7KA 4CFKA 4NRBA 4HXKA 5FFYA 3HMHA 5EM3A 4QEVA 2D9EA 5EP7A 4QSXA 5CUEA 4CL9A 5F25A 4TQNA 5A5NA 5HEMA 5EGUA 4BW3A 4HBXA 2L5EA 2RFJA 3U5OA 3O36A 5E7DA 4BJXA 3K2JA 5TB6A 4NR4A 5KTWA 5D3TA 4J0RA 4PKLA 3I3JA 5EK9A 3QZTA 3NXBA 5F61A 5A83A 4HBVA 4O7AA 5I7XA 5DFCA 3UVXA 2NXBA 2DWWA 5LVRA 4YBMA 4UIYA 4LDFA 4MEPA 5ENEA 4O78A 4F3IA 4MENA 5IGNA 4UITA 2I8NA 4ZC9A 5FE6A 5FG6A 2YDWA 5C85A 4O7BA 5L8UA 4Z93A 4CLBA 2E3KA 4C66A 2L85A 4CUQA 3JVMA 5F2PA 2YEMA 4UIUA 5BT5A 4NRCA 4O77A 4UYFB 4BW1A 4ALHA 4IR3A 5II2A 3MB4A 4LYSA 4QUTA 4MR3A 4PCIA 5CQ7A 1EQFA 5AD3A 5I80A 4RVRA 4NQNA 4A9LA 2F6NA 4QSUA 5FB0A 5DYUA 5J0DA 3MULA 4ZQLA 2G4AA 3AADA 5C4QA 5FE7A 5ENBA 3UVYA 4NQMA 3P1CA 4HXLA 5G4SA 4QR5A 1ZS5A 5E9KA 5EV9A 5EVAA 4OGJA 4UYGA 5EU1A 5CZGA 5AMFA 4KV1A 5LJ2A 2L84A 4NR5A 5CTLA 4XUBA 4A9FA 5LJ0A 4TT2A 5DKCA 4NR6A 4HXMA 5I89A 4MR4A 4O7EA 3G0LA 4NS5A 4Z6IA 4UYDA 4QSTA 5KU3A 5IG6A 5CUBA 5DYXA 5FH8A 3Q2EA 4UIWA 5LVQA 2YEKA 5C87A 2DKWA 5A82A 5AD2A 3O33A 5D24A 4LZSA 3U5KA 2OSSA 5A7CA 5CFWA 2F6JA 3P1FA 4TT4A 4YH3A 5IGKA 5E9YA 5DKDA 5E9VA 4UYEA 5A5PA 3ONIA 3TLPA 5DKHA 1WUGA 4IOOA 2OUOA 3JVJA 4HXNA 2LSPB 4QYLA 4TTEA 5D3JA 2R10A 3Q2FA 5F5ZA 5EI4A 4Z1SA 4QEUA 4IR5A 4Q0OA 5E9MA 4A9NA 4C67A 5F60A 3LQHA 5EWCA 5CRMA 5II1A 5L97A 5CRZA 4WIVA 3GG3A 2DVRA 3O35A 4N4FA 3QZSA 4TU4A 3P1EA 4QEWA 3P5OA 2RO1A 4O74A 2E7NA 4TYLA 5CPEA 5HRXA 5D3PA 5FE0A 5ENFA 5HLSA 4O70A 4J0SA 5D7XA 3MQMA 5JI8A 4TS8A 2KTBB 5E3DA 5D3HA 5CS8A 2R0YA 2RNXA 4YYHA 5EPRA 5HQ5A 1F68A 4HBYA 4CFLA 4KV4A 5EWWA 4UIXA 4QZSA 4J1PA 4N4IA 4YY4A 5CQ5A 3MB3A 1X0JA 5FB1A 4Q0NA 5EPBA 3UVDA 5CQTA 5A85A 2RNYA 4OUFA 2RNWA 2DVSA 5LKZA 5D3LA 5CQ8A 4NUEA 5LKXA 5CP5A 3U5PA 4A9MA 2FSAA 4LR6A 5KHMA 2WP2A 4QBMA 2MJVB 1JM4B 2DVQA 5ACYA 2YELA 4LRGA 4QC3A 4KCXA 5C89A 4DONA 4QSWA 4NYVA 4YH4A 4MR6A 5KTUA 2YQDA 5BT4A 4PCEA 4Z1QA 5FE4A 5I88A 5CGPA 3SVFA 3P1DA 4WHUA 4CUUA 5BT3A 4UIVA 4A9OA 5C7NA 3UV4A 5D26A 5D0CA 5EQ1A 4NYWA 5A5QA 4HXPA 4HXOA 4QUUA 4O72A 4YYDA 5D3NA 5IBNA 5E3GA 4YC9A 2OO1A 2WP1A 5ENHA 5FG5A 4PS5A 5FBXA 5L96A 5CQ4A 5LUUA 5F1LA 5JWMA 4PY6A 5CU8A 5F63A 5HELA 3RCWA 3UVWA 4CUTA 4QNSA 5L99A 4MEOA 5DFBA 3ZYUA 5A5OA 4YABA 2YYNA 3D7CA 5E9IA 5E0RA 4AKNA 5ENJA 4Y03A 4LC2A 5IGMA 5EPSA 3O37A 5H1TA 4QSRA 4QYDA 5I29A 4QSPA 4A9EA 5A5SA 4A9IA 5HQ6A 5FE3A 5CQ6A 5K29A 5HRVA 3HMEA 5G4RA 5F62A 4CURA 5FE1A 4LZRA 5DLXA 5A5RA 4YYKA 4WHWA 3LXJA 4O75A 5EA1A 5ENGA 2DATA 5CY9A 5D3SA 5A81A 4O7CA 4NYXA 4BW4A 4BHWA 3UV5A 3IU5A 5DW1A 4UYFA 4YYGA 1E6IA 4QB3A 5DBMA 5EWDA 4HBWA 5DLZA 4CUSA 4TT6A 1N72A 4OGIA 4UIZA 4HXRA 5FH7A 4NR8A 5ETDA 5F1HA 2N9GA 4TU6A 5I86A 3U5MA 5DFDA 4N3WA 5DYCA 5D3RA 5CQ3A 4O76A 2DVVA 5FE9A 5E73A 5EWHA 4QY4A 5D25A 4YAXA 5HFRA 3S92A 3MXFA 3DAIA 5HENA 4A9JA 4IOQA 2GRCA 4BW2A 5LKTA 5L8TA 4LYWA 4O7FA 2R0SA 4YK0A 5CUCA 5DY7A 3G0JA 4XY8A 4YBSA 4YYNA 5FH6A 3FKMX 2H60A 4Z6HA 5IIDA 4YATA 4YYMA 4XY9A 5HRWA 3U5NA 4QSVA 4N4HA 3S91A 3JVLA 4HXSA 3SVGA 5C8GA 4NR9A 4LZ2A 4FLPA 5L98A 5FFVA 5F36A 4YYJA 1JSPB 5E74A 4A9KA 4GPJA 5FG4A 4MEQA 5DW2A 4QSSA 5CQAA 5EICA 5HM0A 2RI7A 5KTXA 4NUCA 4PTBA 3LQJA 5HFQA 3UW9A 3JVKA 2E7OA 5FE8A 4IR4A 5FE2A 5KO4A 4QR4A 5FE5A 2R0VA 5HQ7A 5H85A 4O71A 5LJ1A 5ENIA 4QR3A 5CUAA 5LKUA 3AQAA 5DX4A 4TZ8A 2YW5A 3O34A 3IU6A 5COIA 4MR5A 5CUDA 3HMFA 5I40A 4QSQA 4IORA 5FFWA 3LJWA 4CUPA 4N4GA 2RS9B 4YADA 5EWVA 5FDZA 4NRAA 5IGLA 5TCMA 3U5JA 5HJCA 5AMEA 4ALGA 3MUKA 5ETBA 4YYIA 4YBTA 5F3AA 5DYAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LYI A;  4J3I A;  5I83 A;  4XYA A;  4XUA A;  5I7Y A;  3LQI A;  4YY6 A;  5H1U A;  4A9H A;  3SVH A;  4X2I A;  2D82 A;  5EIS A;  4QC1 A;  4E96 A;  5I1Q A;  4UYH A;  4NUD A;  4NXJ A;  5E9L A;  5ENC A;  4NR7 A;  3UV2 A;  3DWY A;  1WUM A;  4IR6 A;  3U5L A;  5HCL A;  5CUG A;  4ZW1 A;  4TZ2 A;  5H1V A;  3QZV A;  2I7K A;  4CFK A;  4NRB A;  4HXK A;  5FFY A;  3HMH A;  5EM3 A;  4QEV A;  2D9E A;  5EP7 A;  4QSX A;  5CUE A;  4CL9 A;  5F25 A;  4TQN A;  5A5N A;  5HEM A;  5EGU A;  4BW3 A;  4HBX A;  2L5E A;  2RFJ A;  3U5O A;  3O36 A;  5E7D A;  4BJX A;  3K2J A;  5TB6 A;  4NR4 A;  5KTW A;  5D3T A;  4J0R A;  4PKL A;  3I3J A;  5EK9 A;  3QZT A;  3NXB A;  5F61 A;  5A83 A;  4HBV A;  4O7A A;  5I7X A;  5DFC A;  3UVX A;  2NXB A;  2DWW A;  5LVR A;  4YBM A;  4UIY A;  4LDF A;  4MEP A;  5ENE A;  4O78 A;  4F3I A;  4MEN A;  5IGN A;  4UIT A;  2I8N A;  4ZC9 A;  5FE6 A;  5FG6 A;  2YDW A;  5C85 A;  4O7B A;  5L8U A;  4Z93 A;  4CLB A;  2E3K A;  4C66 A;  2L85 A;  4CUQ A;  3JVM A;  5F2P A;  2YEM A;  4UIU A;  5BT5 A;  4NRC A;  4O77 A;  4UYF B;  4BW1 A;  4ALH A;  4IR3 A;  5II2 A;  3MB4 A;  4LYS A;  4QUT A;  4MR3 A;  4PCI A;  5CQ7 A;  1EQF A;  5AD3 A;  5I80 A;  4RVR A;  4NQN A;  4A9L A;  2F6N A;  4QSU A;  5FB0 A;  5DYU A;  5J0D A;  3MUL A;  4ZQL A;  2G4A A;  3AAD A;  5C4Q A;  5FE7 A;  5ENB A;  3UVY A;  4NQM A;  3P1C A;  4HXL A;  5G4S A;  4QR5 A;  1ZS5 A;  5E9K A;  5EV9 A;  5EVA A;  4OGJ A;  4UYG A;  5EU1 A;  5CZG A;  5AMF A;  4KV1 A;  5LJ2 A;  2L84 A;  4NR5 A;  5CTL A;  4XUB A;  4A9F A;  5LJ0 A;  4TT2 A;  5DKC A;  4NR6 A;  4HXM A;  5I89 A;  4MR4 A;  4O7E A;  3G0L A;  4NS5 A;  4Z6I A;  4UYD A;  4QST A;  5KU3 A;  5IG6 A;  5CUB A;  5DYX A;  5FH8 A;  3Q2E A;  4UIW A;  5LVQ A;  2YEK A;  5C87 A;  2DKW A;  5A82 A;  5AD2 A;  3O33 A;  5D24 A;  4LZS A;  3U5K A;  2OSS A;  5A7C A;  5CFW A;  2F6J A;  3P1F A;  4TT4 A;  4YH3 A;  5IGK A;  5E9Y A;  5DKD A;  5E9V A;  4UYE A;  5A5P A;  3ONI A;  3TLP A;  5DKH A;  1WUG A;  4IOO A;  2OUO A;  3JVJ A;  4HXN A;  2LSP B;  4QYL A;  4TTE A;  5D3J A;  2R10 A;  3Q2F A;  5F5Z A;  5EI4 A;  4Z1S A;  4QEU A;  4IR5 A;  4Q0O A;  5E9M A;  4A9N A;  4C67 A;  5F60 A;  3LQH A;  5EWC A;  5CRM A;  5II1 A;  5L97 A;  5CRZ A;  4WIV A;  3GG3 A;  2DVR A;  3O35 A;  4N4F A;  3QZS A;  4TU4 A;  3P1E A;  4QEW A;  3P5O A;  2RO1 A;  4O74 A;  2E7N A;  4TYL A;  5CPE A;  5HRX A;  5D3P A;  5FE0 A;  5ENF A;  5HLS A;  4O70 A;  4J0S A;  5D7X A;  3MQM A;  5JI8 A;  4TS8 A;  2KTB B;  5E3D A;  5D3H A;  5CS8 A;  2R0Y A;  2RNX A;  4YYH A;  5EPR A;  5HQ5 A;  1F68 A;  4HBY A;  4CFL A;  4KV4 A;  5EWW A;  4UIX A;  4QZS A;  4J1P A;  4N4I A;  4YY4 A;  5CQ5 A;  3MB3 A;  1X0J A;  5FB1 A;  4Q0N A;  5EPB A;  3UVD A;  5CQT A;  5A85 A;  2RNY A;  4OUF A;  2RNW A;  2DVS A;  5LKZ A;  5D3L A;  5CQ8 A;  4NUE A;  5LKX A;  5CP5 A;  3U5P A;  4A9M A;  2FSA A;  4LR6 A;  5KHM A;  2WP2 A;  4QBM A;  2MJV B;  1JM4 B;  2DVQ A;  5ACY A;  2YEL A;  4LRG A;  4QC3 A;  4KCX A;  5C89 A;  4DON A;  4QSW A;  4NYV A;  4YH4 A;  4MR6 A;  5KTU A;  2YQD A;  5BT4 A;  4PCE A;  4Z1Q A;  5FE4 A;  5I88 A;  5CGP A;  3SVF A;  3P1D A;  4WHU A;  4CUU A;  5BT3 A;  4UIV A;  4A9O A;  5C7N A;  3UV4 A;  5D26 A;  5D0C A;  5EQ1 A;  4NYW A;  5A5Q A;  4HXP A;  4HXO A;  4QUU A;  4O72 A;  4YYD A;  5D3N A;  5IBN A;  5E3G A;  4YC9 A;  2OO1 A;  2WP1 A;  5ENH A;  5FG5 A;  4PS5 A;  5FBX A;  5L96 A;  5CQ4 A;  5LUU A;  5F1L A;  5JWM A;  4PY6 A;  5CU8 A;  5F63 A;  5HEL A;  3RCW A;  3UVW A;  4CUT A;  4QNS A;  5L99 A;  4MEO A;  5DFB A;  3ZYU A;  5A5O A;  4YAB A;  2YYN A;  3D7C A;  5E9I A;  5E0R A;  4AKN A;  5ENJ A;  4Y03 A;  4LC2 A;  5IGM A;  5EPS A;  3O37 A;  5H1T A;  4QSR A;  4QYD A;  5I29 A;  4QSP A;  4A9E A;  5A5S A;  4A9I A;  5HQ6 A;  5FE3 A;  5CQ6 A;  5K29 A;  5HRV A;  3HME A;  5G4R A;  5F62 A;  4CUR A;  5FE1 A;  4LZR A;  5DLX A;  5A5R A;  4YYK A;  4WHW A;  3LXJ A;  4O75 A;  5EA1 A;  5ENG A;  2DAT A;  5CY9 A;  5D3S A;  5A81 A;  4O7C A;  4NYX A;  4BW4 A;  4BHW A;  3UV5 A;  3IU5 A;  5DW1 A;  4UYF A;  4YYG A;  1E6I A;  4QB3 A;  5DBM A;  5EWD A;  4HBW A;  5DLZ A;  4CUS A;  4TT6 A;  1N72 A;  4OGI A;  4UIZ A;  4HXR A;  5FH7 A;  4NR8 A;  5ETD A;  5F1H A;  2N9G A;  4TU6 A;  5I86 A;  3U5M A;  5DFD A;  4N3W A;  5DYC A;  5D3R A;  5CQ3 A;  4O76 A;  2DVV A;  5FE9 A;  5E73 A;  5EWH A;  4QY4 A;  5D25 A;  4YAX A;  5HFR A;  3S92 A;  3MXF A;  3DAI A;  5HEN A;  4A9J A;  4IOQ A;  2GRC A;  4BW2 A;  5LKT A;  5L8T A;  4LYW A;  4O7F A;  2R0S A;  4YK0 A;  5CUC A;  5DY7 A;  3G0J A;  4XY8 A;  4YBS A;  4YYN A;  5FH6 A;  3FKM X;  2H60 A;  4Z6H A;  5IID A;  4YAT A;  4YYM A;  4XY9 A;  5HRW A;  3U5N A;  4QSV A;  4N4H A;  3S91 A;  3JVL A;  4HXS A;  3SVG A;  5C8G A;  4NR9 A;  4LZ2 A;  4FLP A;  5L98 A;  5FFV A;  5F36 A;  4YYJ A;  1JSP B;  5E74 A;  4A9K A;  4GPJ A;  5FG4 A;  4MEQ A;  5DW2 A;  4QSS A;  5CQA A;  5EIC A;  5HM0 A;  2RI7 A;  5KTX A;  4NUC A;  4PTB A;  3LQJ A;  5HFQ A;  3UW9 A;  3JVK A;  2E7O A;  5FE8 A;  4IR4 A;  5FE2 A;  5KO4 A;  4QR4 A;  5FE5 A;  2R0V A;  5HQ7 A;  5H85 A;  4O71 A;  5LJ1 A;  5ENI A;  4QR3 A;  5CUA A;  5LKU A;  3AQA A;  5DX4 A;  4TZ8 A;  2YW5 A;  3O34 A;  3IU6 A;  5COI A;  4MR5 A;  5CUD A;  3HMF A;  5I40 A;  4QSQ A;  4IOR A;  5FFW A;  3LJW A;  4CUP A;  4N4G A;  2RS9 B;  4YAD A;  5EWV A;  5FDZ A;  4NRA A;  5IGL A;  5TCM A;  3U5J A;  5HJC A;  5AME A;  4ALG A;  3MUK A;  5ETB A;  4YYI A;  4YBT A;  5F3A A;  5DYA A; 
#chains in the Genus database with same CATH topology
 4LYI A;  4J3I A;  3VKH A;  5I83 A;  4XYA A;  4XUA A;  5I7Y A;  3LQI A;  4YY6 A;  5H1U A;  4A9H A;  3SVH A;  4X2I A;  2D82 A;  5EIS A;  4QC1 A;  4E96 A;  5I1Q A;  4UYH A;  4NUD A;  4NXJ A;  5E9L A;  5ENC A;  4NR7 A;  3UV2 A;  3DWY A;  1WUM A;  4IR6 A;  3U5L A;  5HCL A;  5CUG A;  4ZW1 A;  4TZ2 A;  5H1V A;  3QZV A;  2I7K A;  4CFK A;  4NRB A;  4HXK A;  5FFY A;  3HMH A;  5EM3 A;  4QEV A;  2D9E A;  5EP7 A;  4QSX A;  5CUE A;  4CL9 A;  5F25 A;  4TQN A;  5A5N A;  5HEM A;  5EGU A;  4BW3 A;  4HBX A;  2L5E A;  2RFJ A;  3U5O A;  3O36 A;  5E7D A;  4BJX A;  3K2J A;  5TB6 A;  4NR4 A;  5KTW A;  5D3T A;  4J0R A;  4PKL A;  3I3J A;  5EK9 A;  3QZT A;  3NXB A;  5F61 A;  5A83 A;  4HBV A;  4O7A A;  5I7X A;  5DFC A;  3UVX A;  2NXB A;  2DWW A;  5LVR A;  4YBM A;  4UIY A;  4LDF A;  4MEP A;  5ENE A;  4O78 A;  4F3I A;  4MEN A;  5IGN A;  4UIT A;  2I8N A;  4ZC9 A;  5FE6 A;  5FG6 A;  2YDW A;  5C85 A;  4O7B A;  5L8U A;  4Z93 A;  4CLB A;  2E3K A;  4C66 A;  2L85 A;  4CUQ A;  3JVM A;  5F2P A;  2YEM A;  4UIU A;  5BT5 A;  4NRC A;  4O77 A;  4UYF B;  4BW1 A;  4ALH A;  4IR3 A;  5II2 A;  3MB4 A;  4LYS A;  4QUT A;  4MR3 A;  4PCI A;  5CQ7 A;  1EQF A;  5AD3 A;  3ERR A;  5I80 A;  4RVR A;  4NQN A;  4A9L A;  2F6N A;  4QSU A;  5FB0 A;  5DYU A;  5J0D A;  3MUL A;  4ZQL A;  2G4A A;  3AAD A;  5C4Q A;  5FE7 A;  5ENB A;  3UVY A;  4NQM A;  3P1C A;  4HXL A;  5G4S A;  4QR5 A;  1ZS5 A;  5E9K A;  5EV9 A;  5EVA A;  4OGJ A;  4UYG A;  5EU1 A;  5CZG A;  5AMF A;  4KV1 A;  5LJ2 A;  2L84 A;  4NR5 A;  5CTL A;  4XUB A;  4A9F A;  5LJ0 A;  4TT2 A;  5DKC A;  4NR6 A;  4HXM A;  5I89 A;  4MR4 A;  4O7E A;  3G0L A;  4NS5 A;  4Z6I A;  4UYD A;  4QST A;  5KU3 A;  5IG6 A;  5CUB A;  5DYX A;  5FH8 A;  3Q2E A;  4UIW A;  5LVQ A;  2YEK A;  5C87 A;  2DKW A;  5A82 A;  5AD2 A;  3O33 A;  5D24 A;  4LZS A;  3U5K A;  2OSS A;  5A7C A;  5CFW A;  2F6J A;  3P1F A;  4TT4 A;  4YH3 A;  5IGK A;  5E9Y A;  5DKD A;  5E9V A;  4UYE A;  5A5P A;  3ONI A;  3TLP A;  5DKH A;  1WUG A;  4IOO A;  2OUO A;  3JVJ A;  4HXN A;  2LSP B;  4QYL A;  4TTE A;  5D3J A;  2R10 A;  3Q2F A;  5F5Z A;  5EI4 A;  4Z1S A;  4QEU A;  4IR5 A;  4Q0O A;  5E9M A;  4A9N A;  4C67 A;  5F60 A;  1PUO A;  3LQH A;  5EWC A;  5CRM A;  5II1 A;  5L97 A;  5CRZ A;  4WIV A;  3GG3 A;  2DVR A;  3O35 A;  4N4F A;  3QZS A;  4TU4 A;  3P1E A;  4QEW A;  3P5O A;  2RO1 A;  4O74 A;  2E7N A;  4TYL A;  5CPE A;  5HRX A;  5D3P A;  5FE0 A;  3D1D A;  5ENF A;  5HLS A;  4O70 A;  4J0S A;  5D7X A;  3MQM A;  5JI8 A;  4TS8 A;  2KTB B;  5E3D A;  5D3H A;  5CS8 A;  2R0Y A;  2RNX A;  4YYH A;  5EPR A;  5HQ5 A;  1F68 A;  4HBY A;  4CFL A;  4KV4 A;  5EWW A;  4UIX A;  4QZS A;  4J1P A;  4N4I A;  4YY4 A;  5CQ5 A;  3MB3 A;  1X0J A;  5FB1 A;  4Q0N A;  5EPB A;  3UVD A;  5CQT A;  5A85 A;  2RNY A;  4OUF A;  2RNW A;  2DVS A;  5LKZ A;  5D3L A;  5CQ8 A;  4NUE A;  5LKX A;  5CP5 A;  3U5P A;  4A9M A;  2FSA A;  4LR6 A;  5KHM A;  2WP2 A;  4QBM A;  2MJV B;  1JM4 B;  2DVQ A;  5ACY A;  2YEL A;  4LRG A;  4QC3 A;  4KCX A;  5C89 A;  4DON A;  4QSW A;  4NYV A;  4YH4 A;  4MR6 A;  5KTU A;  2YQD A;  5BT4 A;  1ZKR A;  4PCE A;  4Z1Q A;  5FE4 A;  5I88 A;  5CGP A;  3SVF A;  3P1D A;  4WHU A;  4CUU A;  5BT3 A;  4UIV A;  4A9O A;  5C7N A;  3UV4 A;  5D26 A;  5D0C A;  5EQ1 A;  4NYW A;  5A5Q A;  4HXP A;  4AI6 A;  4HXO A;  4QUU A;  4O72 A;  4YYD A;  5D3N A;  5IBN A;  5E3G A;  4YC9 A;  2OO1 A;  2WP1 A;  5ENH A;  5FG5 A;  4PS5 A;  5FBX A;  5L96 A;  5CQ4 A;  5LUU A;  5F1L A;  5JWM A;  4PY6 A;  5CU8 A;  5F63 A;  5HEL A;  3RCW A;  3UVW A;  4CUT A;  4QNS A;  5L99 A;  4MEO A;  5DFB A;  3ZYU A;  5A5O A;  4YAB A;  2YYN A;  3D7C A;  5E9I A;  5E0R A;  4AKN A;  5ENJ A;  4Y03 A;  4LC2 A;  5IGM A;  5EPS A;  3O37 A;  5H1T A;  4QSR A;  4QYD A;  5I29 A;  4QSP A;  4A9E A;  5A5S A;  4A9I A;  5HQ6 A;  5FE3 A;  5CQ6 A;  5K29 A;  5HRV A;  3HME A;  5G4R A;  5F62 A;  4CUR A;  5FE1 A;  4LZR A;  5DLX A;  5A5R A;  4YYK A;  4WHW A;  3LXJ A;  4O75 A;  5EA1 A;  5ENG A;  2DAT A;  5CY9 A;  5D3S A;  5A81 A;  4O7C A;  4NYX A;  4BW4 A;  4BHW A;  3UV5 A;  3IU5 A;  5DW1 A;  4UYF A;  4YYG A;  1E6I A;  4QB3 A;  5DBM A;  5EWD A;  4HBW A;  5DLZ A;  4CUS A;  4TT6 A;  1N72 A;  4OGI A;  4UIZ A;  4HXR A;  5FH7 A;  4NR8 A;  4AKH A;  3D1B A;  5ETD A;  5F1H A;  2N9G A;  4TU6 A;  5I86 A;  3U5M A;  5DFD A;  4N3W A;  5DYC A;  4AKG A;  5D3R A;  5CQ3 A;  4O76 A;  2DVV A;  3VKG A;  5FE9 A;  5E73 A;  5EWH A;  4QY4 A;  2EJN A;  5D25 A;  4AKI A;  4YAX A;  5HFR A;  3S92 A;  3MXF A;  3DAI A;  5HEN A;  4A9J A;  4IOQ A;  2GRC A;  4BW2 A;  5LKT A;  5L8T A;  4LYW A;  4O7F A;  2R0S A;  4YK0 A;  5CUC A;  5DY7 A;  3G0J A;  4XY8 A;  4YBS A;  4YYN A;  5FH6 A;  3FKM X;  2H60 A;  4Z6H A;  5IID A;  4YAT A;  4YYM A;  4XY9 A;  5HRW A;  3U5N A;  4QSV A;  4N4H A;  3S91 A;  3JVL A;  4HXS A;  3SVG A;  5C8G A;  4NR9 A;  4LZ2 A;  4FLP A;  5L98 A;  5FFV A;  5F36 A;  4YYJ A;  1JSP B;  5E74 A;  4A9K A;  4GPJ A;  5FG4 A;  4MEQ A;  5DW2 A;  4QSS A;  5CQA A;  5EIC A;  5HM0 A;  2RI7 A;  5KTX A;  4NUC A;  4PTB A;  3LQJ A;  5HFQ A;  3UW9 A;  3JVK A;  2E7O A;  5FE8 A;  4IR4 A;  5FE2 A;  5KO4 A;  4QR4 A;  5FE5 A;  2R0V A;  5HQ7 A;  5H85 A;  4O71 A;  5LJ1 A;  5ENI A;  4QR3 A;  5CUA A;  5LKU A;  3AQA A;  5DX4 A;  4TZ8 A;  2YW5 A;  3O34 A;  3IU6 A;  5COI A;  4MR5 A;  5CUD A;  3HMF A;  5I40 A;  4QSQ A;  4IOR A;  5FFW A;  3LJW A;  4CUP A;  4N4G A;  2RS9 B;  4YAD A;  5EWV A;  5FDZ A;  4NRA A;  5IGL A;  5TCM A;  3U5J A;  5HJC A;  5AME A;  4ALG A;  3MUK A;  5ETB A;  4YYI A;  4YBT A;  5F3A A;  5DYA A; 
#chains in the Genus database with same CATH homology
 4LYI A;  4J3I A;  5I83 A;  4XYA A;  4XUA A;  5I7Y A;  3LQI A;  4YY6 A;  5H1U A;  4A9H A;  3SVH A;  4X2I A;  2D82 A;  5EIS A;  4QC1 A;  4E96 A;  5I1Q A;  4UYH A;  4NUD A;  4NXJ A;  5E9L A;  5ENC A;  4NR7 A;  3UV2 A;  3DWY A;  1WUM A;  4IR6 A;  3U5L A;  5HCL A;  5CUG A;  4ZW1 A;  4TZ2 A;  5H1V A;  3QZV A;  2I7K A;  4CFK A;  4NRB A;  4HXK A;  5FFY A;  3HMH A;  5EM3 A;  4QEV A;  2D9E A;  5EP7 A;  4QSX A;  5CUE A;  4CL9 A;  5F25 A;  4TQN A;  5A5N A;  5HEM A;  5EGU A;  4BW3 A;  4HBX A;  2L5E A;  2RFJ A;  3U5O A;  3O36 A;  5E7D A;  4BJX A;  3K2J A;  5TB6 A;  4NR4 A;  5KTW A;  5D3T A;  4J0R A;  4PKL A;  3I3J A;  5EK9 A;  3QZT A;  3NXB A;  5F61 A;  5A83 A;  4HBV A;  4O7A A;  5I7X A;  5DFC A;  3UVX A;  2NXB A;  2DWW A;  5LVR A;  4YBM A;  4UIY A;  4LDF A;  4MEP A;  5ENE A;  4O78 A;  4F3I A;  4MEN A;  5IGN A;  4UIT A;  2I8N A;  4ZC9 A;  5FE6 A;  5FG6 A;  2YDW A;  5C85 A;  4O7B A;  5L8U A;  4Z93 A;  4CLB A;  2E3K A;  4C66 A;  2L85 A;  4CUQ A;  3JVM A;  5F2P A;  2YEM A;  4UIU A;  5BT5 A;  4NRC A;  4O77 A;  4UYF B;  4BW1 A;  4ALH A;  4IR3 A;  5II2 A;  3MB4 A;  4LYS A;  4QUT A;  4MR3 A;  4PCI A;  5CQ7 A;  1EQF A;  5AD3 A;  5I80 A;  4RVR A;  4NQN A;  4A9L A;  2F6N A;  4QSU A;  5FB0 A;  5DYU A;  5J0D A;  3MUL A;  4ZQL A;  2G4A A;  3AAD A;  5C4Q A;  5FE7 A;  5ENB A;  3UVY A;  4NQM A;  3P1C A;  4HXL A;  5G4S A;  4QR5 A;  1ZS5 A;  5E9K A;  5EV9 A;  5EVA A;  4OGJ A;  4UYG A;  5EU1 A;  5CZG A;  5AMF A;  4KV1 A;  5LJ2 A;  2L84 A;  4NR5 A;  5CTL A;  4XUB A;  4A9F A;  5LJ0 A;  4TT2 A;  5DKC A;  4NR6 A;  4HXM A;  5I89 A;  4MR4 A;  4O7E A;  3G0L A;  4NS5 A;  4Z6I A;  4UYD A;  4QST A;  5KU3 A;  5IG6 A;  5CUB A;  5DYX A;  5FH8 A;  3Q2E A;  4UIW A;  5LVQ A;  2YEK A;  5C87 A;  2DKW A;  5A82 A;  5AD2 A;  3O33 A;  5D24 A;  4LZS A;  3U5K A;  2OSS A;  5A7C A;  5CFW A;  2F6J A;  3P1F A;  4TT4 A;  4YH3 A;  5IGK A;  5E9Y A;  5DKD A;  5E9V A;  4UYE A;  5A5P A;  3ONI A;  3TLP A;  5DKH A;  1WUG A;  4IOO A;  2OUO A;  3JVJ A;  4HXN A;  2LSP B;  4QYL A;  4TTE A;  5D3J A;  2R10 A;  3Q2F A;  5F5Z A;  5EI4 A;  4Z1S A;  4QEU A;  4IR5 A;  4Q0O A;  5E9M A;  4A9N A;  4C67 A;  5F60 A;  3LQH A;  5EWC A;  5CRM A;  5II1 A;  5L97 A;  5CRZ A;  4WIV A;  3GG3 A;  2DVR A;  3O35 A;  4N4F A;  3QZS A;  4TU4 A;  3P1E A;  4QEW A;  3P5O A;  2RO1 A;  4O74 A;  2E7N A;  4TYL A;  5CPE A;  5HRX A;  5D3P A;  5FE0 A;  5ENF A;  5HLS A;  4O70 A;  4J0S A;  5D7X A;  3MQM A;  5JI8 A;  4TS8 A;  2KTB B;  5E3D A;  5D3H A;  5CS8 A;  2R0Y A;  2RNX A;  4YYH A;  5EPR A;  5HQ5 A;  1F68 A;  4HBY A;  4CFL A;  4KV4 A;  5EWW A;  4UIX A;  4QZS A;  4J1P A;  4N4I A;  4YY4 A;  5CQ5 A;  3MB3 A;  1X0J A;  5FB1 A;  4Q0N A;  5EPB A;  3UVD A;  5CQT A;  5A85 A;  2RNY A;  4OUF A;  2RNW A;  2DVS A;  5LKZ A;  5D3L A;  5CQ8 A;  4NUE A;  5LKX A;  5CP5 A;  3U5P A;  4A9M A;  2FSA A;  4LR6 A;  5KHM A;  2WP2 A;  4QBM A;  2MJV B;  1JM4 B;  2DVQ A;  5ACY A;  2YEL A;  4LRG A;  4QC3 A;  4KCX A;  5C89 A;  4DON A;  4QSW A;  4NYV A;  4YH4 A;  4MR6 A;  5KTU A;  2YQD A;  5BT4 A;  4PCE A;  4Z1Q A;  5FE4 A;  5I88 A;  5CGP A;  3SVF A;  3P1D A;  4WHU A;  4CUU A;  5BT3 A;  4UIV A;  4A9O A;  5C7N A;  3UV4 A;  5D26 A;  5D0C A;  5EQ1 A;  4NYW A;  5A5Q A;  4HXP A;  4HXO A;  4QUU A;  4O72 A;  4YYD A;  5D3N A;  5IBN A;  5E3G A;  4YC9 A;  2OO1 A;  2WP1 A;  5ENH A;  5FG5 A;  4PS5 A;  5FBX A;  5L96 A;  5CQ4 A;  5LUU A;  5F1L A;  5JWM A;  4PY6 A;  5CU8 A;  5F63 A;  5HEL A;  3RCW A;  3UVW A;  4CUT A;  4QNS A;  5L99 A;  4MEO A;  5DFB A;  3ZYU A;  5A5O A;  4YAB A;  2YYN A;  3D7C A;  5E9I A;  5E0R A;  4AKN A;  5ENJ A;  4Y03 A;  4LC2 A;  5IGM A;  5EPS A;  3O37 A;  5H1T A;  4QSR A;  4QYD A;  5I29 A;  4QSP A;  4A9E A;  5A5S A;  4A9I A;  5HQ6 A;  5FE3 A;  5CQ6 A;  5K29 A;  5HRV A;  3HME A;  5G4R A;  5F62 A;  4CUR A;  5FE1 A;  4LZR A;  5DLX A;  5A5R A;  4YYK A;  4WHW A;  3LXJ A;  4O75 A;  5EA1 A;  5ENG A;  2DAT A;  5CY9 A;  5D3S A;  5A81 A;  4O7C A;  4NYX A;  4BW4 A;  4BHW A;  3UV5 A;  3IU5 A;  5DW1 A;  4UYF A;  4YYG A;  1E6I A;  4QB3 A;  5DBM A;  5EWD A;  4HBW A;  5DLZ A;  4CUS A;  4TT6 A;  1N72 A;  4OGI A;  4UIZ A;  4HXR A;  5FH7 A;  4NR8 A;  5ETD A;  5F1H A;  2N9G A;  4TU6 A;  5I86 A;  3U5M A;  5DFD A;  4N3W A;  5DYC A;  5D3R A;  5CQ3 A;  4O76 A;  2DVV A;  5FE9 A;  5E73 A;  5EWH A;  4QY4 A;  5D25 A;  4YAX A;  5HFR A;  3S92 A;  3MXF A;  3DAI A;  5HEN A;  4A9J A;  4IOQ A;  2GRC A;  4BW2 A;  5LKT A;  5L8T A;  4LYW A;  4O7F A;  2R0S A;  4YK0 A;  5CUC A;  5DY7 A;  3G0J A;  4XY8 A;  4YBS A;  4YYN A;  5FH6 A;  3FKM X;  2H60 A;  4Z6H A;  5IID A;  4YAT A;  4YYM A;  4XY9 A;  5HRW A;  3U5N A;  4QSV A;  4N4H A;  3S91 A;  3JVL A;  4HXS A;  3SVG A;  5C8G A;  4NR9 A;  4LZ2 A;  4FLP A;  5L98 A;  5FFV A;  5F36 A;  4YYJ A;  1JSP B;  5E74 A;  4A9K A;  4GPJ A;  5FG4 A;  4MEQ A;  5DW2 A;  4QSS A;  5CQA A;  5EIC A;  5HM0 A;  2RI7 A;  5KTX A;  4NUC A;  4PTB A;  3LQJ A;  5HFQ A;  3UW9 A;  3JVK A;  2E7O A;  5FE8 A;  4IR4 A;  5FE2 A;  5KO4 A;  4QR4 A;  5FE5 A;  2R0V A;  5HQ7 A;  5H85 A;  4O71 A;  5LJ1 A;  5ENI A;  4QR3 A;  5CUA A;  5LKU A;  3AQA A;  5DX4 A;  4TZ8 A;  2YW5 A;  3O34 A;  3IU6 A;  5COI A;  4MR5 A;  5CUD A;  3HMF A;  5I40 A;  4QSQ A;  4IOR A;  5FFW A;  3LJW A;  4CUP A;  4N4G A;  2RS9 B;  4YAD A;  5EWV A;  5FDZ A;  4NRA A;  5IGL A;  5TCM A;  3U5J A;  5HJC A;  5AME A;  4ALG A;  3MUK A;  5ETB A;  4YYI A;  4YBT A;  5F3A A;  5DYA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...