4NXJA

Crystal structure of pf3d7_1475600, a bromodomain from plasmodium falciparum
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
118
structure length
118
Chain Sequence
GYDEIEELKSKNEVLTNLLNKLIAFDKKRIFLYPVNVQLVPDYLNVIKEPMDFTTMKQKLQNFKYKSFQEFEKDVLLIINNCYTYNDPSTIYYKFAEDIETYYKKLNIKIQTKYMNIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Bromodomain protein
publication title Crystal Structure of PF3D7_1475600, a bromodomain from Plasmodium Falciparum
rcsb
source organism Plasmodium falciparum
total genus 43
structure length 118
sequence length 118
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4nxjA00
3K2JA 3GG3A 4HXMA 4MEPA 3S92A 4CLBA 4LYSA 4QSUA 4QSRA 4YY6A 5CUCA 4IR4A 4ZW1A 4A9KA 4QEWA 1EQFA 4NRCA 5A85A 3MB3A 4Z93A 4LR6A 5A5QA 2YDWA 1ZS5A 5E0RA 4UYHA 4Q0NA 3MQMA 5FE1A 1X0JA 3FKMX 5FE8A 5IGLA 4CUSA 2L84A 4N4IA 5D3NA 3LQJA 2D9EA 4O7EA 5KTWA 3MUKA 5DFDA 4AKNA 5A83A 5EWHA 2DVSA 2E7OA 3UVXA 2I8NA 5A81A 4WIVA 4OGIA 5FG5A 4QSXA 4J0RA 5CGPA 4ZC9A 5A5SA 5CY9A 3U5LA 4MR3A 3Q2FA 5A5RA 4TT4A 5EICA 2RS9B 2RO1A 4YYKA 5HLSA 5DYXA 4XUAA 3HMHA 4TU4A 5LKZA 3SVHA 5D25A 4YK0A 3UVWA 4QB3A 5D3HA 5TB6A 5I7XA 4OGJA 1WUGA 5ENCA 5HQ5A 4O7CA 4Z1SA 2FSAA 5A5NA 5CZGA 5HJCA 3U5JA 1WUMA 4IOQA 5DKDA 4HXNA 4UIYA 4BW3A 4O76A 5EA1A 4MENA 4YYGA 5H85A 5E9KA 5D3RA 4DONA 1JSPB 4NUEA 5FG4A 4WHWA 4TT2A 5CQ8A 5ENIA 5JWMA 3MXFA 2OO1A 2WP2A 5EM3A 5E7DA 4CUPA 5LJ0A 5D3SA 5FG6A 4YBSA 4UITA 3LJWA 4QYLA 5I89A 4N4HA 3UV5A 5HEMA 4GPJA 5EQ1A 4QY4A 5CTLA 4QUUA 4BW1A 4XYAA 4N4GA 5F1HA 5G4SA 4NYWA 4YYMA 3U5MA 4A9MA 4O75A 4PCEA 3G0JA 3Q2EA 3LXJA 4UYEA 5KTUA 4IOOA 4QUTA 5CPEA 4UIUA 5E9YA 4YATA 2F6NA 4MR6A 5H1TA 5FB1A 5DYUA 4NR8A 2YW5A 5FE2A 4TS8A 5EPSA 4NR7A 4QBMA 5I29A 5FB0A 5EU1A 5HQ7A 5DX4A 4HXOA 2GRCA 4CFLA 4X2IA 5BT3A 4HXLA 5DW1A 5E3GA 3P5OA 4O70A 5F60A 5HQ6A 3U5NA 5I80A 4YYJA 4IR5A 5FFYA 4NYVA 2I7KA 5CQ5A 5DLZA 5CUAA 2MJVB 4UYGA 5E9LA 5FE4A 3IU6A 5D7XA 3P1CA 3AADA 4TQNA 5F61A 5C89A 5D0CA 5FE5A 5EP7A 4MEQA 5D24A 3P1EA 2RI7A 5I88A 5IGMA 4UIXA 5C7NA 4A9NA 2DVRA 5FFVA 4N3WA 2R0YA 5LUUA 5IIDA 4LC2A 4YY4A 2H60A 5FFWA 3LQHA 5A5OA 4A9IA 4FLPA 4QNSA 5DLXA 5I1QA 5DBMA 5HELA 4J1PA 4IR3A 5L8UA 4XY8A 2KTBB 3MULA 4QSWA 4YC9A 4LDFA 4UYFA 4YBTA 4WHUA 5KTXA 3DWYA 4IORA 4NR6A 3QZVA 5F63A 4XUBA 5F25A 5KU3A 2R0SA 5EISA 3P1FA 4QZSA 5FH8A 4A9FA 4YYIA 2OUOA 4UIVA 5FE7A 4HBWA 5L98A 5C87A 2YELA 3O35A 4NR4A 4HXPA 3UW9A 4ZQLA 1E6IA 4CUUA 3DAIA 5II1A 4QC3A 5AD2A 3D7CA 3RCWA 4QEVA 4TU6A 4E96A 4NXJA 2YQDA 2YEMA 4KCXA 5CQ4A 5ENBA 3AQAA 3G0LA 3JVJA 4A9EA 4YYNA 5C8GA 1F68A 4O7AA 4LZ2A 2LSPB 2DKWA 5D26A 5D3TA 4A9OA 4ALGA 5ENJA 4RVRA 4PTBA 5II2A 3O36A 5FH6A 4NRAA 5DKCA 5LVRA 4NR9A 4YBMA 5DW2A 5FH7A 3P1DA 4TZ8A 4QSTA 4LYIA 2WP1A 5LVQA 3O34A 4O78A 5COIA 4QSVA 5CUDA 4QEUA 4LZSA 4LRGA 5CUBA 5D3JA 5EK9A 4CUTA 4YYHA 5DFCA 4HXRA 4QSQA 1N72A 5ETDA 5KHMA 5H1UA 5C4QA 4PKLA 4Y03A 4MR4A 4KV1A 3JVMA 5A5PA 2RFJA 5DYAA 4CFKA 2OSSA 5DYCA 4NRBA 3UVYA 5CUGA 4XY9A 5CQAA 5CQ3A 5J0DA 5LJ2A 5EGUA 4PCIA 4QYDA 4J3IA 5I7YA 3HMEA 2RNWA 2F6JA 4A9JA 4A9LA 5I86A 4Z1QA 5CRZA 1JM4B 4CUQA 5EWCA 3ZYUA 4UIWA 5EPBA 5HRVA 3U5KA 4HBYA 3JVKA 4HXSA 5ETBA 5L8TA 5BT5A 2RNXA 5FE9A 4YAXA 5ENHA 5LKTA 2DWWA 2E3KA 4O77A 4N4FA 4YH4A 5C85A 4NR5A 5ENEA 2R10A 4CURA 5F5ZA 5F62A 4BW4A 4LYWA 3HMFA 5CRMA 5LJ1A 4TTEA 4OUFA 5HFQA 3U5PA 4QR3A 4Z6HA 4Q0OA 5CS8A 4QR4A 5DKHA 5FE3A 4BHWA 5K29A 5IGKA 5CQ7A 5HM0A 4BJXA 3UV2A 4YADA 5TCMA 3MB4A 5LKXA 4QC1A 4C67A 5L97A 5FE6A 5FE0A 4YH3A 4NUDA 4NUCA 5CU8A 5H1VA 5EVAA 3I3JA 3UVDA 4UYFB 3SVGA 5A82A 5HENA 2YYNA 4UYDA 5BT4A 4QSPA 3S91A 4O72A 5E9IA 4O7FA 3JVLA 3QZTA 5D3LA 4NQMA 3SVFA 5ENFA 5EWDA 5EV9A 5I83A 5F2PA 2N9GA 4HBVA 3TLPA 2YEKA 3O37A 2D82A 5EWVA 4TT6A 4PY6A 3QZSA 3O33A 5CUEA 3U5OA 5JI8A 2L5EA 4NYXA 5ACYA 5AD3A 4CL9A 4MR5A 5L99A 4J0SA 4PS5A 5FBXA 4Z6IA 2R0VA 4NS5A 5A7CA 5EWWA 5HRXA 4MEOA 4QSSA 5F3AA 4ALHA 4IR6A 2RNYA 5CQTA 5L96A 3ONIA 4NQNA 5D3PA 4KV4A 2DATA 4C66A 4TZ2A 4YABA 5EI4A 5LKUA 2G4AA 5CFWA 4QR5A 5IBNA 4BW2A 2NXBA 4UIZA 5HRWA 5E73A 5AMEA 2E7NA 5EPRA 5E9MA 5ENGA 5IG6A 2DVQA 4YYDA 5F1LA 5CQ6A 5IGNA 5KO4A 5DY7A 4O71A 4HBXA 3LQIA 2L85A 4HXKA 5DFBA 5E3DA 5HCLA 5E9VA 5CP5A 4F3IA 5I40A 3IU5A 4LZRA 5HFRA 5G4RA 2DVVA 4O74A 3UV4A 4TYLA 5AMFA 5E74A 4A9HA 4O7BA 3NXBA 5FDZA 5F36A
chains in the Genus database with same CATH superfamily
3K2JA 3GG3A 4HXMA 4MEPA 3VKGA 3S92A 4CLBA 4LYSA 4QSUA 3D1BA 4QSRA 4YY6A 5CUCA 4IR4A 4ZW1A 4A9KA 4QEWA 1EQFA 4NRCA 5A85A 3MB3A 4Z93A 4LR6A 3VKHA 5A5QA 2YDWA 1ZS5A 5E0RA 4UYHA 4Q0NA 3MQMA 5FE1A 1X0JA 3FKMX 5FE8A 5IGLA 4CUSA 2L84A 4N4IA 5D3NA 3LQJA 1PUOA 2D9EA 4O7EA 5KTWA 3MUKA 5DFDA 4AKNA 5A83A 5EWHA 2DVSA 2E7OA 3UVXA 2I8NA 5A81A 4WIVA 4OGIA 5FG5A 4QSXA 4J0RA 5CGPA 4ZC9A 5A5SA 5CY9A 3U5LA 4MR3A 3Q2FA 5A5RA 4TT4A 5EICA 2RS9B 2RO1A 4YYKA 5HLSA 5DYXA 4XUAA 3HMHA 4TU4A 5LKZA 3SVHA 1ZKRA 5D25A 4YK0A 3UVWA 4QB3A 5D3HA 5TB6A 5I7XA 4OGJA 1WUGA 5ENCA 5HQ5A 4O7CA 4Z1SA 2FSAA 5A5NA 5CZGA 5HJCA 3U5JA 1WUMA 4IOQA 5DKDA 4HXNA 4UIYA 4BW3A 4O76A 5EA1A 4MENA 4YYGA 5H85A 5E9KA 5D3RA 4DONA 1JSPB 4NUEA 5FG4A 4WHWA 4TT2A 5CQ8A 5ENIA 5JWMA 3MXFA 2OO1A 2WP2A 5EM3A 5E7DA 4CUPA 5LJ0A 5D3SA 5FG6A 4YBSA 4UITA 3LJWA 4QYLA 5I89A 4N4HA 3UV5A 5HEMA 4GPJA 5EQ1A 4QY4A 5CTLA 4QUUA 4BW1A 4XYAA 4N4GA 5F1HA 5G4SA 4NYWA 4YYMA 3U5MA 4A9MA 4O75A 4PCEA 3G0JA 3Q2EA 3LXJA 4UYEA 5KTUA 4IOOA 4QUTA 5CPEA 4UIUA 5E9YA 4YATA 2F6NA 4MR6A 5H1TA 5FB1A 5DYUA 4NR8A 3ERRA 2YW5A 5FE2A 4TS8A 5EPSA 4NR7A 4QBMA 5I29A 5FB0A 5EU1A 5HQ7A 5DX4A 4HXOA 2GRCA 4CFLA 4X2IA 5BT3A 4HXLA 5DW1A 5E3GA 3P5OA 4O70A 5F60A 5HQ6A 3U5NA 5I80A 4YYJA 4IR5A 5FFYA 4NYVA 2I7KA 5CQ5A 5DLZA 5CUAA 2MJVB 4UYGA 5E9LA 5FE4A 3IU6A 5D7XA 3P1CA 3AADA 4TQNA 5F61A 5C89A 5D0CA 5FE5A 5EP7A 4MEQA 5D24A 3P1EA 2RI7A 5I88A 5IGMA 4UIXA 5C7NA 4A9NA 2DVRA 5FFVA 4N3WA 2R0YA 5LUUA 5IIDA 4LC2A 4YY4A 2H60A 5FFWA 3LQHA 5A5OA 4A9IA 4FLPA 4QNSA 5DLXA 5I1QA 5DBMA 5HELA 4J1PA 4IR3A 5L8UA 4XY8A 2KTBB 3MULA 4QSWA 4YC9A 4LDFA 4UYFA 4YBTA 4WHUA 5KTXA 3DWYA 4IORA 4NR6A 3QZVA 5F63A 4XUBA 5F25A 5KU3A 2R0SA 5EISA 3P1FA 4QZSA 5FH8A 4A9FA 4YYIA 2OUOA 4UIVA 5FE7A 4HBWA 5L98A 5C87A 2YELA 3O35A 4NR4A 4HXPA 3UW9A 4AKGA 4ZQLA 1E6IA 4CUUA 3DAIA 5II1A 4QC3A 5AD2A 3D7CA 3RCWA 4QEVA 4TU6A 4E96A 4AKIA 4AI6A 4NXJA 2YQDA 2YEMA 4KCXA 5CQ4A 5ENBA 3AQAA 3G0LA 3JVJA 4A9EA 4YYNA 5C8GA 1F68A 4O7AA 4LZ2A 2LSPB 2DKWA 5D26A 5D3TA 4A9OA 4ALGA 5ENJA 4RVRA 4PTBA 5II2A 3O36A 5FH6A 4NRAA 5DKCA 5LVRA 4NR9A 4YBMA 5DW2A 5FH7A 3P1DA 4TZ8A 4QSTA 4LYIA 2WP1A 5LVQA 3O34A 4O78A 5COIA 4QSVA 5CUDA 4QEUA 4LZSA 4LRGA 5CUBA 5D3JA 5EK9A 4CUTA 4YYHA 5DFCA 4HXRA 4QSQA 1N72A 5ETDA 5KHMA 5H1UA 5C4QA 4PKLA 4Y03A 4MR4A 4KV1A 3JVMA 5A5PA 2RFJA 5DYAA 4CFKA 2OSSA 5DYCA 4NRBA 3UVYA 5CUGA 4XY9A 5CQAA 5CQ3A 5J0DA 5LJ2A 5EGUA 4PCIA 4QYDA 4J3IA 5I7YA 3HMEA 2RNWA 2F6JA 4A9JA 4A9LA 5I86A 4Z1QA 5CRZA 1JM4B 4CUQA 5EWCA 3ZYUA 4UIWA 5EPBA 5HRVA 3U5KA 4HBYA 3JVKA 4HXSA 5ETBA 5L8TA 4AKHA 5BT5A 2RNXA 5FE9A 4YAXA 5ENHA 5LKTA 2DWWA 2E3KA 4O77A 2EJNA 4N4FA 4YH4A 5C85A 4NR5A 5ENEA 2R10A 4CURA 5F5ZA 5F62A 4BW4A 4LYWA 3HMFA 5CRMA 5LJ1A 4TTEA 4OUFA 5HFQA 3U5PA 4QR3A 4Z6HA 4Q0OA 5CS8A 4QR4A 5DKHA 5FE3A 4BHWA 5K29A 5IGKA 5CQ7A 5HM0A 3D1DA 4BJXA 3UV2A 4YADA 5TCMA 3MB4A 5LKXA 4QC1A 4C67A 5L97A 5FE6A 5FE0A 4YH3A 4NUDA 4NUCA 5CU8A 5H1VA 5EVAA 3I3JA 3UVDA 4UYFB 3SVGA 5A82A 5HENA 2YYNA 4UYDA 5BT4A 4QSPA 3S91A 4O72A 5E9IA 4O7FA 3JVLA 3QZTA 5D3LA 4NQMA 3SVFA 5ENFA 5EWDA 5EV9A 5I83A 5F2PA 2N9GA 4HBVA 3TLPA 2YEKA 3O37A 2D82A 5EWVA 4TT6A 4PY6A 3QZSA 3O33A 5CUEA 3U5OA 5JI8A 2L5EA 4NYXA 5ACYA 5AD3A 4CL9A 4MR5A 5L99A 4J0SA 4PS5A 5FBXA 4Z6IA 2R0VA 4NS5A 5A7CA 5EWWA 5HRXA 4MEOA 4QSSA 5F3AA 4ALHA 4IR6A 2RNYA 5CQTA 5L96A 3ONIA 4NQNA 5D3PA 4KV4A 2DATA 4C66A 4TZ2A 4YABA 5EI4A 5LKUA 2G4AA 5CFWA 4QR5A 5IBNA 4BW2A 2NXBA 4UIZA 5HRWA 5E73A 5AMEA 2E7NA 5EPRA 5E9MA 5ENGA 5IG6A 2DVQA 4YYDA 5F1LA 5CQ6A 5IGNA 5KO4A 5DY7A 4O71A 4HBXA 3LQIA 2L85A 4HXKA 5DFBA 5E3DA 5HCLA 5E9VA 5CP5A 4F3IA 5I40A 3IU5A 4LZRA 5HFRA 5G4RA 2DVVA 4O74A 3UV4A 4TYLA 5AMFA 5E74A 4A9HA 4O7BA 3NXBA 5FDZA 5F36A
chains in the Genus database with same CATH topology
3K2JA 3GG3A 4HXMA 4MEPA 3S92A 4CLBA 4LYSA 4QSUA 4QSRA 4YY6A 5CUCA 4IR4A 4ZW1A 4A9KA 4QEWA 1EQFA 4NRCA 5A85A 3MB3A 4Z93A 4LR6A 5A5QA 2YDWA 1ZS5A 5E0RA 4UYHA 4Q0NA 3MQMA 5FE1A 1X0JA 3FKMX 5FE8A 5IGLA 4CUSA 2L84A 4N4IA 5D3NA 3LQJA 2D9EA 4O7EA 5KTWA 3MUKA 5DFDA 4AKNA 5A83A 5EWHA 2DVSA 2E7OA 3UVXA 2I8NA 5A81A 4WIVA 4OGIA 5FG5A 4QSXA 4J0RA 5CGPA 4ZC9A 5A5SA 5CY9A 3U5LA 4MR3A 3Q2FA 5A5RA 4TT4A 5EICA 2RS9B 2RO1A 4YYKA 5HLSA 5DYXA 4XUAA 3HMHA 4TU4A 5LKZA 3SVHA 5D25A 4YK0A 3UVWA 4QB3A 5D3HA 5TB6A 5I7XA 4OGJA 1WUGA 5ENCA 5HQ5A 4O7CA 4Z1SA 2FSAA 5A5NA 5CZGA 5HJCA 3U5JA 1WUMA 4IOQA 5DKDA 4HXNA 4UIYA 4BW3A 4O76A 5EA1A 4MENA 4YYGA 5H85A 5E9KA 5D3RA 4DONA 1JSPB 4NUEA 5FG4A 4WHWA 4TT2A 5CQ8A 5ENIA 5JWMA 3MXFA 2OO1A 2WP2A 5EM3A 5E7DA 4CUPA 5LJ0A 5D3SA 5FG6A 4YBSA 4UITA 3LJWA 4QYLA 5I89A 4N4HA 3UV5A 5HEMA 4GPJA 5EQ1A 4QY4A 5CTLA 4QUUA 4BW1A 4XYAA 4N4GA 5F1HA 5G4SA 4NYWA 4YYMA 3U5MA 4A9MA 4O75A 4PCEA 3G0JA 3Q2EA 3LXJA 4UYEA 5KTUA 4IOOA 4QUTA 5CPEA 4UIUA 5E9YA 4YATA 2F6NA 4MR6A 5H1TA 5FB1A 5DYUA 4NR8A 2YW5A 5FE2A 4TS8A 5EPSA 4NR7A 4QBMA 5I29A 5FB0A 5EU1A 5HQ7A 5DX4A 4HXOA 2GRCA 4CFLA 4X2IA 5BT3A 4HXLA 5DW1A 5E3GA 3P5OA 4O70A 5F60A 5HQ6A 3U5NA 5I80A 4YYJA 4IR5A 5FFYA 4NYVA 2I7KA 5CQ5A 5DLZA 5CUAA 2MJVB 4UYGA 5E9LA 5FE4A 3IU6A 5D7XA 3P1CA 3AADA 4TQNA 5F61A 5C89A 5D0CA 5FE5A 5EP7A 4MEQA 5D24A 3P1EA 2RI7A 5I88A 5IGMA 4UIXA 5C7NA 4A9NA 2DVRA 5FFVA 4N3WA 2R0YA 5LUUA 5IIDA 4LC2A 4YY4A 2H60A 5FFWA 3LQHA 5A5OA 4A9IA 4FLPA 4QNSA 5DLXA 5I1QA 5DBMA 5HELA 4J1PA 4IR3A 5L8UA 4XY8A 2KTBB 3MULA 4QSWA 4YC9A 4LDFA 4UYFA 4YBTA 4WHUA 5KTXA 3DWYA 4IORA 4NR6A 3QZVA 5F63A 4XUBA 5F25A 5KU3A 2R0SA 5EISA 3P1FA 4QZSA 5FH8A 4A9FA 4YYIA 2OUOA 4UIVA 5FE7A 4HBWA 5L98A 5C87A 2YELA 3O35A 4NR4A 4HXPA 3UW9A 4ZQLA 1E6IA 4CUUA 3DAIA 5II1A 4QC3A 5AD2A 3D7CA 3RCWA 4QEVA 4TU6A 4E96A 4NXJA 2YQDA 2YEMA 4KCXA 5CQ4A 5ENBA 3AQAA 3G0LA 3JVJA 4A9EA 4YYNA 5C8GA 1F68A 4O7AA 4LZ2A 2LSPB 2DKWA 5D26A 5D3TA 4A9OA 4ALGA 5ENJA 4RVRA 4PTBA 5II2A 3O36A 5FH6A 4NRAA 5DKCA 5LVRA 4NR9A 4YBMA 5DW2A 5FH7A 3P1DA 4TZ8A 4QSTA 4LYIA 2WP1A 5LVQA 3O34A 4O78A 5COIA 4QSVA 5CUDA 4QEUA 4LZSA 4LRGA 5CUBA 5D3JA 5EK9A 4CUTA 4YYHA 5DFCA 4HXRA 4QSQA 1N72A 5ETDA 5KHMA 5H1UA 5C4QA 4PKLA 4Y03A 4MR4A 4KV1A 3JVMA 5A5PA 2RFJA 5DYAA 4CFKA 2OSSA 5DYCA 4NRBA 3UVYA 5CUGA 4XY9A 5CQAA 5CQ3A 5J0DA 5LJ2A 5EGUA 4PCIA 4QYDA 4J3IA 5I7YA 3HMEA 2RNWA 2F6JA 4A9JA 4A9LA 5I86A 4Z1QA 5CRZA 1JM4B 4CUQA 5EWCA 3ZYUA 4UIWA 5EPBA 5HRVA 3U5KA 4HBYA 3JVKA 4HXSA 5ETBA 5L8TA 5BT5A 2RNXA 5FE9A 4YAXA 5ENHA 5LKTA 2DWWA 2E3KA 4O77A 4N4FA 4YH4A 5C85A 4NR5A 5ENEA 2R10A 4CURA 5F5ZA 5F62A 4BW4A 4LYWA 3HMFA 5CRMA 5LJ1A 4TTEA 4OUFA 5HFQA 3U5PA 4QR3A 4Z6HA 4Q0OA 5CS8A 4QR4A 5DKHA 5FE3A 4BHWA 5K29A 5IGKA 5CQ7A 5HM0A 4BJXA 3UV2A 4YADA 5TCMA 3MB4A 5LKXA 4QC1A 4C67A 5L97A 5FE6A 5FE0A 4YH3A 4NUDA 4NUCA 5CU8A 5H1VA 5EVAA 3I3JA 3UVDA 4UYFB 3SVGA 5A82A 5HENA 2YYNA 4UYDA 5BT4A 4QSPA 3S91A 4O72A 5E9IA 4O7FA 3JVLA 3QZTA 5D3LA 4NQMA 3SVFA 5ENFA 5EWDA 5EV9A 5I83A 5F2PA 2N9GA 4HBVA 3TLPA 2YEKA 3O37A 2D82A 5EWVA 4TT6A 4PY6A 3QZSA 3O33A 5CUEA 3U5OA 5JI8A 2L5EA 4NYXA 5ACYA 5AD3A 4CL9A 4MR5A 5L99A 4J0SA 4PS5A 5FBXA 4Z6IA 2R0VA 4NS5A 5A7CA 5EWWA 5HRXA 4MEOA 4QSSA 5F3AA 4ALHA 4IR6A 2RNYA 5CQTA 5L96A 3ONIA 4NQNA 5D3PA 4KV4A 2DATA 4C66A 4TZ2A 4YABA 5EI4A 5LKUA 2G4AA 5CFWA 4QR5A 5IBNA 4BW2A 2NXBA 4UIZA 5HRWA 5E73A 5AMEA 2E7NA 5EPRA 5E9MA 5ENGA 5IG6A 2DVQA 4YYDA 5F1LA 5CQ6A 5IGNA 5KO4A 5DY7A 4O71A 4HBXA 3LQIA 2L85A 4HXKA 5DFBA 5E3DA 5HCLA 5E9VA 5CP5A 4F3IA 5I40A 3IU5A 4LZRA 5HFRA 5G4RA 2DVVA 4O74A 3UV4A 4TYLA 5AMFA 5E74A 4A9HA 4O7BA 3NXBA 5FDZA 5F36A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K2J A;  3GG3 A;  4HXM A;  4MEP A;  3S92 A;  4CLB A;  4LYS A;  4QSU A;  4QSR A;  4YY6 A;  5CUC A;  4IR4 A;  4ZW1 A;  4A9K A;  4QEW A;  1EQF A;  4NRC A;  5A85 A;  3MB3 A;  4Z93 A;  4LR6 A;  5A5Q A;  2YDW A;  1ZS5 A;  5E0R A;  4UYH A;  4Q0N A;  3MQM A;  5FE1 A;  1X0J A;  3FKM X;  5FE8 A;  5IGL A;  4CUS A;  2L84 A;  4N4I A;  5D3N A;  3LQJ A;  2D9E A;  4O7E A;  5KTW A;  3MUK A;  5DFD A;  4AKN A;  5A83 A;  5EWH A;  2DVS A;  2E7O A;  3UVX A;  2I8N A;  5A81 A;  4WIV A;  4OGI A;  5FG5 A;  4QSX A;  4J0R A;  5CGP A;  4ZC9 A;  5A5S A;  5CY9 A;  3U5L A;  4MR3 A;  3Q2F A;  5A5R A;  4TT4 A;  5EIC A;  2RS9 B;  2RO1 A;  4YYK A;  5HLS A;  5DYX A;  4XUA A;  3HMH A;  4TU4 A;  5LKZ A;  3SVH A;  5D25 A;  4YK0 A;  3UVW A;  4QB3 A;  5D3H A;  5TB6 A;  5I7X A;  4OGJ A;  1WUG A;  5ENC A;  5HQ5 A;  4O7C A;  4Z1S A;  2FSA A;  5A5N A;  5CZG A;  5HJC A;  3U5J A;  1WUM A;  4IOQ A;  5DKD A;  4HXN A;  4UIY A;  4BW3 A;  4O76 A;  5EA1 A;  4MEN A;  4YYG A;  5H85 A;  5E9K A;  5D3R A;  4DON A;  1JSP B;  4NUE A;  5FG4 A;  4WHW A;  4TT2 A;  5CQ8 A;  5ENI A;  5JWM A;  3MXF A;  2OO1 A;  2WP2 A;  5EM3 A;  5E7D A;  4CUP A;  5LJ0 A;  5D3S A;  5FG6 A;  4YBS A;  4UIT A;  3LJW A;  4QYL A;  5I89 A;  4N4H A;  3UV5 A;  5HEM A;  4GPJ A;  5EQ1 A;  4QY4 A;  5CTL A;  4QUU A;  4BW1 A;  4XYA A;  4N4G A;  5F1H A;  5G4S A;  4NYW A;  4YYM A;  3U5M A;  4A9M A;  4O75 A;  4PCE A;  3G0J A;  3Q2E A;  3LXJ A;  4UYE A;  5KTU A;  4IOO A;  4QUT A;  5CPE A;  4UIU A;  5E9Y A;  4YAT A;  2F6N A;  4MR6 A;  5H1T A;  5FB1 A;  5DYU A;  4NR8 A;  2YW5 A;  5FE2 A;  4TS8 A;  5EPS A;  4NR7 A;  4QBM A;  5I29 A;  5FB0 A;  5EU1 A;  5HQ7 A;  5DX4 A;  4HXO A;  2GRC A;  4CFL A;  4X2I A;  5BT3 A;  4HXL A;  5DW1 A;  5E3G A;  3P5O A;  4O70 A;  5F60 A;  5HQ6 A;  3U5N A;  5I80 A;  4YYJ A;  4IR5 A;  5FFY A;  4NYV A;  2I7K A;  5CQ5 A;  5DLZ A;  5CUA A;  2MJV B;  4UYG A;  5E9L A;  5FE4 A;  3IU6 A;  5D7X A;  3P1C A;  3AAD A;  4TQN A;  5F61 A;  5C89 A;  5D0C A;  5FE5 A;  5EP7 A;  4MEQ A;  5D24 A;  3P1E A;  2RI7 A;  5I88 A;  5IGM A;  4UIX A;  5C7N A;  4A9N A;  2DVR A;  5FFV A;  4N3W A;  2R0Y A;  5LUU A;  5IID A;  4LC2 A;  4YY4 A;  2H60 A;  5FFW A;  3LQH A;  5A5O A;  4A9I A;  4FLP A;  4QNS A;  5DLX A;  5I1Q A;  5DBM A;  5HEL A;  4J1P A;  4IR3 A;  5L8U A;  4XY8 A;  2KTB B;  3MUL A;  4QSW A;  4YC9 A;  4LDF A;  4UYF A;  4YBT A;  4WHU A;  5KTX A;  3DWY A;  4IOR A;  4NR6 A;  3QZV A;  5F63 A;  4XUB A;  5F25 A;  5KU3 A;  2R0S A;  5EIS A;  3P1F A;  4QZS A;  5FH8 A;  4A9F A;  4YYI A;  2OUO A;  4UIV A;  5FE7 A;  4HBW A;  5L98 A;  5C87 A;  2YEL A;  3O35 A;  4NR4 A;  4HXP A;  3UW9 A;  4ZQL A;  1E6I A;  4CUU A;  3DAI A;  5II1 A;  4QC3 A;  5AD2 A;  3D7C A;  3RCW A;  4QEV A;  4TU6 A;  4E96 A;  4NXJ A;  2YQD A;  2YEM A;  4KCX A;  5CQ4 A;  5ENB A;  3AQA A;  3G0L A;  3JVJ A;  4A9E A;  4YYN A;  5C8G A;  1F68 A;  4O7A A;  4LZ2 A;  2LSP B;  2DKW A;  5D26 A;  5D3T A;  4A9O A;  4ALG A;  5ENJ A;  4RVR A;  4PTB A;  5II2 A;  3O36 A;  5FH6 A;  4NRA A;  5DKC A;  5LVR A;  4NR9 A;  4YBM A;  5DW2 A;  5FH7 A;  3P1D A;  4TZ8 A;  4QST A;  4LYI A;  2WP1 A;  5LVQ A;  3O34 A;  4O78 A;  5COI A;  4QSV A;  5CUD A;  4QEU A;  4LZS A;  4LRG A;  5CUB A;  5D3J A;  5EK9 A;  4CUT A;  4YYH A;  5DFC A;  4HXR A;  4QSQ A;  1N72 A;  5ETD A;  5KHM A;  5H1U A;  5C4Q A;  4PKL A;  4Y03 A;  4MR4 A;  4KV1 A;  3JVM A;  5A5P A;  2RFJ A;  5DYA A;  4CFK A;  2OSS A;  5DYC A;  4NRB A;  3UVY A;  5CUG A;  4XY9 A;  5CQA A;  5CQ3 A;  5J0D A;  5LJ2 A;  5EGU A;  4PCI A;  4QYD A;  4J3I A;  5I7Y A;  3HME A;  2RNW A;  2F6J A;  4A9J A;  4A9L A;  5I86 A;  4Z1Q A;  5CRZ A;  1JM4 B;  4CUQ A;  5EWC A;  3ZYU A;  4UIW A;  5EPB A;  5HRV A;  3U5K A;  4HBY A;  3JVK A;  4HXS A;  5ETB A;  5L8T A;  5BT5 A;  2RNX A;  5FE9 A;  4YAX A;  5ENH A;  5LKT A;  2DWW A;  2E3K A;  4O77 A;  4N4F A;  4YH4 A;  5C85 A;  4NR5 A;  5ENE A;  2R10 A;  4CUR A;  5F5Z A;  5F62 A;  4BW4 A;  4LYW A;  3HMF A;  5CRM A;  5LJ1 A;  4TTE A;  4OUF A;  5HFQ A;  3U5P A;  4QR3 A;  4Z6H A;  4Q0O A;  5CS8 A;  4QR4 A;  5DKH A;  5FE3 A;  4BHW A;  5K29 A;  5IGK A;  5CQ7 A;  5HM0 A;  4BJX A;  3UV2 A;  4YAD A;  5TCM A;  3MB4 A;  5LKX A;  4QC1 A;  4C67 A;  5L97 A;  5FE6 A;  5FE0 A;  4YH3 A;  4NUD A;  4NUC A;  5CU8 A;  5H1V A;  5EVA A;  3I3J A;  3UVD A;  4UYF B;  3SVG A;  5A82 A;  5HEN A;  2YYN A;  4UYD A;  5BT4 A;  4QSP A;  3S91 A;  4O72 A;  5E9I A;  4O7F A;  3JVL A;  3QZT A;  5D3L A;  4NQM A;  3SVF A;  5ENF A;  5EWD A;  5EV9 A;  5I83 A;  5F2P A;  2N9G A;  4HBV A;  3TLP A;  2YEK A;  3O37 A;  2D82 A;  5EWV A;  4TT6 A;  4PY6 A;  3QZS A;  3O33 A;  5CUE A;  3U5O A;  5JI8 A;  2L5E A;  4NYX A;  5ACY A;  5AD3 A;  4CL9 A;  4MR5 A;  5L99 A;  4J0S A;  4PS5 A;  5FBX A;  4Z6I A;  2R0V A;  4NS5 A;  5A7C A;  5EWW A;  5HRX A;  4MEO A;  4QSS A;  5F3A A;  4ALH A;  4IR6 A;  2RNY A;  5CQT A;  5L96 A;  3ONI A;  4NQN A;  5D3P A;  4KV4 A;  2DAT A;  4C66 A;  4TZ2 A;  4YAB A;  5EI4 A;  5LKU A;  2G4A A;  5CFW A;  4QR5 A;  5IBN A;  4BW2 A;  2NXB A;  4UIZ A;  5HRW A;  5E73 A;  5AME A;  2E7N A;  5EPR A;  5E9M A;  5ENG A;  5IG6 A;  2DVQ A;  4YYD A;  5F1L A;  5CQ6 A;  5IGN A;  5KO4 A;  5DY7 A;  4O71 A;  4HBX A;  3LQI A;  2L85 A;  4HXK A;  5DFB A;  5E3D A;  5HCL A;  5E9V A;  5CP5 A;  4F3I A;  5I40 A;  3IU5 A;  4LZR A;  5HFR A;  5G4R A;  2DVV A;  4O74 A;  3UV4 A;  4TYL A;  5AMF A;  5E74 A;  4A9H A;  4O7B A;  3NXB A;  5FDZ A;  5F36 A; 
#chains in the Genus database with same CATH topology
 3K2J A;  3GG3 A;  4HXM A;  4MEP A;  3VKG A;  3S92 A;  4CLB A;  4LYS A;  4QSU A;  3D1B A;  4QSR A;  4YY6 A;  5CUC A;  4IR4 A;  4ZW1 A;  4A9K A;  4QEW A;  1EQF A;  4NRC A;  5A85 A;  3MB3 A;  4Z93 A;  4LR6 A;  3VKH A;  5A5Q A;  2YDW A;  1ZS5 A;  5E0R A;  4UYH A;  4Q0N A;  3MQM A;  5FE1 A;  1X0J A;  3FKM X;  5FE8 A;  5IGL A;  4CUS A;  2L84 A;  4N4I A;  5D3N A;  3LQJ A;  1PUO A;  2D9E A;  4O7E A;  5KTW A;  3MUK A;  5DFD A;  4AKN A;  5A83 A;  5EWH A;  2DVS A;  2E7O A;  3UVX A;  2I8N A;  5A81 A;  4WIV A;  4OGI A;  5FG5 A;  4QSX A;  4J0R A;  5CGP A;  4ZC9 A;  5A5S A;  5CY9 A;  3U5L A;  4MR3 A;  3Q2F A;  5A5R A;  4TT4 A;  5EIC A;  2RS9 B;  2RO1 A;  4YYK A;  5HLS A;  5DYX A;  4XUA A;  3HMH A;  4TU4 A;  5LKZ A;  3SVH A;  1ZKR A;  5D25 A;  4YK0 A;  3UVW A;  4QB3 A;  5D3H A;  5TB6 A;  5I7X A;  4OGJ A;  1WUG A;  5ENC A;  5HQ5 A;  4O7C A;  4Z1S A;  2FSA A;  5A5N A;  5CZG A;  5HJC A;  3U5J A;  1WUM A;  4IOQ A;  5DKD A;  4HXN A;  4UIY A;  4BW3 A;  4O76 A;  5EA1 A;  4MEN A;  4YYG A;  5H85 A;  5E9K A;  5D3R A;  4DON A;  1JSP B;  4NUE A;  5FG4 A;  4WHW A;  4TT2 A;  5CQ8 A;  5ENI A;  5JWM A;  3MXF A;  2OO1 A;  2WP2 A;  5EM3 A;  5E7D A;  4CUP A;  5LJ0 A;  5D3S A;  5FG6 A;  4YBS A;  4UIT A;  3LJW A;  4QYL A;  5I89 A;  4N4H A;  3UV5 A;  5HEM A;  4GPJ A;  5EQ1 A;  4QY4 A;  5CTL A;  4QUU A;  4BW1 A;  4XYA A;  4N4G A;  5F1H A;  5G4S A;  4NYW A;  4YYM A;  3U5M A;  4A9M A;  4O75 A;  4PCE A;  3G0J A;  3Q2E A;  3LXJ A;  4UYE A;  5KTU A;  4IOO A;  4QUT A;  5CPE A;  4UIU A;  5E9Y A;  4YAT A;  2F6N A;  4MR6 A;  5H1T A;  5FB1 A;  5DYU A;  4NR8 A;  3ERR A;  2YW5 A;  5FE2 A;  4TS8 A;  5EPS A;  4NR7 A;  4QBM A;  5I29 A;  5FB0 A;  5EU1 A;  5HQ7 A;  5DX4 A;  4HXO A;  2GRC A;  4CFL A;  4X2I A;  5BT3 A;  4HXL A;  5DW1 A;  5E3G A;  3P5O A;  4O70 A;  5F60 A;  5HQ6 A;  3U5N A;  5I80 A;  4YYJ A;  4IR5 A;  5FFY A;  4NYV A;  2I7K A;  5CQ5 A;  5DLZ A;  5CUA A;  2MJV B;  4UYG A;  5E9L A;  5FE4 A;  3IU6 A;  5D7X A;  3P1C A;  3AAD A;  4TQN A;  5F61 A;  5C89 A;  5D0C A;  5FE5 A;  5EP7 A;  4MEQ A;  5D24 A;  3P1E A;  2RI7 A;  5I88 A;  5IGM A;  4UIX A;  5C7N A;  4A9N A;  2DVR A;  5FFV A;  4N3W A;  2R0Y A;  5LUU A;  5IID A;  4LC2 A;  4YY4 A;  2H60 A;  5FFW A;  3LQH A;  5A5O A;  4A9I A;  4FLP A;  4QNS A;  5DLX A;  5I1Q A;  5DBM A;  5HEL A;  4J1P A;  4IR3 A;  5L8U A;  4XY8 A;  2KTB B;  3MUL A;  4QSW A;  4YC9 A;  4LDF A;  4UYF A;  4YBT A;  4WHU A;  5KTX A;  3DWY A;  4IOR A;  4NR6 A;  3QZV A;  5F63 A;  4XUB A;  5F25 A;  5KU3 A;  2R0S A;  5EIS A;  3P1F A;  4QZS A;  5FH8 A;  4A9F A;  4YYI A;  2OUO A;  4UIV A;  5FE7 A;  4HBW A;  5L98 A;  5C87 A;  2YEL A;  3O35 A;  4NR4 A;  4HXP A;  3UW9 A;  4AKG A;  4ZQL A;  1E6I A;  4CUU A;  3DAI A;  5II1 A;  4QC3 A;  5AD2 A;  3D7C A;  3RCW A;  4QEV A;  4TU6 A;  4E96 A;  4AKI A;  4AI6 A;  4NXJ A;  2YQD A;  2YEM A;  4KCX A;  5CQ4 A;  5ENB A;  3AQA A;  3G0L A;  3JVJ A;  4A9E A;  4YYN A;  5C8G A;  1F68 A;  4O7A A;  4LZ2 A;  2LSP B;  2DKW A;  5D26 A;  5D3T A;  4A9O A;  4ALG A;  5ENJ A;  4RVR A;  4PTB A;  5II2 A;  3O36 A;  5FH6 A;  4NRA A;  5DKC A;  5LVR A;  4NR9 A;  4YBM A;  5DW2 A;  5FH7 A;  3P1D A;  4TZ8 A;  4QST A;  4LYI A;  2WP1 A;  5LVQ A;  3O34 A;  4O78 A;  5COI A;  4QSV A;  5CUD A;  4QEU A;  4LZS A;  4LRG A;  5CUB A;  5D3J A;  5EK9 A;  4CUT A;  4YYH A;  5DFC A;  4HXR A;  4QSQ A;  1N72 A;  5ETD A;  5KHM A;  5H1U A;  5C4Q A;  4PKL A;  4Y03 A;  4MR4 A;  4KV1 A;  3JVM A;  5A5P A;  2RFJ A;  5DYA A;  4CFK A;  2OSS A;  5DYC A;  4NRB A;  3UVY A;  5CUG A;  4XY9 A;  5CQA A;  5CQ3 A;  5J0D A;  5LJ2 A;  5EGU A;  4PCI A;  4QYD A;  4J3I A;  5I7Y A;  3HME A;  2RNW A;  2F6J A;  4A9J A;  4A9L A;  5I86 A;  4Z1Q A;  5CRZ A;  1JM4 B;  4CUQ A;  5EWC A;  3ZYU A;  4UIW A;  5EPB A;  5HRV A;  3U5K A;  4HBY A;  3JVK A;  4HXS A;  5ETB A;  5L8T A;  4AKH A;  5BT5 A;  2RNX A;  5FE9 A;  4YAX A;  5ENH A;  5LKT A;  2DWW A;  2E3K A;  4O77 A;  2EJN A;  4N4F A;  4YH4 A;  5C85 A;  4NR5 A;  5ENE A;  2R10 A;  4CUR A;  5F5Z A;  5F62 A;  4BW4 A;  4LYW A;  3HMF A;  5CRM A;  5LJ1 A;  4TTE A;  4OUF A;  5HFQ A;  3U5P A;  4QR3 A;  4Z6H A;  4Q0O A;  5CS8 A;  4QR4 A;  5DKH A;  5FE3 A;  4BHW A;  5K29 A;  5IGK A;  5CQ7 A;  5HM0 A;  3D1D A;  4BJX A;  3UV2 A;  4YAD A;  5TCM A;  3MB4 A;  5LKX A;  4QC1 A;  4C67 A;  5L97 A;  5FE6 A;  5FE0 A;  4YH3 A;  4NUD A;  4NUC A;  5CU8 A;  5H1V A;  5EVA A;  3I3J A;  3UVD A;  4UYF B;  3SVG A;  5A82 A;  5HEN A;  2YYN A;  4UYD A;  5BT4 A;  4QSP A;  3S91 A;  4O72 A;  5E9I A;  4O7F A;  3JVL A;  3QZT A;  5D3L A;  4NQM A;  3SVF A;  5ENF A;  5EWD A;  5EV9 A;  5I83 A;  5F2P A;  2N9G A;  4HBV A;  3TLP A;  2YEK A;  3O37 A;  2D82 A;  5EWV A;  4TT6 A;  4PY6 A;  3QZS A;  3O33 A;  5CUE A;  3U5O A;  5JI8 A;  2L5E A;  4NYX A;  5ACY A;  5AD3 A;  4CL9 A;  4MR5 A;  5L99 A;  4J0S A;  4PS5 A;  5FBX A;  4Z6I A;  2R0V A;  4NS5 A;  5A7C A;  5EWW A;  5HRX A;  4MEO A;  4QSS A;  5F3A A;  4ALH A;  4IR6 A;  2RNY A;  5CQT A;  5L96 A;  3ONI A;  4NQN A;  5D3P A;  4KV4 A;  2DAT A;  4C66 A;  4TZ2 A;  4YAB A;  5EI4 A;  5LKU A;  2G4A A;  5CFW A;  4QR5 A;  5IBN A;  4BW2 A;  2NXB A;  4UIZ A;  5HRW A;  5E73 A;  5AME A;  2E7N A;  5EPR A;  5E9M A;  5ENG A;  5IG6 A;  2DVQ A;  4YYD A;  5F1L A;  5CQ6 A;  5IGN A;  5KO4 A;  5DY7 A;  4O71 A;  4HBX A;  3LQI A;  2L85 A;  4HXK A;  5DFB A;  5E3D A;  5HCL A;  5E9V A;  5CP5 A;  4F3I A;  5I40 A;  3IU5 A;  4LZR A;  5HFR A;  5G4R A;  2DVV A;  4O74 A;  3UV4 A;  4TYL A;  5AMF A;  5E74 A;  4A9H A;  4O7B A;  3NXB A;  5FDZ A;  5F36 A; 
#chains in the Genus database with same CATH homology
 3K2J A;  3GG3 A;  4HXM A;  4MEP A;  3S92 A;  4CLB A;  4LYS A;  4QSU A;  4QSR A;  4YY6 A;  5CUC A;  4IR4 A;  4ZW1 A;  4A9K A;  4QEW A;  1EQF A;  4NRC A;  5A85 A;  3MB3 A;  4Z93 A;  4LR6 A;  5A5Q A;  2YDW A;  1ZS5 A;  5E0R A;  4UYH A;  4Q0N A;  3MQM A;  5FE1 A;  1X0J A;  3FKM X;  5FE8 A;  5IGL A;  4CUS A;  2L84 A;  4N4I A;  5D3N A;  3LQJ A;  2D9E A;  4O7E A;  5KTW A;  3MUK A;  5DFD A;  4AKN A;  5A83 A;  5EWH A;  2DVS A;  2E7O A;  3UVX A;  2I8N A;  5A81 A;  4WIV A;  4OGI A;  5FG5 A;  4QSX A;  4J0R A;  5CGP A;  4ZC9 A;  5A5S A;  5CY9 A;  3U5L A;  4MR3 A;  3Q2F A;  5A5R A;  4TT4 A;  5EIC A;  2RS9 B;  2RO1 A;  4YYK A;  5HLS A;  5DYX A;  4XUA A;  3HMH A;  4TU4 A;  5LKZ A;  3SVH A;  5D25 A;  4YK0 A;  3UVW A;  4QB3 A;  5D3H A;  5TB6 A;  5I7X A;  4OGJ A;  1WUG A;  5ENC A;  5HQ5 A;  4O7C A;  4Z1S A;  2FSA A;  5A5N A;  5CZG A;  5HJC A;  3U5J A;  1WUM A;  4IOQ A;  5DKD A;  4HXN A;  4UIY A;  4BW3 A;  4O76 A;  5EA1 A;  4MEN A;  4YYG A;  5H85 A;  5E9K A;  5D3R A;  4DON A;  1JSP B;  4NUE A;  5FG4 A;  4WHW A;  4TT2 A;  5CQ8 A;  5ENI A;  5JWM A;  3MXF A;  2OO1 A;  2WP2 A;  5EM3 A;  5E7D A;  4CUP A;  5LJ0 A;  5D3S A;  5FG6 A;  4YBS A;  4UIT A;  3LJW A;  4QYL A;  5I89 A;  4N4H A;  3UV5 A;  5HEM A;  4GPJ A;  5EQ1 A;  4QY4 A;  5CTL A;  4QUU A;  4BW1 A;  4XYA A;  4N4G A;  5F1H A;  5G4S A;  4NYW A;  4YYM A;  3U5M A;  4A9M A;  4O75 A;  4PCE A;  3G0J A;  3Q2E A;  3LXJ A;  4UYE A;  5KTU A;  4IOO A;  4QUT A;  5CPE A;  4UIU A;  5E9Y A;  4YAT A;  2F6N A;  4MR6 A;  5H1T A;  5FB1 A;  5DYU A;  4NR8 A;  2YW5 A;  5FE2 A;  4TS8 A;  5EPS A;  4NR7 A;  4QBM A;  5I29 A;  5FB0 A;  5EU1 A;  5HQ7 A;  5DX4 A;  4HXO A;  2GRC A;  4CFL A;  4X2I A;  5BT3 A;  4HXL A;  5DW1 A;  5E3G A;  3P5O A;  4O70 A;  5F60 A;  5HQ6 A;  3U5N A;  5I80 A;  4YYJ A;  4IR5 A;  5FFY A;  4NYV A;  2I7K A;  5CQ5 A;  5DLZ A;  5CUA A;  2MJV B;  4UYG A;  5E9L A;  5FE4 A;  3IU6 A;  5D7X A;  3P1C A;  3AAD A;  4TQN A;  5F61 A;  5C89 A;  5D0C A;  5FE5 A;  5EP7 A;  4MEQ A;  5D24 A;  3P1E A;  2RI7 A;  5I88 A;  5IGM A;  4UIX A;  5C7N A;  4A9N A;  2DVR A;  5FFV A;  4N3W A;  2R0Y A;  5LUU A;  5IID A;  4LC2 A;  4YY4 A;  2H60 A;  5FFW A;  3LQH A;  5A5O A;  4A9I A;  4FLP A;  4QNS A;  5DLX A;  5I1Q A;  5DBM A;  5HEL A;  4J1P A;  4IR3 A;  5L8U A;  4XY8 A;  2KTB B;  3MUL A;  4QSW A;  4YC9 A;  4LDF A;  4UYF A;  4YBT A;  4WHU A;  5KTX A;  3DWY A;  4IOR A;  4NR6 A;  3QZV A;  5F63 A;  4XUB A;  5F25 A;  5KU3 A;  2R0S A;  5EIS A;  3P1F A;  4QZS A;  5FH8 A;  4A9F A;  4YYI A;  2OUO A;  4UIV A;  5FE7 A;  4HBW A;  5L98 A;  5C87 A;  2YEL A;  3O35 A;  4NR4 A;  4HXP A;  3UW9 A;  4ZQL A;  1E6I A;  4CUU A;  3DAI A;  5II1 A;  4QC3 A;  5AD2 A;  3D7C A;  3RCW A;  4QEV A;  4TU6 A;  4E96 A;  4NXJ A;  2YQD A;  2YEM A;  4KCX A;  5CQ4 A;  5ENB A;  3AQA A;  3G0L A;  3JVJ A;  4A9E A;  4YYN A;  5C8G A;  1F68 A;  4O7A A;  4LZ2 A;  2LSP B;  2DKW A;  5D26 A;  5D3T A;  4A9O A;  4ALG A;  5ENJ A;  4RVR A;  4PTB A;  5II2 A;  3O36 A;  5FH6 A;  4NRA A;  5DKC A;  5LVR A;  4NR9 A;  4YBM A;  5DW2 A;  5FH7 A;  3P1D A;  4TZ8 A;  4QST A;  4LYI A;  2WP1 A;  5LVQ A;  3O34 A;  4O78 A;  5COI A;  4QSV A;  5CUD A;  4QEU A;  4LZS A;  4LRG A;  5CUB A;  5D3J A;  5EK9 A;  4CUT A;  4YYH A;  5DFC A;  4HXR A;  4QSQ A;  1N72 A;  5ETD A;  5KHM A;  5H1U A;  5C4Q A;  4PKL A;  4Y03 A;  4MR4 A;  4KV1 A;  3JVM A;  5A5P A;  2RFJ A;  5DYA A;  4CFK A;  2OSS A;  5DYC A;  4NRB A;  3UVY A;  5CUG A;  4XY9 A;  5CQA A;  5CQ3 A;  5J0D A;  5LJ2 A;  5EGU A;  4PCI A;  4QYD A;  4J3I A;  5I7Y A;  3HME A;  2RNW A;  2F6J A;  4A9J A;  4A9L A;  5I86 A;  4Z1Q A;  5CRZ A;  1JM4 B;  4CUQ A;  5EWC A;  3ZYU A;  4UIW A;  5EPB A;  5HRV A;  3U5K A;  4HBY A;  3JVK A;  4HXS A;  5ETB A;  5L8T A;  5BT5 A;  2RNX A;  5FE9 A;  4YAX A;  5ENH A;  5LKT A;  2DWW A;  2E3K A;  4O77 A;  4N4F A;  4YH4 A;  5C85 A;  4NR5 A;  5ENE A;  2R10 A;  4CUR A;  5F5Z A;  5F62 A;  4BW4 A;  4LYW A;  3HMF A;  5CRM A;  5LJ1 A;  4TTE A;  4OUF A;  5HFQ A;  3U5P A;  4QR3 A;  4Z6H A;  4Q0O A;  5CS8 A;  4QR4 A;  5DKH A;  5FE3 A;  4BHW A;  5K29 A;  5IGK A;  5CQ7 A;  5HM0 A;  4BJX A;  3UV2 A;  4YAD A;  5TCM A;  3MB4 A;  5LKX A;  4QC1 A;  4C67 A;  5L97 A;  5FE6 A;  5FE0 A;  4YH3 A;  4NUD A;  4NUC A;  5CU8 A;  5H1V A;  5EVA A;  3I3J A;  3UVD A;  4UYF B;  3SVG A;  5A82 A;  5HEN A;  2YYN A;  4UYD A;  5BT4 A;  4QSP A;  3S91 A;  4O72 A;  5E9I A;  4O7F A;  3JVL A;  3QZT A;  5D3L A;  4NQM A;  3SVF A;  5ENF A;  5EWD A;  5EV9 A;  5I83 A;  5F2P A;  2N9G A;  4HBV A;  3TLP A;  2YEK A;  3O37 A;  2D82 A;  5EWV A;  4TT6 A;  4PY6 A;  3QZS A;  3O33 A;  5CUE A;  3U5O A;  5JI8 A;  2L5E A;  4NYX A;  5ACY A;  5AD3 A;  4CL9 A;  4MR5 A;  5L99 A;  4J0S A;  4PS5 A;  5FBX A;  4Z6I A;  2R0V A;  4NS5 A;  5A7C A;  5EWW A;  5HRX A;  4MEO A;  4QSS A;  5F3A A;  4ALH A;  4IR6 A;  2RNY A;  5CQT A;  5L96 A;  3ONI A;  4NQN A;  5D3P A;  4KV4 A;  2DAT A;  4C66 A;  4TZ2 A;  4YAB A;  5EI4 A;  5LKU A;  2G4A A;  5CFW A;  4QR5 A;  5IBN A;  4BW2 A;  2NXB A;  4UIZ A;  5HRW A;  5E73 A;  5AME A;  2E7N A;  5EPR A;  5E9M A;  5ENG A;  5IG6 A;  2DVQ A;  4YYD A;  5F1L A;  5CQ6 A;  5IGN A;  5KO4 A;  5DY7 A;  4O71 A;  4HBX A;  3LQI A;  2L85 A;  4HXK A;  5DFB A;  5E3D A;  5HCL A;  5E9V A;  5CP5 A;  4F3I A;  5I40 A;  3IU5 A;  4LZR A;  5HFR A;  5G4R A;  2DVV A;  4O74 A;  3UV4 A;  4TYL A;  5AMF A;  5E74 A;  4A9H A;  4O7B A;  3NXB A;  5FDZ A;  5F36 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...