5EPBA

Crystal structure of the bromodomain of human atad2 in complex with compound 49
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
130
structure length
130
Chain Sequence
SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICSNALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ATPase family AAA domain-containing protein 2
publication title Crystal structure of the bromodomain of human ATAD2 in complex with Compound 49
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 53
structure length 130
sequence length 130
ec nomenclature ec 3.6.1.3: Adenosinetriphosphatase.
pdb deposition date 2015-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5epbA00
5E3GA 5DLZA 3P5OA 4QSQA 5E9VA 4MENA 4PS5A 5EWWA 3HMEA 4QSTA 4UYHA 4NUEA 4QSUA 5E3DA 4N4GA 3SVFA 4O72A 5DYAA 5A85A 4YAXA 5CUEA 3IU6A 3UW9A 5FG6A 4IR3A 5IBNA 5C87A 5C8GA 4CUQA 4BW4A 4J3IA 4CUUA 4YYGA 4O77A 4YABA 2YEMA 2DKWA 3UVDA 4A9IA 5H1UA 3JVKA 5DX4A 5C4QA 5A5SA 5HFQA 3U5PA 3MXFA 4NYWA 4CFKA 5H1TA 5CQ8A 5A5QA 4NR9A 2I8NA 5HQ5A 1JM4B 4TZ2A 5EWHA 5I80A 5AMFA 4YATA 1E6IA 5DKDA 2WP1A 4HXPA 5I7YA 4IR4A 5FFVA 2F6JA 3LJWA 4IR6A 3LXJA 5LKUA 4HBYA 5A7CA 5EV9A 5EA1A 4IOQA 5CTLA 5D3TA 4QZSA 4YH4A 2D9EA 2FSAA 5F3AA 2G4AA 3MB4A 5ENEA 3LQJA 3UV5A 3GG3A 4PKLA 5I7XA 2N9GA 5CUDA 5EISA 4NR5A 5F1LA 5F1HA 5D3JA 4A9NA 5CUCA 4XYAA 3D7CA 5F5ZA 4Y03A 3JVLA 5L97A 2RO1A 4QUUA 4NRCA 5LUUA 4NR7A 2LSPB 5ENFA 5CQ5A 5FE7A 5CRZA 4LYIA 2YQDA 4PTBA 5F60A 5D24A 5FDZA 4MR3A 5C89A 4PCIA 4LDFA 4YYJA 2I7KA 4HXLA 5I89A 4OGIA 2R0SA 5EK9A 5I83A 5A81A 4PCEA 5L98A 5FB1A 4YH3A 5CFWA 4N4HA 4QSPA 4YYDA 4LYWA 5F36A 5A83A 5COIA 5HCLA 5HM0A 2R10A 3U5OA 5TB6A 4CUPA 5ENCA 5EP7A 5A5RA 5BT4A 4HBVA 5LJ2A 5IGNA 5FE2A 3P1FA 4YBSA 5EICA 5FE6A 5IG6A 5L8TA 2L85A 4GPJA 5D7XA 5E9MA 2RNWA 5LKZA 4N4IA 4HXMA 4NS5A 5KTXA 5ENJA 4J0SA 2YDWA 4YC9A 4TS8A 5EWDA 3Q2EA 3UVWA 5I40A 1ZS5A 3U5KA 5H85A 5CUBA 5HRWA 4UYFA 5EU1A 4CUSA 3UVXA 5I29A 5IGLA 5FG4A 3ZYUA 5ETDA 5EPBA 2E7NA 5DW1A 4O75A 3UVYA 5IGKA 2E7OA 5AMEA 3Q2FA 4J1PA 4TT2A 4YK0A 3HMHA 5FE1A 5HFRA 2D82A 2YW5A 4CFLA 4QEUA 5HLSA 4QSVA 4NUDA 5JI8A 5ENIA 5I88A 1X0JA 5CU8A 4Q0OA 4LRGA 3O35A 4NYXA 4QSRA 4TT6A 4O7EA 2YELA 5AD3A 4CURA 1F68A 4A9FA 3LQHA 5D3SA 4IOOA 3MUKA 4ZQLA 5HENA 4C67A 1JSPB 2NXBA 5D26A 3SVGA 4A9LA 5CQTA 5CQAA 4QR5A 5DKHA 5ENBA 5FBXA 5CQ4A 5LKTA 4ZC9A 5CUAA 5D3HA 4N4FA 4O7CA 5K29A 5L8UA 4MR6A 4HBWA 5E9LA 4BHWA 5E7DA 5DFDA 4HXOA 4UIUA 5FE3A 5FH6A 5KHMA 3U5NA 4TYLA 5JWMA 2DVVA 3DAIA 5EWVA 3MULA 4WHWA 3HMFA 4UIXA 4XY8A 3P1DA 4PY6A 5ENHA 2YEKA 5FE4A 4TQNA 4CL9A 5EGUA 5FE9A 5EWCA 5F61A 3P1EA 4QYLA 4Z1SA 2DVRA 4YYMA 1EQFA 3DWYA 5II2A 5G4RA 3TLPA 3AQAA 4QEWA 4TT4A 3G0JA 5DYUA 5CP5A 5IGMA 5DYCA 3I3JA 4HXKA 4TZ8A 5DKCA 4IR5A 2YYNA 4NRAA 2DWWA 2MJVB 4A9JA 4A9EA 5HQ6A 4YADA 4QC1A 5CPEA 3ONIA 4Z6HA 5LVQA 4QYDA 5F63A 3P1CA 5CQ7A 3FKMX 5BT5A 5E73A 3G0LA 5CUGA 5EPRA 5E74A 4ALHA 5I86A 4KV1A 4NRBA 2OO1A 4CLBA 4YYIA 5D3RA 5HJCA 4LR6A 2GRCA 3UV4A 4UIZA 5EVAA 4HXRA 5D0CA 4O78A 4N3WA 4TU4A 4IORA 4Q0NA 5DY7A 4NYVA 5KTUA 3QZTA 4LC2A 5D3NA 5EI4A 4QBMA 2L5EA 4YY6A 4A9MA 5F62A 4F3IA 4Z1QA 5E9YA 4LZ2A 5D3PA 4QY4A 5D3LA 3LQIA 5HRVA 2DVQA 5KU3A 3U5LA 4YYHA 4TTEA 5AD2A 4QUTA 5II1A 5A5PA 4DONA 4NQNA 4UYDA 4MR5A 2OSSA 5FE5A 4KCXA 5C85A 4BW3A 4QNSA 2WP2A 5FE8A 4QSSA 4TU6A 2RI7A 2R0YA 4YYKA 3RCWA 3JVJA 4QSWA 5ETBA 3JVMA 5EPSA 5FFWA 4BW1A 4NXJA 5C7NA 4YBMA 2RNXA 5FFYA 1N72A 5FG5A 3S91A 3AADA 4O71A 5L96A 2RS9B 2H60A 3K2JA 3S92A 4XUBA 4A9OA 3QZVA 3U5MA 4Z6IA 3NXBA 4LYSA 5KTWA 4OGJA 3U5JA 4MEQA 2F6NA 4LZSA 1WUMA 5EM3A 3MQMA 5L99A 5A5OA 4YYNA 4NR4A 4A9HA 4WHUA 4UYFB 5F25A 5H1VA 2DATA 4QC3A 4NR8A 2RNYA 4Z93A 4YY4A 4O7AA 5FH8A 5E0RA 2DVSA 4HXSA 5HQ7A 3O37A 5CGPA 4CUTA 5G4SA 5A5NA 4QSXA 5DLXA 3IU5A 4XUAA 5ENGA 4LZRA 5IIDA 3SVHA 3O33A 4QR4A 5E9KA 4YBTA 5HRXA 4UIWA 2E3KA 5KO4A 4RVRA 4ALGA 4X2IA 5TCMA 4A9KA 3UV2A 5FB0A 4UITA 4QR3A 5DFBA 5HELA 5HEMA 5BT3A 5DFCA 4O7BA 2RFJA 4FLPA 4WIVA 2R0VA 4NQMA 4HBXA 4AKNA 4ZW1A 1WUGA 4QEVA 2OUOA 5DW2A 4O70A 4J0RA 5LKXA 5DBMA 5A82A 4OUFA 5FH7A 4MEOA 4MR4A 4E96A 4BJXA 2L84A 4MEPA 4UYEA 4BW2A 5CQ3A 4XY9A 2KTBB 5E9IA 5J0DA 4UYGA 3QZSA 5LJ0A 5CY9A 5DYXA 5D25A 3O34A 5CS8A 3MB3A 5CRMA 5EQ1A 5LJ1A 5ACYA 5I1QA 4KV4A 5LVRA 5CQ6A 5FE0A 4UIYA 4NR6A 4UIVA 4O76A 3O36A 4C66A 5CZGA 4NUCA 4O7FA 4HXNA 4O74A 5F2PA 4QB3A
chains in the Genus database with same CATH superfamily
5E3GA 5DLZA 3P5OA 4QSQA 5E9VA 4MENA 4PS5A 5EWWA 3HMEA 4QSTA 4UYHA 4NUEA 4QSUA 5E3DA 4N4GA 3SVFA 4O72A 5DYAA 5A85A 4YAXA 5CUEA 3IU6A 3UW9A 5FG6A 4IR3A 5IBNA 5C87A 5C8GA 4CUQA 4BW4A 4J3IA 3D1DA 4CUUA 4YYGA 4O77A 4YABA 2YEMA 2DKWA 3UVDA 4A9IA 5H1UA 3JVKA 5DX4A 1PUOA 5C4QA 5A5SA 5HFQA 1ZKRA 3U5PA 3MXFA 4NYWA 4CFKA 5H1TA 5CQ8A 5A5QA 4NR9A 2I8NA 5HQ5A 1JM4B 4TZ2A 5EWHA 5I80A 5AMFA 4YATA 1E6IA 5DKDA 2WP1A 4HXPA 5I7YA 4IR4A 5FFVA 2F6JA 3LJWA 4IR6A 3LXJA 5LKUA 4HBYA 5A7CA 5EV9A 5EA1A 4IOQA 5CTLA 5D3TA 4QZSA 4YH4A 2D9EA 2FSAA 5F3AA 2G4AA 3MB4A 5ENEA 3LQJA 3UV5A 3GG3A 4PKLA 5I7XA 2N9GA 5CUDA 5EISA 4NR5A 5F1LA 5F1HA 5D3JA 4A9NA 5CUCA 4XYAA 3D7CA 5F5ZA 4Y03A 3JVLA 5L97A 2RO1A 4QUUA 4NRCA 5LUUA 4NR7A 2LSPB 5ENFA 5CQ5A 5FE7A 5CRZA 4LYIA 2YQDA 4PTBA 5F60A 5D24A 5FDZA 4MR3A 5C89A 4PCIA 4LDFA 4YYJA 2I7KA 4HXLA 5I89A 4OGIA 2R0SA 5EK9A 5I83A 5A81A 4PCEA 3ERRA 5L98A 5FB1A 4YH3A 5CFWA 4N4HA 4QSPA 4YYDA 4LYWA 5F36A 5A83A 5COIA 5HCLA 5HM0A 2R10A 3U5OA 5TB6A 4CUPA 5ENCA 4AKIA 5EP7A 5A5RA 5BT4A 4HBVA 5LJ2A 5IGNA 5FE2A 3P1FA 4YBSA 5EICA 5FE6A 5IG6A 5L8TA 2L85A 4GPJA 5D7XA 5E9MA 2RNWA 5LKZA 4N4IA 4HXMA 4NS5A 5KTXA 5ENJA 4J0SA 2YDWA 4YC9A 4TS8A 5EWDA 3Q2EA 3UVWA 5I40A 1ZS5A 3U5KA 5H85A 5CUBA 5HRWA 4UYFA 5EU1A 4CUSA 3UVXA 5I29A 5IGLA 5FG4A 3ZYUA 5ETDA 5EPBA 2E7NA 5DW1A 4O75A 3UVYA 5IGKA 2E7OA 5AMEA 3VKHA 3Q2FA 4J1PA 4TT2A 4YK0A 3HMHA 5FE1A 5HFRA 2D82A 2YW5A 4CFLA 4QEUA 5HLSA 4QSVA 4NUDA 5JI8A 5ENIA 5I88A 1X0JA 5CU8A 4Q0OA 4LRGA 3O35A 4NYXA 4QSRA 4TT6A 4O7EA 2YELA 5AD3A 4CURA 1F68A 4A9FA 3LQHA 5D3SA 4AKGA 4IOOA 3MUKA 4ZQLA 5HENA 4C67A 1JSPB 2NXBA 5D26A 3SVGA 4A9LA 5CQTA 5CQAA 4QR5A 5DKHA 5ENBA 5FBXA 5CQ4A 5LKTA 4ZC9A 5CUAA 5D3HA 4N4FA 4O7CA 5K29A 5L8UA 4MR6A 4HBWA 5E9LA 4BHWA 5E7DA 5DFDA 4HXOA 4UIUA 5FE3A 5FH6A 5KHMA 3U5NA 4TYLA 5JWMA 2DVVA 3DAIA 5EWVA 3MULA 4WHWA 3HMFA 4UIXA 4XY8A 3P1DA 4PY6A 5ENHA 2YEKA 5FE4A 4TQNA 4CL9A 5EGUA 5FE9A 5EWCA 5F61A 3P1EA 4QYLA 4Z1SA 2DVRA 4YYMA 1EQFA 3DWYA 5II2A 5G4RA 3TLPA 3AQAA 4QEWA 4TT4A 3G0JA 5DYUA 5CP5A 5IGMA 5DYCA 3I3JA 4HXKA 4TZ8A 5DKCA 4IR5A 2YYNA 4NRAA 2DWWA 2MJVB 4A9JA 4A9EA 5HQ6A 4YADA 4QC1A 5CPEA 3ONIA 4Z6HA 5LVQA 4QYDA 5F63A 3P1CA 5CQ7A 3FKMX 5BT5A 5E73A 3G0LA 5CUGA 5EPRA 5E74A 4ALHA 5I86A 4KV1A 4NRBA 2OO1A 4CLBA 4YYIA 5D3RA 5HJCA 4LR6A 2GRCA 3UV4A 4UIZA 5EVAA 4HXRA 5D0CA 4O78A 4N3WA 4TU4A 4IORA 4Q0NA 5DY7A 4NYVA 5KTUA 3QZTA 4LC2A 5D3NA 5EI4A 3VKGA 4QBMA 2L5EA 4YY6A 4A9MA 5F62A 4F3IA 4Z1QA 5E9YA 4LZ2A 5D3PA 4QY4A 5D3LA 3LQIA 5HRVA 2DVQA 5KU3A 3U5LA 4YYHA 4TTEA 5AD2A 4QUTA 5II1A 5A5PA 4DONA 4NQNA 4UYDA 4MR5A 2OSSA 5FE5A 4KCXA 5C85A 4BW3A 4QNSA 2WP2A 5FE8A 4QSSA 4TU6A 2RI7A 2R0YA 4YYKA 3RCWA 3JVJA 4QSWA 5ETBA 3JVMA 5EPSA 5FFWA 4BW1A 4NXJA 5C7NA 4YBMA 2RNXA 5FFYA 1N72A 5FG5A 3S91A 3AADA 4O71A 5L96A 2RS9B 2H60A 3K2JA 3S92A 4XUBA 4A9OA 3QZVA 3U5MA 4Z6IA 3NXBA 4LYSA 5KTWA 4OGJA 3U5JA 4MEQA 2F6NA 4LZSA 1WUMA 5EM3A 3MQMA 5L99A 5A5OA 4YYNA 4NR4A 4A9HA 4WHUA 4UYFB 5F25A 5H1VA 2DATA 4QC3A 4NR8A 2RNYA 4Z93A 4YY4A 4O7AA 5FH8A 5E0RA 2DVSA 4HXSA 5HQ7A 3O37A 5CGPA 4CUTA 5G4SA 5A5NA 4QSXA 5DLXA 3IU5A 4XUAA 5ENGA 4LZRA 5IIDA 3SVHA 4AKHA 3O33A 4QR4A 5E9KA 3D1BA 4YBTA 5HRXA 4UIWA 2E3KA 5KO4A 4RVRA 4ALGA 4X2IA 5TCMA 4A9KA 3UV2A 5FB0A 4UITA 4QR3A 5DFBA 5HELA 5HEMA 5BT3A 5DFCA 4O7BA 2RFJA 4FLPA 4WIVA 2R0VA 4NQMA 4HBXA 4AI6A 4AKNA 4ZW1A 1WUGA 4QEVA 2OUOA 5DW2A 4O70A 4J0RA 5LKXA 5DBMA 5A82A 4OUFA 5FH7A 4MEOA 4MR4A 4E96A 4BJXA 2L84A 4MEPA 4UYEA 4BW2A 5CQ3A 4XY9A 2KTBB 5E9IA 5J0DA 4UYGA 3QZSA 2EJNA 5CY9A 5DYXA 5LJ0A 5D25A 3O34A 5CS8A 3MB3A 5CRMA 5EQ1A 5LJ1A 5ACYA 5I1QA 4KV4A 5LVRA 5CQ6A 5FE0A 4UIYA 4NR6A 4UIVA 4O76A 3O36A 4C66A 5CZGA 4NUCA 4O7FA 4HXNA 4O74A 5F2PA 4QB3A
chains in the Genus database with same CATH topology
5E3GA 5DLZA 3P5OA 4QSQA 5E9VA 4MENA 4PS5A 5EWWA 3HMEA 4QSTA 4UYHA 4NUEA 4QSUA 5E3DA 4N4GA 3SVFA 4O72A 5DYAA 5A85A 4YAXA 5CUEA 3IU6A 3UW9A 5FG6A 4IR3A 5IBNA 5C87A 5C8GA 4CUQA 4BW4A 4J3IA 4CUUA 4YYGA 4O77A 4YABA 2YEMA 2DKWA 3UVDA 4A9IA 5H1UA 3JVKA 5DX4A 5C4QA 5A5SA 5HFQA 3U5PA 3MXFA 4NYWA 4CFKA 5H1TA 5CQ8A 5A5QA 4NR9A 2I8NA 5HQ5A 1JM4B 4TZ2A 5EWHA 5I80A 5AMFA 4YATA 1E6IA 5DKDA 2WP1A 4HXPA 5I7YA 4IR4A 5FFVA 2F6JA 3LJWA 4IR6A 3LXJA 5LKUA 4HBYA 5A7CA 5EV9A 5EA1A 4IOQA 5CTLA 5D3TA 4QZSA 4YH4A 2D9EA 2FSAA 5F3AA 2G4AA 3MB4A 5ENEA 3LQJA 3UV5A 3GG3A 4PKLA 5I7XA 2N9GA 5CUDA 5EISA 4NR5A 5F1LA 5F1HA 5D3JA 4A9NA 5CUCA 4XYAA 3D7CA 5F5ZA 4Y03A 3JVLA 5L97A 2RO1A 4QUUA 4NRCA 5LUUA 4NR7A 2LSPB 5ENFA 5CQ5A 5FE7A 5CRZA 4LYIA 2YQDA 4PTBA 5F60A 5D24A 5FDZA 4MR3A 5C89A 4PCIA 4LDFA 4YYJA 2I7KA 4HXLA 5I89A 4OGIA 2R0SA 5EK9A 5I83A 5A81A 4PCEA 5L98A 5FB1A 4YH3A 5CFWA 4N4HA 4QSPA 4YYDA 4LYWA 5F36A 5A83A 5COIA 5HCLA 5HM0A 2R10A 3U5OA 5TB6A 4CUPA 5ENCA 5EP7A 5A5RA 5BT4A 4HBVA 5LJ2A 5IGNA 5FE2A 3P1FA 4YBSA 5EICA 5FE6A 5IG6A 5L8TA 2L85A 4GPJA 5D7XA 5E9MA 2RNWA 5LKZA 4N4IA 4HXMA 4NS5A 5KTXA 5ENJA 4J0SA 2YDWA 4YC9A 4TS8A 5EWDA 3Q2EA 3UVWA 5I40A 1ZS5A 3U5KA 5H85A 5CUBA 5HRWA 4UYFA 5EU1A 4CUSA 3UVXA 5I29A 5IGLA 5FG4A 3ZYUA 5ETDA 5EPBA 2E7NA 5DW1A 4O75A 3UVYA 5IGKA 2E7OA 5AMEA 3Q2FA 4J1PA 4TT2A 4YK0A 3HMHA 5FE1A 5HFRA 2D82A 2YW5A 4CFLA 4QEUA 5HLSA 4QSVA 4NUDA 5JI8A 5ENIA 5I88A 1X0JA 5CU8A 4Q0OA 4LRGA 3O35A 4NYXA 4QSRA 4TT6A 4O7EA 2YELA 5AD3A 4CURA 1F68A 4A9FA 3LQHA 5D3SA 4IOOA 3MUKA 4ZQLA 5HENA 4C67A 1JSPB 2NXBA 5D26A 3SVGA 4A9LA 5CQTA 5CQAA 4QR5A 5DKHA 5ENBA 5FBXA 5CQ4A 5LKTA 4ZC9A 5CUAA 5D3HA 4N4FA 4O7CA 5K29A 5L8UA 4MR6A 4HBWA 5E9LA 4BHWA 5E7DA 5DFDA 4HXOA 4UIUA 5FE3A 5FH6A 5KHMA 3U5NA 4TYLA 5JWMA 2DVVA 3DAIA 5EWVA 3MULA 4WHWA 3HMFA 4UIXA 4XY8A 3P1DA 4PY6A 5ENHA 2YEKA 5FE4A 4TQNA 4CL9A 5EGUA 5FE9A 5EWCA 5F61A 3P1EA 4QYLA 4Z1SA 2DVRA 4YYMA 1EQFA 3DWYA 5II2A 5G4RA 3TLPA 3AQAA 4QEWA 4TT4A 3G0JA 5DYUA 5CP5A 5IGMA 5DYCA 3I3JA 4HXKA 4TZ8A 5DKCA 4IR5A 2YYNA 4NRAA 2DWWA 2MJVB 4A9JA 4A9EA 5HQ6A 4YADA 4QC1A 5CPEA 3ONIA 4Z6HA 5LVQA 4QYDA 5F63A 3P1CA 5CQ7A 3FKMX 5BT5A 5E73A 3G0LA 5CUGA 5EPRA 5E74A 4ALHA 5I86A 4KV1A 4NRBA 2OO1A 4CLBA 4YYIA 5D3RA 5HJCA 4LR6A 2GRCA 3UV4A 4UIZA 5EVAA 4HXRA 5D0CA 4O78A 4N3WA 4TU4A 4IORA 4Q0NA 5DY7A 4NYVA 5KTUA 3QZTA 4LC2A 5D3NA 5EI4A 4QBMA 2L5EA 4YY6A 4A9MA 5F62A 4F3IA 4Z1QA 5E9YA 4LZ2A 5D3PA 4QY4A 5D3LA 3LQIA 5HRVA 2DVQA 5KU3A 3U5LA 4YYHA 4TTEA 5AD2A 4QUTA 5II1A 5A5PA 4DONA 4NQNA 4UYDA 4MR5A 2OSSA 5FE5A 4KCXA 5C85A 4BW3A 4QNSA 2WP2A 5FE8A 4QSSA 4TU6A 2RI7A 2R0YA 4YYKA 3RCWA 3JVJA 4QSWA 5ETBA 3JVMA 5EPSA 5FFWA 4BW1A 4NXJA 5C7NA 4YBMA 2RNXA 5FFYA 1N72A 5FG5A 3S91A 3AADA 4O71A 5L96A 2RS9B 2H60A 3K2JA 3S92A 4XUBA 4A9OA 3QZVA 3U5MA 4Z6IA 3NXBA 4LYSA 5KTWA 4OGJA 3U5JA 4MEQA 2F6NA 4LZSA 1WUMA 5EM3A 3MQMA 5L99A 5A5OA 4YYNA 4NR4A 4A9HA 4WHUA 4UYFB 5F25A 5H1VA 2DATA 4QC3A 4NR8A 2RNYA 4Z93A 4YY4A 4O7AA 5FH8A 5E0RA 2DVSA 4HXSA 5HQ7A 3O37A 5CGPA 4CUTA 5G4SA 5A5NA 4QSXA 5DLXA 3IU5A 4XUAA 5ENGA 4LZRA 5IIDA 3SVHA 3O33A 4QR4A 5E9KA 4YBTA 5HRXA 4UIWA 2E3KA 5KO4A 4RVRA 4ALGA 4X2IA 5TCMA 4A9KA 3UV2A 5FB0A 4UITA 4QR3A 5DFBA 5HELA 5HEMA 5BT3A 5DFCA 4O7BA 2RFJA 4FLPA 4WIVA 2R0VA 4NQMA 4HBXA 4AKNA 4ZW1A 1WUGA 4QEVA 2OUOA 5DW2A 4O70A 4J0RA 5LKXA 5DBMA 5A82A 4OUFA 5FH7A 4MEOA 4MR4A 4E96A 4BJXA 2L84A 4MEPA 4UYEA 4BW2A 5CQ3A 4XY9A 2KTBB 5E9IA 5J0DA 4UYGA 3QZSA 5LJ0A 5CY9A 5DYXA 5D25A 3O34A 5CS8A 3MB3A 5CRMA 5EQ1A 5LJ1A 5ACYA 5I1QA 4KV4A 5LVRA 5CQ6A 5FE0A 4UIYA 4NR6A 4UIVA 4O76A 3O36A 4C66A 5CZGA 4NUCA 4O7FA 4HXNA 4O74A 5F2PA 4QB3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E3G A;  5DLZ A;  3P5O A;  4QSQ A;  5E9V A;  4MEN A;  4PS5 A;  5EWW A;  3HME A;  4QST A;  4UYH A;  4NUE A;  4QSU A;  5E3D A;  4N4G A;  3SVF A;  4O72 A;  5DYA A;  5A85 A;  4YAX A;  5CUE A;  3IU6 A;  3UW9 A;  5FG6 A;  4IR3 A;  5IBN A;  5C87 A;  5C8G A;  4CUQ A;  4BW4 A;  4J3I A;  4CUU A;  4YYG A;  4O77 A;  4YAB A;  2YEM A;  2DKW A;  3UVD A;  4A9I A;  5H1U A;  3JVK A;  5DX4 A;  5C4Q A;  5A5S A;  5HFQ A;  3U5P A;  3MXF A;  4NYW A;  4CFK A;  5H1T A;  5CQ8 A;  5A5Q A;  4NR9 A;  2I8N A;  5HQ5 A;  1JM4 B;  4TZ2 A;  5EWH A;  5I80 A;  5AMF A;  4YAT A;  1E6I A;  5DKD A;  2WP1 A;  4HXP A;  5I7Y A;  4IR4 A;  5FFV A;  2F6J A;  3LJW A;  4IR6 A;  3LXJ A;  5LKU A;  4HBY A;  5A7C A;  5EV9 A;  5EA1 A;  4IOQ A;  5CTL A;  5D3T A;  4QZS A;  4YH4 A;  2D9E A;  2FSA A;  5F3A A;  2G4A A;  3MB4 A;  5ENE A;  3LQJ A;  3UV5 A;  3GG3 A;  4PKL A;  5I7X A;  2N9G A;  5CUD A;  5EIS A;  4NR5 A;  5F1L A;  5F1H A;  5D3J A;  4A9N A;  5CUC A;  4XYA A;  3D7C A;  5F5Z A;  4Y03 A;  3JVL A;  5L97 A;  2RO1 A;  4QUU A;  4NRC A;  5LUU A;  4NR7 A;  2LSP B;  5ENF A;  5CQ5 A;  5FE7 A;  5CRZ A;  4LYI A;  2YQD A;  4PTB A;  5F60 A;  5D24 A;  5FDZ A;  4MR3 A;  5C89 A;  4PCI A;  4LDF A;  4YYJ A;  2I7K A;  4HXL A;  5I89 A;  4OGI A;  2R0S A;  5EK9 A;  5I83 A;  5A81 A;  4PCE A;  5L98 A;  5FB1 A;  4YH3 A;  5CFW A;  4N4H A;  4QSP A;  4YYD A;  4LYW A;  5F36 A;  5A83 A;  5COI A;  5HCL A;  5HM0 A;  2R10 A;  3U5O A;  5TB6 A;  4CUP A;  5ENC A;  5EP7 A;  5A5R A;  5BT4 A;  4HBV A;  5LJ2 A;  5IGN A;  5FE2 A;  3P1F A;  4YBS A;  5EIC A;  5FE6 A;  5IG6 A;  5L8T A;  2L85 A;  4GPJ A;  5D7X A;  5E9M A;  2RNW A;  5LKZ A;  4N4I A;  4HXM A;  4NS5 A;  5KTX A;  5ENJ A;  4J0S A;  2YDW A;  4YC9 A;  4TS8 A;  5EWD A;  3Q2E A;  3UVW A;  5I40 A;  1ZS5 A;  3U5K A;  5H85 A;  5CUB A;  5HRW A;  4UYF A;  5EU1 A;  4CUS A;  3UVX A;  5I29 A;  5IGL A;  5FG4 A;  3ZYU A;  5ETD A;  5EPB A;  2E7N A;  5DW1 A;  4O75 A;  3UVY A;  5IGK A;  2E7O A;  5AME A;  3Q2F A;  4J1P A;  4TT2 A;  4YK0 A;  3HMH A;  5FE1 A;  5HFR A;  2D82 A;  2YW5 A;  4CFL A;  4QEU A;  5HLS A;  4QSV A;  4NUD A;  5JI8 A;  5ENI A;  5I88 A;  1X0J A;  5CU8 A;  4Q0O A;  4LRG A;  3O35 A;  4NYX A;  4QSR A;  4TT6 A;  4O7E A;  2YEL A;  5AD3 A;  4CUR A;  1F68 A;  4A9F A;  3LQH A;  5D3S A;  4IOO A;  3MUK A;  4ZQL A;  5HEN A;  4C67 A;  1JSP B;  2NXB A;  5D26 A;  3SVG A;  4A9L A;  5CQT A;  5CQA A;  4QR5 A;  5DKH A;  5ENB A;  5FBX A;  5CQ4 A;  5LKT A;  4ZC9 A;  5CUA A;  5D3H A;  4N4F A;  4O7C A;  5K29 A;  5L8U A;  4MR6 A;  4HBW A;  5E9L A;  4BHW A;  5E7D A;  5DFD A;  4HXO A;  4UIU A;  5FE3 A;  5FH6 A;  5KHM A;  3U5N A;  4TYL A;  5JWM A;  2DVV A;  3DAI A;  5EWV A;  3MUL A;  4WHW A;  3HMF A;  4UIX A;  4XY8 A;  3P1D A;  4PY6 A;  5ENH A;  2YEK A;  5FE4 A;  4TQN A;  4CL9 A;  5EGU A;  5FE9 A;  5EWC A;  5F61 A;  3P1E A;  4QYL A;  4Z1S A;  2DVR A;  4YYM A;  1EQF A;  3DWY A;  5II2 A;  5G4R A;  3TLP A;  3AQA A;  4QEW A;  4TT4 A;  3G0J A;  5DYU A;  5CP5 A;  5IGM A;  5DYC A;  3I3J A;  4HXK A;  4TZ8 A;  5DKC A;  4IR5 A;  2YYN A;  4NRA A;  2DWW A;  2MJV B;  4A9J A;  4A9E A;  5HQ6 A;  4YAD A;  4QC1 A;  5CPE A;  3ONI A;  4Z6H A;  5LVQ A;  4QYD A;  5F63 A;  3P1C A;  5CQ7 A;  3FKM X;  5BT5 A;  5E73 A;  3G0L A;  5CUG A;  5EPR A;  5E74 A;  4ALH A;  5I86 A;  4KV1 A;  4NRB A;  2OO1 A;  4CLB A;  4YYI A;  5D3R A;  5HJC A;  4LR6 A;  2GRC A;  3UV4 A;  4UIZ A;  5EVA A;  4HXR A;  5D0C A;  4O78 A;  4N3W A;  4TU4 A;  4IOR A;  4Q0N A;  5DY7 A;  4NYV A;  5KTU A;  3QZT A;  4LC2 A;  5D3N A;  5EI4 A;  4QBM A;  2L5E A;  4YY6 A;  4A9M A;  5F62 A;  4F3I A;  4Z1Q A;  5E9Y A;  4LZ2 A;  5D3P A;  4QY4 A;  5D3L A;  3LQI A;  5HRV A;  2DVQ A;  5KU3 A;  3U5L A;  4YYH A;  4TTE A;  5AD2 A;  4QUT A;  5II1 A;  5A5P A;  4DON A;  4NQN A;  4UYD A;  4MR5 A;  2OSS A;  5FE5 A;  4KCX A;  5C85 A;  4BW3 A;  4QNS A;  2WP2 A;  5FE8 A;  4QSS A;  4TU6 A;  2RI7 A;  2R0Y A;  4YYK A;  3RCW A;  3JVJ A;  4QSW A;  5ETB A;  3JVM A;  5EPS A;  5FFW A;  4BW1 A;  4NXJ A;  5C7N A;  4YBM A;  2RNX A;  5FFY A;  1N72 A;  5FG5 A;  3S91 A;  3AAD A;  4O71 A;  5L96 A;  2RS9 B;  2H60 A;  3K2J A;  3S92 A;  4XUB A;  4A9O A;  3QZV A;  3U5M A;  4Z6I A;  3NXB A;  4LYS A;  5KTW A;  4OGJ A;  3U5J A;  4MEQ A;  2F6N A;  4LZS A;  1WUM A;  5EM3 A;  3MQM A;  5L99 A;  5A5O A;  4YYN A;  4NR4 A;  4A9H A;  4WHU A;  4UYF B;  5F25 A;  5H1V A;  2DAT A;  4QC3 A;  4NR8 A;  2RNY A;  4Z93 A;  4YY4 A;  4O7A A;  5FH8 A;  5E0R A;  2DVS A;  4HXS A;  5HQ7 A;  3O37 A;  5CGP A;  4CUT A;  5G4S A;  5A5N A;  4QSX A;  5DLX A;  3IU5 A;  4XUA A;  5ENG A;  4LZR A;  5IID A;  3SVH A;  3O33 A;  4QR4 A;  5E9K A;  4YBT A;  5HRX A;  4UIW A;  2E3K A;  5KO4 A;  4RVR A;  4ALG A;  4X2I A;  5TCM A;  4A9K A;  3UV2 A;  5FB0 A;  4UIT A;  4QR3 A;  5DFB A;  5HEL A;  5HEM A;  5BT3 A;  5DFC A;  4O7B A;  2RFJ A;  4FLP A;  4WIV A;  2R0V A;  4NQM A;  4HBX A;  4AKN A;  4ZW1 A;  1WUG A;  4QEV A;  2OUO A;  5DW2 A;  4O70 A;  4J0R A;  5LKX A;  5DBM A;  5A82 A;  4OUF A;  5FH7 A;  4MEO A;  4MR4 A;  4E96 A;  4BJX A;  2L84 A;  4MEP A;  4UYE A;  4BW2 A;  5CQ3 A;  4XY9 A;  2KTB B;  5E9I A;  5J0D A;  4UYG A;  3QZS A;  5LJ0 A;  5CY9 A;  5DYX A;  5D25 A;  3O34 A;  5CS8 A;  3MB3 A;  5CRM A;  5EQ1 A;  5LJ1 A;  5ACY A;  5I1Q A;  4KV4 A;  5LVR A;  5CQ6 A;  5FE0 A;  4UIY A;  4NR6 A;  4UIV A;  4O76 A;  3O36 A;  4C66 A;  5CZG A;  4NUC A;  4O7F A;  4HXN A;  4O74 A;  5F2P A;  4QB3 A; 
#chains in the Genus database with same CATH topology
 5E3G A;  5DLZ A;  3P5O A;  4QSQ A;  5E9V A;  4MEN A;  4PS5 A;  5EWW A;  3HME A;  4QST A;  4UYH A;  4NUE A;  4QSU A;  5E3D A;  4N4G A;  3SVF A;  4O72 A;  5DYA A;  5A85 A;  4YAX A;  5CUE A;  3IU6 A;  3UW9 A;  5FG6 A;  4IR3 A;  5IBN A;  5C87 A;  5C8G A;  4CUQ A;  4BW4 A;  4J3I A;  3D1D A;  4CUU A;  4YYG A;  4O77 A;  4YAB A;  2YEM A;  2DKW A;  3UVD A;  4A9I A;  5H1U A;  3JVK A;  5DX4 A;  1PUO A;  5C4Q A;  5A5S A;  5HFQ A;  1ZKR A;  3U5P A;  3MXF A;  4NYW A;  4CFK A;  5H1T A;  5CQ8 A;  5A5Q A;  4NR9 A;  2I8N A;  5HQ5 A;  1JM4 B;  4TZ2 A;  5EWH A;  5I80 A;  5AMF A;  4YAT A;  1E6I A;  5DKD A;  2WP1 A;  4HXP A;  5I7Y A;  4IR4 A;  5FFV A;  2F6J A;  3LJW A;  4IR6 A;  3LXJ A;  5LKU A;  4HBY A;  5A7C A;  5EV9 A;  5EA1 A;  4IOQ A;  5CTL A;  5D3T A;  4QZS A;  4YH4 A;  2D9E A;  2FSA A;  5F3A A;  2G4A A;  3MB4 A;  5ENE A;  3LQJ A;  3UV5 A;  3GG3 A;  4PKL A;  5I7X A;  2N9G A;  5CUD A;  5EIS A;  4NR5 A;  5F1L A;  5F1H A;  5D3J A;  4A9N A;  5CUC A;  4XYA A;  3D7C A;  5F5Z A;  4Y03 A;  3JVL A;  5L97 A;  2RO1 A;  4QUU A;  4NRC A;  5LUU A;  4NR7 A;  2LSP B;  5ENF A;  5CQ5 A;  5FE7 A;  5CRZ A;  4LYI A;  2YQD A;  4PTB A;  5F60 A;  5D24 A;  5FDZ A;  4MR3 A;  5C89 A;  4PCI A;  4LDF A;  4YYJ A;  2I7K A;  4HXL A;  5I89 A;  4OGI A;  2R0S A;  5EK9 A;  5I83 A;  5A81 A;  4PCE A;  3ERR A;  5L98 A;  5FB1 A;  4YH3 A;  5CFW A;  4N4H A;  4QSP A;  4YYD A;  4LYW A;  5F36 A;  5A83 A;  5COI A;  5HCL A;  5HM0 A;  2R10 A;  3U5O A;  5TB6 A;  4CUP A;  5ENC A;  4AKI A;  5EP7 A;  5A5R A;  5BT4 A;  4HBV A;  5LJ2 A;  5IGN A;  5FE2 A;  3P1F A;  4YBS A;  5EIC A;  5FE6 A;  5IG6 A;  5L8T A;  2L85 A;  4GPJ A;  5D7X A;  5E9M A;  2RNW A;  5LKZ A;  4N4I A;  4HXM A;  4NS5 A;  5KTX A;  5ENJ A;  4J0S A;  2YDW A;  4YC9 A;  4TS8 A;  5EWD A;  3Q2E A;  3UVW A;  5I40 A;  1ZS5 A;  3U5K A;  5H85 A;  5CUB A;  5HRW A;  4UYF A;  5EU1 A;  4CUS A;  3UVX A;  5I29 A;  5IGL A;  5FG4 A;  3ZYU A;  5ETD A;  5EPB A;  2E7N A;  5DW1 A;  4O75 A;  3UVY A;  5IGK A;  2E7O A;  5AME A;  3VKH A;  3Q2F A;  4J1P A;  4TT2 A;  4YK0 A;  3HMH A;  5FE1 A;  5HFR A;  2D82 A;  2YW5 A;  4CFL A;  4QEU A;  5HLS A;  4QSV A;  4NUD A;  5JI8 A;  5ENI A;  5I88 A;  1X0J A;  5CU8 A;  4Q0O A;  4LRG A;  3O35 A;  4NYX A;  4QSR A;  4TT6 A;  4O7E A;  2YEL A;  5AD3 A;  4CUR A;  1F68 A;  4A9F A;  3LQH A;  5D3S A;  4AKG A;  4IOO A;  3MUK A;  4ZQL A;  5HEN A;  4C67 A;  1JSP B;  2NXB A;  5D26 A;  3SVG A;  4A9L A;  5CQT A;  5CQA A;  4QR5 A;  5DKH A;  5ENB A;  5FBX A;  5CQ4 A;  5LKT A;  4ZC9 A;  5CUA A;  5D3H A;  4N4F A;  4O7C A;  5K29 A;  5L8U A;  4MR6 A;  4HBW A;  5E9L A;  4BHW A;  5E7D A;  5DFD A;  4HXO A;  4UIU A;  5FE3 A;  5FH6 A;  5KHM A;  3U5N A;  4TYL A;  5JWM A;  2DVV A;  3DAI A;  5EWV A;  3MUL A;  4WHW A;  3HMF A;  4UIX A;  4XY8 A;  3P1D A;  4PY6 A;  5ENH A;  2YEK A;  5FE4 A;  4TQN A;  4CL9 A;  5EGU A;  5FE9 A;  5EWC A;  5F61 A;  3P1E A;  4QYL A;  4Z1S A;  2DVR A;  4YYM A;  1EQF A;  3DWY A;  5II2 A;  5G4R A;  3TLP A;  3AQA A;  4QEW A;  4TT4 A;  3G0J A;  5DYU A;  5CP5 A;  5IGM A;  5DYC A;  3I3J A;  4HXK A;  4TZ8 A;  5DKC A;  4IR5 A;  2YYN A;  4NRA A;  2DWW A;  2MJV B;  4A9J A;  4A9E A;  5HQ6 A;  4YAD A;  4QC1 A;  5CPE A;  3ONI A;  4Z6H A;  5LVQ A;  4QYD A;  5F63 A;  3P1C A;  5CQ7 A;  3FKM X;  5BT5 A;  5E73 A;  3G0L A;  5CUG A;  5EPR A;  5E74 A;  4ALH A;  5I86 A;  4KV1 A;  4NRB A;  2OO1 A;  4CLB A;  4YYI A;  5D3R A;  5HJC A;  4LR6 A;  2GRC A;  3UV4 A;  4UIZ A;  5EVA A;  4HXR A;  5D0C A;  4O78 A;  4N3W A;  4TU4 A;  4IOR A;  4Q0N A;  5DY7 A;  4NYV A;  5KTU A;  3QZT A;  4LC2 A;  5D3N A;  5EI4 A;  3VKG A;  4QBM A;  2L5E A;  4YY6 A;  4A9M A;  5F62 A;  4F3I A;  4Z1Q A;  5E9Y A;  4LZ2 A;  5D3P A;  4QY4 A;  5D3L A;  3LQI A;  5HRV A;  2DVQ A;  5KU3 A;  3U5L A;  4YYH A;  4TTE A;  5AD2 A;  4QUT A;  5II1 A;  5A5P A;  4DON A;  4NQN A;  4UYD A;  4MR5 A;  2OSS A;  5FE5 A;  4KCX A;  5C85 A;  4BW3 A;  4QNS A;  2WP2 A;  5FE8 A;  4QSS A;  4TU6 A;  2RI7 A;  2R0Y A;  4YYK A;  3RCW A;  3JVJ A;  4QSW A;  5ETB A;  3JVM A;  5EPS A;  5FFW A;  4BW1 A;  4NXJ A;  5C7N A;  4YBM A;  2RNX A;  5FFY A;  1N72 A;  5FG5 A;  3S91 A;  3AAD A;  4O71 A;  5L96 A;  2RS9 B;  2H60 A;  3K2J A;  3S92 A;  4XUB A;  4A9O A;  3QZV A;  3U5M A;  4Z6I A;  3NXB A;  4LYS A;  5KTW A;  4OGJ A;  3U5J A;  4MEQ A;  2F6N A;  4LZS A;  1WUM A;  5EM3 A;  3MQM A;  5L99 A;  5A5O A;  4YYN A;  4NR4 A;  4A9H A;  4WHU A;  4UYF B;  5F25 A;  5H1V A;  2DAT A;  4QC3 A;  4NR8 A;  2RNY A;  4Z93 A;  4YY4 A;  4O7A A;  5FH8 A;  5E0R A;  2DVS A;  4HXS A;  5HQ7 A;  3O37 A;  5CGP A;  4CUT A;  5G4S A;  5A5N A;  4QSX A;  5DLX A;  3IU5 A;  4XUA A;  5ENG A;  4LZR A;  5IID A;  3SVH A;  4AKH A;  3O33 A;  4QR4 A;  5E9K A;  3D1B A;  4YBT A;  5HRX A;  4UIW A;  2E3K A;  5KO4 A;  4RVR A;  4ALG A;  4X2I A;  5TCM A;  4A9K A;  3UV2 A;  5FB0 A;  4UIT A;  4QR3 A;  5DFB A;  5HEL A;  5HEM A;  5BT3 A;  5DFC A;  4O7B A;  2RFJ A;  4FLP A;  4WIV A;  2R0V A;  4NQM A;  4HBX A;  4AI6 A;  4AKN A;  4ZW1 A;  1WUG A;  4QEV A;  2OUO A;  5DW2 A;  4O70 A;  4J0R A;  5LKX A;  5DBM A;  5A82 A;  4OUF A;  5FH7 A;  4MEO A;  4MR4 A;  4E96 A;  4BJX A;  2L84 A;  4MEP A;  4UYE A;  4BW2 A;  5CQ3 A;  4XY9 A;  2KTB B;  5E9I A;  5J0D A;  4UYG A;  3QZS A;  2EJN A;  5CY9 A;  5DYX A;  5LJ0 A;  5D25 A;  3O34 A;  5CS8 A;  3MB3 A;  5CRM A;  5EQ1 A;  5LJ1 A;  5ACY A;  5I1Q A;  4KV4 A;  5LVR A;  5CQ6 A;  5FE0 A;  4UIY A;  4NR6 A;  4UIV A;  4O76 A;  3O36 A;  4C66 A;  5CZG A;  4NUC A;  4O7F A;  4HXN A;  4O74 A;  5F2P A;  4QB3 A; 
#chains in the Genus database with same CATH homology
 5E3G A;  5DLZ A;  3P5O A;  4QSQ A;  5E9V A;  4MEN A;  4PS5 A;  5EWW A;  3HME A;  4QST A;  4UYH A;  4NUE A;  4QSU A;  5E3D A;  4N4G A;  3SVF A;  4O72 A;  5DYA A;  5A85 A;  4YAX A;  5CUE A;  3IU6 A;  3UW9 A;  5FG6 A;  4IR3 A;  5IBN A;  5C87 A;  5C8G A;  4CUQ A;  4BW4 A;  4J3I A;  4CUU A;  4YYG A;  4O77 A;  4YAB A;  2YEM A;  2DKW A;  3UVD A;  4A9I A;  5H1U A;  3JVK A;  5DX4 A;  5C4Q A;  5A5S A;  5HFQ A;  3U5P A;  3MXF A;  4NYW A;  4CFK A;  5H1T A;  5CQ8 A;  5A5Q A;  4NR9 A;  2I8N A;  5HQ5 A;  1JM4 B;  4TZ2 A;  5EWH A;  5I80 A;  5AMF A;  4YAT A;  1E6I A;  5DKD A;  2WP1 A;  4HXP A;  5I7Y A;  4IR4 A;  5FFV A;  2F6J A;  3LJW A;  4IR6 A;  3LXJ A;  5LKU A;  4HBY A;  5A7C A;  5EV9 A;  5EA1 A;  4IOQ A;  5CTL A;  5D3T A;  4QZS A;  4YH4 A;  2D9E A;  2FSA A;  5F3A A;  2G4A A;  3MB4 A;  5ENE A;  3LQJ A;  3UV5 A;  3GG3 A;  4PKL A;  5I7X A;  2N9G A;  5CUD A;  5EIS A;  4NR5 A;  5F1L A;  5F1H A;  5D3J A;  4A9N A;  5CUC A;  4XYA A;  3D7C A;  5F5Z A;  4Y03 A;  3JVL A;  5L97 A;  2RO1 A;  4QUU A;  4NRC A;  5LUU A;  4NR7 A;  2LSP B;  5ENF A;  5CQ5 A;  5FE7 A;  5CRZ A;  4LYI A;  2YQD A;  4PTB A;  5F60 A;  5D24 A;  5FDZ A;  4MR3 A;  5C89 A;  4PCI A;  4LDF A;  4YYJ A;  2I7K A;  4HXL A;  5I89 A;  4OGI A;  2R0S A;  5EK9 A;  5I83 A;  5A81 A;  4PCE A;  5L98 A;  5FB1 A;  4YH3 A;  5CFW A;  4N4H A;  4QSP A;  4YYD A;  4LYW A;  5F36 A;  5A83 A;  5COI A;  5HCL A;  5HM0 A;  2R10 A;  3U5O A;  5TB6 A;  4CUP A;  5ENC A;  5EP7 A;  5A5R A;  5BT4 A;  4HBV A;  5LJ2 A;  5IGN A;  5FE2 A;  3P1F A;  4YBS A;  5EIC A;  5FE6 A;  5IG6 A;  5L8T A;  2L85 A;  4GPJ A;  5D7X A;  5E9M A;  2RNW A;  5LKZ A;  4N4I A;  4HXM A;  4NS5 A;  5KTX A;  5ENJ A;  4J0S A;  2YDW A;  4YC9 A;  4TS8 A;  5EWD A;  3Q2E A;  3UVW A;  5I40 A;  1ZS5 A;  3U5K A;  5H85 A;  5CUB A;  5HRW A;  4UYF A;  5EU1 A;  4CUS A;  3UVX A;  5I29 A;  5IGL A;  5FG4 A;  3ZYU A;  5ETD A;  5EPB A;  2E7N A;  5DW1 A;  4O75 A;  3UVY A;  5IGK A;  2E7O A;  5AME A;  3Q2F A;  4J1P A;  4TT2 A;  4YK0 A;  3HMH A;  5FE1 A;  5HFR A;  2D82 A;  2YW5 A;  4CFL A;  4QEU A;  5HLS A;  4QSV A;  4NUD A;  5JI8 A;  5ENI A;  5I88 A;  1X0J A;  5CU8 A;  4Q0O A;  4LRG A;  3O35 A;  4NYX A;  4QSR A;  4TT6 A;  4O7E A;  2YEL A;  5AD3 A;  4CUR A;  1F68 A;  4A9F A;  3LQH A;  5D3S A;  4IOO A;  3MUK A;  4ZQL A;  5HEN A;  4C67 A;  1JSP B;  2NXB A;  5D26 A;  3SVG A;  4A9L A;  5CQT A;  5CQA A;  4QR5 A;  5DKH A;  5ENB A;  5FBX A;  5CQ4 A;  5LKT A;  4ZC9 A;  5CUA A;  5D3H A;  4N4F A;  4O7C A;  5K29 A;  5L8U A;  4MR6 A;  4HBW A;  5E9L A;  4BHW A;  5E7D A;  5DFD A;  4HXO A;  4UIU A;  5FE3 A;  5FH6 A;  5KHM A;  3U5N A;  4TYL A;  5JWM A;  2DVV A;  3DAI A;  5EWV A;  3MUL A;  4WHW A;  3HMF A;  4UIX A;  4XY8 A;  3P1D A;  4PY6 A;  5ENH A;  2YEK A;  5FE4 A;  4TQN A;  4CL9 A;  5EGU A;  5FE9 A;  5EWC A;  5F61 A;  3P1E A;  4QYL A;  4Z1S A;  2DVR A;  4YYM A;  1EQF A;  3DWY A;  5II2 A;  5G4R A;  3TLP A;  3AQA A;  4QEW A;  4TT4 A;  3G0J A;  5DYU A;  5CP5 A;  5IGM A;  5DYC A;  3I3J A;  4HXK A;  4TZ8 A;  5DKC A;  4IR5 A;  2YYN A;  4NRA A;  2DWW A;  2MJV B;  4A9J A;  4A9E A;  5HQ6 A;  4YAD A;  4QC1 A;  5CPE A;  3ONI A;  4Z6H A;  5LVQ A;  4QYD A;  5F63 A;  3P1C A;  5CQ7 A;  3FKM X;  5BT5 A;  5E73 A;  3G0L A;  5CUG A;  5EPR A;  5E74 A;  4ALH A;  5I86 A;  4KV1 A;  4NRB A;  2OO1 A;  4CLB A;  4YYI A;  5D3R A;  5HJC A;  4LR6 A;  2GRC A;  3UV4 A;  4UIZ A;  5EVA A;  4HXR A;  5D0C A;  4O78 A;  4N3W A;  4TU4 A;  4IOR A;  4Q0N A;  5DY7 A;  4NYV A;  5KTU A;  3QZT A;  4LC2 A;  5D3N A;  5EI4 A;  4QBM A;  2L5E A;  4YY6 A;  4A9M A;  5F62 A;  4F3I A;  4Z1Q A;  5E9Y A;  4LZ2 A;  5D3P A;  4QY4 A;  5D3L A;  3LQI A;  5HRV A;  2DVQ A;  5KU3 A;  3U5L A;  4YYH A;  4TTE A;  5AD2 A;  4QUT A;  5II1 A;  5A5P A;  4DON A;  4NQN A;  4UYD A;  4MR5 A;  2OSS A;  5FE5 A;  4KCX A;  5C85 A;  4BW3 A;  4QNS A;  2WP2 A;  5FE8 A;  4QSS A;  4TU6 A;  2RI7 A;  2R0Y A;  4YYK A;  3RCW A;  3JVJ A;  4QSW A;  5ETB A;  3JVM A;  5EPS A;  5FFW A;  4BW1 A;  4NXJ A;  5C7N A;  4YBM A;  2RNX A;  5FFY A;  1N72 A;  5FG5 A;  3S91 A;  3AAD A;  4O71 A;  5L96 A;  2RS9 B;  2H60 A;  3K2J A;  3S92 A;  4XUB A;  4A9O A;  3QZV A;  3U5M A;  4Z6I A;  3NXB A;  4LYS A;  5KTW A;  4OGJ A;  3U5J A;  4MEQ A;  2F6N A;  4LZS A;  1WUM A;  5EM3 A;  3MQM A;  5L99 A;  5A5O A;  4YYN A;  4NR4 A;  4A9H A;  4WHU A;  4UYF B;  5F25 A;  5H1V A;  2DAT A;  4QC3 A;  4NR8 A;  2RNY A;  4Z93 A;  4YY4 A;  4O7A A;  5FH8 A;  5E0R A;  2DVS A;  4HXS A;  5HQ7 A;  3O37 A;  5CGP A;  4CUT A;  5G4S A;  5A5N A;  4QSX A;  5DLX A;  3IU5 A;  4XUA A;  5ENG A;  4LZR A;  5IID A;  3SVH A;  3O33 A;  4QR4 A;  5E9K A;  4YBT A;  5HRX A;  4UIW A;  2E3K A;  5KO4 A;  4RVR A;  4ALG A;  4X2I A;  5TCM A;  4A9K A;  3UV2 A;  5FB0 A;  4UIT A;  4QR3 A;  5DFB A;  5HEL A;  5HEM A;  5BT3 A;  5DFC A;  4O7B A;  2RFJ A;  4FLP A;  4WIV A;  2R0V A;  4NQM A;  4HBX A;  4AKN A;  4ZW1 A;  1WUG A;  4QEV A;  2OUO A;  5DW2 A;  4O70 A;  4J0R A;  5LKX A;  5DBM A;  5A82 A;  4OUF A;  5FH7 A;  4MEO A;  4MR4 A;  4E96 A;  4BJX A;  2L84 A;  4MEP A;  4UYE A;  4BW2 A;  5CQ3 A;  4XY9 A;  2KTB B;  5E9I A;  5J0D A;  4UYG A;  3QZS A;  5LJ0 A;  5CY9 A;  5DYX A;  5D25 A;  3O34 A;  5CS8 A;  3MB3 A;  5CRM A;  5EQ1 A;  5LJ1 A;  5ACY A;  5I1Q A;  4KV4 A;  5LVR A;  5CQ6 A;  5FE0 A;  4UIY A;  4NR6 A;  4UIV A;  4O76 A;  3O36 A;  4C66 A;  5CZG A;  4NUC A;  4O7F A;  4HXN A;  4O74 A;  5F2P A;  4QB3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...