4FLPA

Crystal structure of the first bromodomain of human brdt in complex with the inhibitor jq1
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
106
structure length
106
Chain Sequence
TNQLQYLQKVVLKDLWKHSFSWPFQRPVDAVKLQLPDYYTIIKNPMDLNTIKKRLENKYYAKASECIEDFNTMFSNCYLYNKPGDDIVLMAQALEKLFMQKLSQMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator/inhibitor
molecule keywords Bromodomain testis-specific protein
publication title Small-Molecule Inhibition of BRDT for Male Contraception.
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4flpA01
4NQMA 5E9YA 5D3HA 4YBTA 5HQ7A 4E96A 4HXRA 4WHWA 2YQDA 4NXJA 4YH3A 5HM0A 3ONIA 4PCIA 2D82A 4UIZA 5FH8A 5IG6A 4YYDA 5EWDA 3LXJA 4Z1QA 4MENA 5KU3A 5F1LA 5CRMA 4OUFA 2I7KA 4O71A 2RO1A 5FE2A 5D3RA 5HJCA 4FLPA 5CS8A 5F63A 4UYEA 5HENA 4Z1SA 4F3IA 5AMEA 3G0LA 5CTLA 4NRCA 4UIXA 5FH6A 4QSXA 5ENBA 5A82A 2KTBB 3I3JA 4ZC9A 2OUOA 4O75A 2FSAA 5FE7A 1EQFA 4QUUA 3JVLA 4IR4A 3MB4A 3U5JA 4BW3A 2G4AA 4O7CA 3P1CA 4UYHA 2DVRA 5CQ3A 5ENHA 5ETDA 3O33A 2E3KA 4QBMA 4YATA 5HRXA 5D3PA 4CL9A 5CP5A 5LKZA 5HFRA 4O7EA 5G4SA 5D3LA 5F2PA 2YYNA 5D0CA 5FE8A 4Z6HA 4BJXA 5E3GA 4A9NA 4C66A 4XUAA 4YBMA 5I89A 3O35A 1F68A 5E74A 4LZ2A 5IIDA 5KO4A 4O70A 5DFBA 5F36A 5G4RA 5CUDA 4NYXA 5A85A 4QSWA 1JM4B 4UYFA 3GG3A 5E9LA 5IBNA 5EI4A 5EWHA 3LQHA 2I8NA 4YYNA 3RCWA 4IR5A 4PS5A 5FFYA 5KTUA 2RNWA 5A5OA 3UVWA 4GPJA 4LC2A 5L96A 4J0SA 4UIVA 4YYGA 5HRVA 5CU8A 4A9MA 4XY8A 4YYKA 5C87A 4LRGA 5LJ0A 4NYWA 3IU6A 5J0DA 4QSSA 4UYGA 3MULA 4O72A 4QY4A 5E9VA 4YYMA 4O74A 4ZQLA 4CURA 5C4QA 4YADA 4NQNA 5CUGA 2D9EA 5DY7A 2YELA 3MB3A 2MJVB 4QC1A 3UV2A 5DYCA 5I1QA 4NR9A 2DATA 4QZSA 3UVYA 5EISA 3IU5A 5HFQA 4A9OA 4PY6A 5E7DA 4PCEA 5H1VA 5L99A 4LR6A 3UV4A 1X0JA 5L98A 4YYJA 5FDZA 5EPRA 5EQ1A 3D7CA 5C7NA 5F62A 2R0VA 2YEKA 4HXOA 5I88A 4UYDA 4QEWA 3NXBA 5EA1A 2RI7A 5DX4A 3U5LA 3ZYUA 5I80A 5CRZA 5A5NA 2L5EA 4NUDA 5IGKA 5HRWA 4YH4A 3QZSA 5F25A 4LYWA 3U5NA 5E0RA 3LQJA 4YYHA 4CUQA 5HCLA 4TYLA 4HBYA 3S91A 3O37A 4TT2A 5KHMA 4DONA 4TTEA 4MR4A 2E7NA 4O7BA 5EU1A 3JVJA 4O78A 4YC9A 4QSRA 5CQAA 4CUTA 3K2JA 5HEMA 4YAXA 4UIUA 4MEOA 4NYVA 4CLBA 4TS8A 5EK9A 5EM3A 4CUPA 4HBWA 5CQ8A 4KV4A 4NS5A 4TZ2A 5FG5A 5I7YA 4NUEA 4AKNA 5D7XA 5ENFA 4HXKA 5L97A 4ALGA 5DFDA 5LVRA 4OGIA 4QC3A 5ENEA 5CQ7A 5COIA 4TU4A 5E3DA 5DKHA 5FG4A 3HMFA 5E73A 4CFLA 4NUCA 5EWCA 4LZSA 4QSTA 5A5QA 4QYDA 5II2A 3O34A 3DAIA 5EWWA 5I83A 4CUUA 5ACYA 1E6IA 5FE1A 2L85A 5FB1A 3UVDA 3P1DA 5HLSA 4J3IA 4O7AA 5D3JA 4O76A 2RNYA 5E9KA 2RS9B 5I86A 3Q2FA 4X2IA 2NXBA 2R10A 4LZRA 3Q2EA 5CUAA 4N4GA 4QEUA 4KV1A 5II1A 3DWYA 4MR3A 4C67A 3MXFA 5D3SA 3U5KA 4PTBA 3QZTA 5LJ1A 4ZW1A 5DYAA 4QNSA 4ALHA 5CY9A 5FG6A 5IGLA 5H85A 4IORA 5EP7A 5A5SA 4XY9A 4IOQA 5LKUA 5CQ5A 1WUMA 5H1UA 2F6NA 4YABA 3G0JA 4TT6A 4BW1A 4PKLA 3JVMA 5FFVA 4QEVA 4UIYA 5I40A 3P5OA 4Z93A 5BT3A 5KTWA 5CZGA 4HXSA 5FE5A 2R0SA 1JSPB 4KCXA 4MEQA 5DYXA 4HXMA 3U5PA 4NR4A 4Y03A 2LSPB 4Q0OA 5K29A 5HELA 3UW9A 5E9MA 5D25A 5CUBA 5A5RA 5FB0A 2OO1A 5L8TA 4QR4A 4XYAA 4NR7A 4QSUA 5EPSA 4Z6IA 4QSPA 2WP1A 3AQAA 5E9IA 2R0YA 4NR8A 4QB3A 5LKXA 4MR5A 3O36A 4TQNA 2YEMA 5H1TA 2DKWA 5A81A 4BW2A 1ZS5A 5FE4A 5C89A 4LYSA 4CFKA 5DW1A 4HXNA 5EWVA 5CPEA 4RVRA 2N9GA 4UIWA 4A9FA 5F61A 3UVXA 2DVSA 5LJ2A 4A9EA 5FE9A 4NRBA 2YW5A 4QSVA 3U5MA 5IGMA 3FKMX 3LJWA 3QZVA 4HXLA 5EGUA 5CUEA 4LYIA 2H60A 5AD2A 5KTXA 4N4HA 2WP2A 5DKDA 2YDWA 5EICA 5HQ5A 4HBVA 3U5OA 4N3WA 2E7OA 4TT4A 5D3NA 5LUUA 5L8UA 4J0RA 4HXPA 5D24A 5CQTA 5AMFA 4A9IA 3AADA 5DLXA 5FE0A 3HMEA 5FBXA 5DW2A 2RFJA 4NRAA 4MEPA 4CUSA 4LDFA 3UV5A 4XUBA 5HQ6A 4QSQA 4YYIA 5I29A 5FH7A 5F3AA 5CGPA 5FE3A 4O7FA 4YK0A 5TB6A 5EVAA 4Q0NA 4N4FA 4A9LA 5JWMA 2L84A 5ENIA 5F1HA 5ENJA 1WUGA 5AD3A 2F6JA 4QR3A 5D26A 5FFWA 4HBXA 5DFCA 5ETBA 2DVQA 5CUCA 3MQMA 4QYLA 5F5ZA 4NR5A 4BHWA 3MUKA 4TU6A 5LKTA 5TCMA 4WIVA 3LQIA 4WHUA 3SVHA 4TZ8A 4MR6A 3HMHA 4UITA 1N72A 4O77A 5C8GA 5IGNA 5A7CA 5EPBA 2DVVA 5DLZA 4A9JA 4YY6A 5CQ6A 4A9HA 4IOOA 2DWWA 3P1EA 5BT5A 5C85A 3SVGA 2GRCA 4N4IA 4YY4A 5FE6A 4YBSA 4A9KA 4NR6A 2RNXA 4IR6A 5CQ4A 5DYUA 5LVQA 4IR3A 5F60A 4QUTA 4BW4A 5CFWA 4OGJA 5ENGA 5A5PA 5DKCA 2OSSA 3P1FA 4UYFB 4QR5A 3JVKA 5A83A 5JI8A 5ENCA 4J1PA 5EV9A 3S92A 3TLPA 3SVFA 5D3TA 5BT4A 5DBMA 5I7XA
chains in the Genus database with same CATH superfamily
4NQMA 5E9YA 5D3HA 4YBTA 5HQ7A 4E96A 4HXRA 4WHWA 2YQDA 4NXJA 4YH3A 5HM0A 3ONIA 4PCIA 2D82A 4UIZA 5FH8A 5IG6A 4YYDA 5EWDA 3LXJA 4Z1QA 4MENA 5KU3A 5F1LA 5CRMA 4OUFA 2I7KA 4O71A 2RO1A 5FE2A 3VKGA 5D3RA 5HJCA 4FLPA 5CS8A 5F63A 4UYEA 5HENA 4Z1SA 4F3IA 5AMEA 3G0LA 5CTLA 4NRCA 4UIXA 5FH6A 4QSXA 5ENBA 5A82A 2KTBB 3I3JA 4ZC9A 2OUOA 4O75A 2FSAA 5FE7A 1EQFA 4QUUA 3JVLA 4IR4A 3MB4A 3U5JA 4BW3A 2G4AA 4O7CA 3P1CA 4UYHA 2DVRA 5CQ3A 5ENHA 5ETDA 3O33A 2E3KA 4QBMA 4YATA 5HRXA 5D3PA 4CL9A 5CP5A 5LKZA 3VKHA 5HFRA 4O7EA 5G4SA 5D3LA 5F2PA 2YYNA 5D0CA 5FE8A 4Z6HA 4BJXA 5E3GA 4A9NA 4C66A 4XUAA 4YBMA 5I89A 3O35A 1F68A 5E74A 4LZ2A 5IIDA 5KO4A 4O70A 5DFBA 5F36A 5G4RA 5CUDA 4NYXA 5A85A 4QSWA 1JM4B 4UYFA 3GG3A 5E9LA 5IBNA 5EI4A 5EWHA 3LQHA 2I8NA 4YYNA 3RCWA 4IR5A 4PS5A 5FFYA 5KTUA 2RNWA 5A5OA 3UVWA 4GPJA 4LC2A 5L96A 4J0SA 4UIVA 4YYGA 5HRVA 5CU8A 4A9MA 4XY8A 4YYKA 5C87A 4LRGA 5LJ0A 4NYWA 3IU6A 5J0DA 4QSSA 4UYGA 3MULA 4O72A 4QY4A 5E9VA 4YYMA 4AKHA 4O74A 4ZQLA 4CURA 5C4QA 4YADA 4NQNA 5CUGA 2D9EA 5DY7A 2YELA 3MB3A 2MJVB 4QC1A 3UV2A 5DYCA 5I1QA 4NR9A 2DATA 4QZSA 3UVYA 5EISA 3IU5A 5HFQA 4A9OA 4PY6A 5E7DA 4PCEA 5H1VA 5L99A 4LR6A 3UV4A 1X0JA 5L98A 4YYJA 5FDZA 5EPRA 5EQ1A 3D7CA 5C7NA 5F62A 2R0VA 2YEKA 4HXOA 5I88A 4UYDA 4QEWA 3NXBA 5EA1A 2RI7A 5DX4A 3U5LA 3ZYUA 5I80A 5CRZA 5A5NA 2L5EA 4NUDA 5IGKA 5HRWA 4YH4A 3QZSA 5F25A 4LYWA 3U5NA 5E0RA 3LQJA 4YYHA 4CUQA 5HCLA 4TYLA 4HBYA 3S91A 3O37A 4TT2A 5KHMA 4DONA 4TTEA 4MR4A 2E7NA 4O7BA 5EU1A 3JVJA 4O78A 4YC9A 4QSRA 5CQAA 4CUTA 3K2JA 5HEMA 4YAXA 4UIUA 4MEOA 4NYVA 4CLBA 4TS8A 5EK9A 5EM3A 4CUPA 4HBWA 5CQ8A 4KV4A 4NS5A 4TZ2A 5FG5A 5I7YA 4NUEA 4AKNA 5D7XA 5ENFA 4HXKA 5L97A 4ALGA 5DFDA 5LVRA 4OGIA 4QC3A 5ENEA 5CQ7A 5COIA 4TU4A 5E3DA 5DKHA 5FG4A 3HMFA 5E73A 4CFLA 4NUCA 5EWCA 4LZSA 4QSTA 5A5QA 4QYDA 5II2A 3O34A 3DAIA 5EWWA 5I83A 4CUUA 5ACYA 1E6IA 5FE1A 2L85A 5FB1A 3UVDA 3P1DA 5HLSA 4J3IA 4O7AA 5D3JA 4O76A 2RNYA 5E9KA 2RS9B 5I86A 3Q2FA 4X2IA 2NXBA 2R10A 4LZRA 3Q2EA 5CUAA 4N4GA 4QEUA 4KV1A 5II1A 3DWYA 4MR3A 4C67A 3MXFA 5D3SA 3U5KA 4PTBA 3QZTA 5LJ1A 4ZW1A 5DYAA 4QNSA 4ALHA 5CY9A 5FG6A 5IGLA 5H85A 4IORA 5EP7A 5A5SA 4XY9A 4IOQA 5LKUA 5CQ5A 1WUMA 5H1UA 2F6NA 4YABA 3G0JA 4TT6A 4BW1A 4PKLA 3JVMA 5FFVA 4QEVA 4UIYA 5I40A 3P5OA 4Z93A 5BT3A 5KTWA 5CZGA 4HXSA 5FE5A 2R0SA 1JSPB 4KCXA 4MEQA 5DYXA 4HXMA 3U5PA 4NR4A 4Y03A 2LSPB 4Q0OA 5K29A 1ZKRA 5HELA 3UW9A 5E9MA 5D25A 5CUBA 5A5RA 5FB0A 2OO1A 5L8TA 4QR4A 4XYAA 4NR7A 4QSUA 5EPSA 4Z6IA 4QSPA 2WP1A 3AQAA 5E9IA 2R0YA 4NR8A 4QB3A 5LKXA 4MR5A 3O36A 4TQNA 2YEMA 5H1TA 2DKWA 5A81A 4BW2A 1ZS5A 5FE4A 5C89A 4LYSA 4CFKA 5DW1A 4HXNA 5EWVA 5CPEA 4RVRA 2N9GA 4UIWA 4A9FA 5F61A 3UVXA 2DVSA 5LJ2A 4A9EA 5FE9A 4NRBA 2YW5A 4QSVA 3U5MA 5IGMA 3FKMX 3LJWA 3QZVA 4HXLA 5EGUA 5CUEA 4LYIA 2H60A 5AD2A 5KTXA 4N4HA 2WP2A 5DKDA 2YDWA 5EICA 5HQ5A 4HBVA 3U5OA 4N3WA 2E7OA 3D1DA 4TT4A 5D3NA 5LUUA 5L8UA 4J0RA 4HXPA 5D24A 5CQTA 5AMFA 4A9IA 3AADA 5DLXA 5FE0A 3HMEA 5FBXA 5DW2A 2RFJA 4NRAA 4MEPA 4CUSA 4LDFA 1PUOA 3UV5A 4XUBA 5HQ6A 4QSQA 4YYIA 5I29A 5FH7A 5F3AA 5CGPA 5FE3A 4O7FA 4YK0A 5TB6A 5EVAA 4Q0NA 4N4FA 4A9LA 5JWMA 2L84A 5ENIA 5F1HA 5ENJA 1WUGA 5AD3A 2F6JA 4QR3A 5D26A 5FFWA 4AKIA 4HBXA 5DFCA 5ETBA 2DVQA 5CUCA 3MQMA 4QYLA 5F5ZA 4NR5A 4BHWA 3MUKA 4TU6A 5LKTA 5TCMA 4WIVA 3LQIA 4WHUA 3SVHA 4TZ8A 4MR6A 3HMHA 4UITA 1N72A 4O77A 5C8GA 5IGNA 3D1BA 5A7CA 5EPBA 2DVVA 5DLZA 4A9JA 4YY6A 5CQ6A 4A9HA 4IOOA 2DWWA 3P1EA 5BT5A 5C85A 3ERRA 3SVGA 2GRCA 4N4IA 4YY4A 5FE6A 4YBSA 4A9KA 4NR6A 2RNXA 4IR6A 5CQ4A 4AI6A 5DYUA 5LVQA 4IR3A 5F60A 4QUTA 4BW4A 5CFWA 4OGJA 4AKGA 5ENGA 5A5PA 5DKCA 2OSSA 3P1FA 4UYFB 4QR5A 3JVKA 5A83A 5JI8A 5ENCA 4J1PA 5EV9A 3S92A 3TLPA 3SVFA 5D3TA 2EJNA 5BT4A 5DBMA 5I7XA
chains in the Genus database with same CATH topology
4NQMA 5E9YA 5D3HA 4YBTA 5HQ7A 4E96A 4HXRA 4WHWA 2YQDA 4NXJA 4YH3A 5HM0A 3ONIA 4PCIA 2D82A 4UIZA 5FH8A 5IG6A 4YYDA 5EWDA 3LXJA 4Z1QA 4MENA 5KU3A 5F1LA 5CRMA 4OUFA 2I7KA 4O71A 2RO1A 5FE2A 5D3RA 5HJCA 4FLPA 5CS8A 5F63A 4UYEA 5HENA 4Z1SA 4F3IA 5AMEA 3G0LA 5CTLA 4NRCA 4UIXA 5FH6A 4QSXA 5ENBA 5A82A 2KTBB 3I3JA 4ZC9A 2OUOA 4O75A 2FSAA 5FE7A 1EQFA 4QUUA 3JVLA 4IR4A 3MB4A 3U5JA 4BW3A 2G4AA 4O7CA 3P1CA 4UYHA 2DVRA 5CQ3A 5ENHA 5ETDA 3O33A 2E3KA 4QBMA 4YATA 5HRXA 5D3PA 4CL9A 5CP5A 5LKZA 5HFRA 4O7EA 5G4SA 5D3LA 5F2PA 2YYNA 5D0CA 5FE8A 4Z6HA 4BJXA 5E3GA 4A9NA 4C66A 4XUAA 4YBMA 5I89A 3O35A 1F68A 5E74A 4LZ2A 5IIDA 5KO4A 4O70A 5DFBA 5F36A 5G4RA 5CUDA 4NYXA 5A85A 4QSWA 1JM4B 4UYFA 3GG3A 5E9LA 5IBNA 5EI4A 5EWHA 3LQHA 2I8NA 4YYNA 3RCWA 4IR5A 4PS5A 5FFYA 5KTUA 2RNWA 5A5OA 3UVWA 4GPJA 4LC2A 5L96A 4J0SA 4UIVA 4YYGA 5HRVA 5CU8A 4A9MA 4XY8A 4YYKA 5C87A 4LRGA 5LJ0A 4NYWA 3IU6A 5J0DA 4QSSA 4UYGA 3MULA 4O72A 4QY4A 5E9VA 4YYMA 4O74A 4ZQLA 4CURA 5C4QA 4YADA 4NQNA 5CUGA 2D9EA 5DY7A 2YELA 3MB3A 2MJVB 4QC1A 3UV2A 5DYCA 5I1QA 4NR9A 2DATA 4QZSA 3UVYA 5EISA 3IU5A 5HFQA 4A9OA 4PY6A 5E7DA 4PCEA 5H1VA 5L99A 4LR6A 3UV4A 1X0JA 5L98A 4YYJA 5FDZA 5EPRA 5EQ1A 3D7CA 5C7NA 5F62A 2R0VA 2YEKA 4HXOA 5I88A 4UYDA 4QEWA 3NXBA 5EA1A 2RI7A 5DX4A 3U5LA 3ZYUA 5I80A 5CRZA 5A5NA 2L5EA 4NUDA 5IGKA 5HRWA 4YH4A 3QZSA 5F25A 4LYWA 3U5NA 5E0RA 3LQJA 4YYHA 4CUQA 5HCLA 4TYLA 4HBYA 3S91A 3O37A 4TT2A 5KHMA 4DONA 4TTEA 4MR4A 2E7NA 4O7BA 5EU1A 3JVJA 4O78A 4YC9A 4QSRA 5CQAA 4CUTA 3K2JA 5HEMA 4YAXA 4UIUA 4MEOA 4NYVA 4CLBA 4TS8A 5EK9A 5EM3A 4CUPA 4HBWA 5CQ8A 4KV4A 4NS5A 4TZ2A 5FG5A 5I7YA 4NUEA 4AKNA 5D7XA 5ENFA 4HXKA 5L97A 4ALGA 5DFDA 5LVRA 4OGIA 4QC3A 5ENEA 5CQ7A 5COIA 4TU4A 5E3DA 5DKHA 5FG4A 3HMFA 5E73A 4CFLA 4NUCA 5EWCA 4LZSA 4QSTA 5A5QA 4QYDA 5II2A 3O34A 3DAIA 5EWWA 5I83A 4CUUA 5ACYA 1E6IA 5FE1A 2L85A 5FB1A 3UVDA 3P1DA 5HLSA 4J3IA 4O7AA 5D3JA 4O76A 2RNYA 5E9KA 2RS9B 5I86A 3Q2FA 4X2IA 2NXBA 2R10A 4LZRA 3Q2EA 5CUAA 4N4GA 4QEUA 4KV1A 5II1A 3DWYA 4MR3A 4C67A 3MXFA 5D3SA 3U5KA 4PTBA 3QZTA 5LJ1A 4ZW1A 5DYAA 4QNSA 4ALHA 5CY9A 5FG6A 5IGLA 5H85A 4IORA 5EP7A 5A5SA 4XY9A 4IOQA 5LKUA 5CQ5A 1WUMA 5H1UA 2F6NA 4YABA 3G0JA 4TT6A 4BW1A 4PKLA 3JVMA 5FFVA 4QEVA 4UIYA 5I40A 3P5OA 4Z93A 5BT3A 5KTWA 5CZGA 4HXSA 5FE5A 2R0SA 1JSPB 4KCXA 4MEQA 5DYXA 4HXMA 3U5PA 4NR4A 4Y03A 2LSPB 4Q0OA 5K29A 5HELA 3UW9A 5E9MA 5D25A 5CUBA 5A5RA 5FB0A 2OO1A 5L8TA 4QR4A 4XYAA 4NR7A 4QSUA 5EPSA 4Z6IA 4QSPA 2WP1A 3AQAA 5E9IA 2R0YA 4NR8A 4QB3A 5LKXA 4MR5A 3O36A 4TQNA 2YEMA 5H1TA 2DKWA 5A81A 4BW2A 1ZS5A 5FE4A 5C89A 4LYSA 4CFKA 5DW1A 4HXNA 5EWVA 5CPEA 4RVRA 2N9GA 4UIWA 4A9FA 5F61A 3UVXA 2DVSA 5LJ2A 4A9EA 5FE9A 4NRBA 2YW5A 4QSVA 3U5MA 5IGMA 3FKMX 3LJWA 3QZVA 4HXLA 5EGUA 5CUEA 4LYIA 2H60A 5AD2A 5KTXA 4N4HA 2WP2A 5DKDA 2YDWA 5EICA 5HQ5A 4HBVA 3U5OA 4N3WA 2E7OA 4TT4A 5D3NA 5LUUA 5L8UA 4J0RA 4HXPA 5D24A 5CQTA 5AMFA 4A9IA 3AADA 5DLXA 5FE0A 3HMEA 5FBXA 5DW2A 2RFJA 4NRAA 4MEPA 4CUSA 4LDFA 3UV5A 4XUBA 5HQ6A 4QSQA 4YYIA 5I29A 5FH7A 5F3AA 5CGPA 5FE3A 4O7FA 4YK0A 5TB6A 5EVAA 4Q0NA 4N4FA 4A9LA 5JWMA 2L84A 5ENIA 5F1HA 5ENJA 1WUGA 5AD3A 2F6JA 4QR3A 5D26A 5FFWA 4HBXA 5DFCA 5ETBA 2DVQA 5CUCA 3MQMA 4QYLA 5F5ZA 4NR5A 4BHWA 3MUKA 4TU6A 5LKTA 5TCMA 4WIVA 3LQIA 4WHUA 3SVHA 4TZ8A 4MR6A 3HMHA 4UITA 1N72A 4O77A 5C8GA 5IGNA 5A7CA 5EPBA 2DVVA 5DLZA 4A9JA 4YY6A 5CQ6A 4A9HA 4IOOA 2DWWA 3P1EA 5BT5A 5C85A 3SVGA 2GRCA 4N4IA 4YY4A 5FE6A 4YBSA 4A9KA 4NR6A 2RNXA 4IR6A 5CQ4A 5DYUA 5LVQA 4IR3A 5F60A 4QUTA 4BW4A 5CFWA 4OGJA 5ENGA 5A5PA 5DKCA 2OSSA 3P1FA 4UYFB 4QR5A 3JVKA 5A83A 5JI8A 5ENCA 4J1PA 5EV9A 3S92A 3TLPA 3SVFA 5D3TA 5BT4A 5DBMA 5I7XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NQM A;  5E9Y A;  5D3H A;  4YBT A;  5HQ7 A;  4E96 A;  4HXR A;  4WHW A;  2YQD A;  4NXJ A;  4YH3 A;  5HM0 A;  3ONI A;  4PCI A;  2D82 A;  4UIZ A;  5FH8 A;  5IG6 A;  4YYD A;  5EWD A;  3LXJ A;  4Z1Q A;  4MEN A;  5KU3 A;  5F1L A;  5CRM A;  4OUF A;  2I7K A;  4O71 A;  2RO1 A;  5FE2 A;  5D3R A;  5HJC A;  4FLP A;  5CS8 A;  5F63 A;  4UYE A;  5HEN A;  4Z1S A;  4F3I A;  5AME A;  3G0L A;  5CTL A;  4NRC A;  4UIX A;  5FH6 A;  4QSX A;  5ENB A;  5A82 A;  2KTB B;  3I3J A;  4ZC9 A;  2OUO A;  4O75 A;  2FSA A;  5FE7 A;  1EQF A;  4QUU A;  3JVL A;  4IR4 A;  3MB4 A;  3U5J A;  4BW3 A;  2G4A A;  4O7C A;  3P1C A;  4UYH A;  2DVR A;  5CQ3 A;  5ENH A;  5ETD A;  3O33 A;  2E3K A;  4QBM A;  4YAT A;  5HRX A;  5D3P A;  4CL9 A;  5CP5 A;  5LKZ A;  5HFR A;  4O7E A;  5G4S A;  5D3L A;  5F2P A;  2YYN A;  5D0C A;  5FE8 A;  4Z6H A;  4BJX A;  5E3G A;  4A9N A;  4C66 A;  4XUA A;  4YBM A;  5I89 A;  3O35 A;  1F68 A;  5E74 A;  4LZ2 A;  5IID A;  5KO4 A;  4O70 A;  5DFB A;  5F36 A;  5G4R A;  5CUD A;  4NYX A;  5A85 A;  4QSW A;  1JM4 B;  4UYF A;  3GG3 A;  5E9L A;  5IBN A;  5EI4 A;  5EWH A;  3LQH A;  2I8N A;  4YYN A;  3RCW A;  4IR5 A;  4PS5 A;  5FFY A;  5KTU A;  2RNW A;  5A5O A;  3UVW A;  4GPJ A;  4LC2 A;  5L96 A;  4J0S A;  4UIV A;  4YYG A;  5HRV A;  5CU8 A;  4A9M A;  4XY8 A;  4YYK A;  5C87 A;  4LRG A;  5LJ0 A;  4NYW A;  3IU6 A;  5J0D A;  4QSS A;  4UYG A;  3MUL A;  4O72 A;  4QY4 A;  5E9V A;  4YYM A;  4O74 A;  4ZQL A;  4CUR A;  5C4Q A;  4YAD A;  4NQN A;  5CUG A;  2D9E A;  5DY7 A;  2YEL A;  3MB3 A;  2MJV B;  4QC1 A;  3UV2 A;  5DYC A;  5I1Q A;  4NR9 A;  2DAT A;  4QZS A;  3UVY A;  5EIS A;  3IU5 A;  5HFQ A;  4A9O A;  4PY6 A;  5E7D A;  4PCE A;  5H1V A;  5L99 A;  4LR6 A;  3UV4 A;  1X0J A;  5L98 A;  4YYJ A;  5FDZ A;  5EPR A;  5EQ1 A;  3D7C A;  5C7N A;  5F62 A;  2R0V A;  2YEK A;  4HXO A;  5I88 A;  4UYD A;  4QEW A;  3NXB A;  5EA1 A;  2RI7 A;  5DX4 A;  3U5L A;  3ZYU A;  5I80 A;  5CRZ A;  5A5N A;  2L5E A;  4NUD A;  5IGK A;  5HRW A;  4YH4 A;  3QZS A;  5F25 A;  4LYW A;  3U5N A;  5E0R A;  3LQJ A;  4YYH A;  4CUQ A;  5HCL A;  4TYL A;  4HBY A;  3S91 A;  3O37 A;  4TT2 A;  5KHM A;  4DON A;  4TTE A;  4MR4 A;  2E7N A;  4O7B A;  5EU1 A;  3JVJ A;  4O78 A;  4YC9 A;  4QSR A;  5CQA A;  4CUT A;  3K2J A;  5HEM A;  4YAX A;  4UIU A;  4MEO A;  4NYV A;  4CLB A;  4TS8 A;  5EK9 A;  5EM3 A;  4CUP A;  4HBW A;  5CQ8 A;  4KV4 A;  4NS5 A;  4TZ2 A;  5FG5 A;  5I7Y A;  4NUE A;  4AKN A;  5D7X A;  5ENF A;  4HXK A;  5L97 A;  4ALG A;  5DFD A;  5LVR A;  4OGI A;  4QC3 A;  5ENE A;  5CQ7 A;  5COI A;  4TU4 A;  5E3D A;  5DKH A;  5FG4 A;  3HMF A;  5E73 A;  4CFL A;  4NUC A;  5EWC A;  4LZS A;  4QST A;  5A5Q A;  4QYD A;  5II2 A;  3O34 A;  3DAI A;  5EWW A;  5I83 A;  4CUU A;  5ACY A;  1E6I A;  5FE1 A;  2L85 A;  5FB1 A;  3UVD A;  3P1D A;  5HLS A;  4J3I A;  4O7A A;  5D3J A;  4O76 A;  2RNY A;  5E9K A;  2RS9 B;  5I86 A;  3Q2F A;  4X2I A;  2NXB A;  2R10 A;  4LZR A;  3Q2E A;  5CUA A;  4N4G A;  4QEU A;  4KV1 A;  5II1 A;  3DWY A;  4MR3 A;  4C67 A;  3MXF A;  5D3S A;  3U5K A;  4PTB A;  3QZT A;  5LJ1 A;  4ZW1 A;  5DYA A;  4QNS A;  4ALH A;  5CY9 A;  5FG6 A;  5IGL A;  5H85 A;  4IOR A;  5EP7 A;  5A5S A;  4XY9 A;  4IOQ A;  5LKU A;  5CQ5 A;  1WUM A;  5H1U A;  2F6N A;  4YAB A;  3G0J A;  4TT6 A;  4BW1 A;  4PKL A;  3JVM A;  5FFV A;  4QEV A;  4UIY A;  5I40 A;  3P5O A;  4Z93 A;  5BT3 A;  5KTW A;  5CZG A;  4HXS A;  5FE5 A;  2R0S A;  1JSP B;  4KCX A;  4MEQ A;  5DYX A;  4HXM A;  3U5P A;  4NR4 A;  4Y03 A;  2LSP B;  4Q0O A;  5K29 A;  5HEL A;  3UW9 A;  5E9M A;  5D25 A;  5CUB A;  5A5R A;  5FB0 A;  2OO1 A;  5L8T A;  4QR4 A;  4XYA A;  4NR7 A;  4QSU A;  5EPS A;  4Z6I A;  4QSP A;  2WP1 A;  3AQA A;  5E9I A;  2R0Y A;  4NR8 A;  4QB3 A;  5LKX A;  4MR5 A;  3O36 A;  4TQN A;  2YEM A;  5H1T A;  2DKW A;  5A81 A;  4BW2 A;  1ZS5 A;  5FE4 A;  5C89 A;  4LYS A;  4CFK A;  5DW1 A;  4HXN A;  5EWV A;  5CPE A;  4RVR A;  2N9G A;  4UIW A;  4A9F A;  5F61 A;  3UVX A;  2DVS A;  5LJ2 A;  4A9E A;  5FE9 A;  4NRB A;  2YW5 A;  4QSV A;  3U5M A;  5IGM A;  3FKM X;  3LJW A;  3QZV A;  4HXL A;  5EGU A;  5CUE A;  4LYI A;  2H60 A;  5AD2 A;  5KTX A;  4N4H A;  2WP2 A;  5DKD A;  2YDW A;  5EIC A;  5HQ5 A;  4HBV A;  3U5O A;  4N3W A;  2E7O A;  4TT4 A;  5D3N A;  5LUU A;  5L8U A;  4J0R A;  4HXP A;  5D24 A;  5CQT A;  5AMF A;  4A9I A;  3AAD A;  5DLX A;  5FE0 A;  3HME A;  5FBX A;  5DW2 A;  2RFJ A;  4NRA A;  4MEP A;  4CUS A;  4LDF A;  3UV5 A;  4XUB A;  5HQ6 A;  4QSQ A;  4YYI A;  5I29 A;  5FH7 A;  5F3A A;  5CGP A;  5FE3 A;  4O7F A;  4YK0 A;  5TB6 A;  5EVA A;  4Q0N A;  4N4F A;  4A9L A;  5JWM A;  2L84 A;  5ENI A;  5F1H A;  5ENJ A;  1WUG A;  5AD3 A;  2F6J A;  4QR3 A;  5D26 A;  5FFW A;  4HBX A;  5DFC A;  5ETB A;  2DVQ A;  5CUC A;  3MQM A;  4QYL A;  5F5Z A;  4NR5 A;  4BHW A;  3MUK A;  4TU6 A;  5LKT A;  5TCM A;  4WIV A;  3LQI A;  4WHU A;  3SVH A;  4TZ8 A;  4MR6 A;  3HMH A;  4UIT A;  1N72 A;  4O77 A;  5C8G A;  5IGN A;  5A7C A;  5EPB A;  2DVV A;  5DLZ A;  4A9J A;  4YY6 A;  5CQ6 A;  4A9H A;  4IOO A;  2DWW A;  3P1E A;  5BT5 A;  5C85 A;  3SVG A;  2GRC A;  4N4I A;  4YY4 A;  5FE6 A;  4YBS A;  4A9K A;  4NR6 A;  2RNX A;  4IR6 A;  5CQ4 A;  5DYU A;  5LVQ A;  4IR3 A;  5F60 A;  4QUT A;  4BW4 A;  5CFW A;  4OGJ A;  5ENG A;  5A5P A;  5DKC A;  2OSS A;  3P1F A;  4UYF B;  4QR5 A;  3JVK A;  5A83 A;  5JI8 A;  5ENC A;  4J1P A;  5EV9 A;  3S92 A;  3TLP A;  3SVF A;  5D3T A;  5BT4 A;  5DBM A;  5I7X A; 
#chains in the Genus database with same CATH topology
 4NQM A;  5E9Y A;  5D3H A;  4YBT A;  5HQ7 A;  4E96 A;  4HXR A;  4WHW A;  2YQD A;  4NXJ A;  4YH3 A;  5HM0 A;  3ONI A;  4PCI A;  2D82 A;  4UIZ A;  5FH8 A;  5IG6 A;  4YYD A;  5EWD A;  3LXJ A;  4Z1Q A;  4MEN A;  5KU3 A;  5F1L A;  5CRM A;  4OUF A;  2I7K A;  4O71 A;  2RO1 A;  5FE2 A;  3VKG A;  5D3R A;  5HJC A;  4FLP A;  5CS8 A;  5F63 A;  4UYE A;  5HEN A;  4Z1S A;  4F3I A;  5AME A;  3G0L A;  5CTL A;  4NRC A;  4UIX A;  5FH6 A;  4QSX A;  5ENB A;  5A82 A;  2KTB B;  3I3J A;  4ZC9 A;  2OUO A;  4O75 A;  2FSA A;  5FE7 A;  1EQF A;  4QUU A;  3JVL A;  4IR4 A;  3MB4 A;  3U5J A;  4BW3 A;  2G4A A;  4O7C A;  3P1C A;  4UYH A;  2DVR A;  5CQ3 A;  5ENH A;  5ETD A;  3O33 A;  2E3K A;  4QBM A;  4YAT A;  5HRX A;  5D3P A;  4CL9 A;  5CP5 A;  5LKZ A;  3VKH A;  5HFR A;  4O7E A;  5G4S A;  5D3L A;  5F2P A;  2YYN A;  5D0C A;  5FE8 A;  4Z6H A;  4BJX A;  5E3G A;  4A9N A;  4C66 A;  4XUA A;  4YBM A;  5I89 A;  3O35 A;  1F68 A;  5E74 A;  4LZ2 A;  5IID A;  5KO4 A;  4O70 A;  5DFB A;  5F36 A;  5G4R A;  5CUD A;  4NYX A;  5A85 A;  4QSW A;  1JM4 B;  4UYF A;  3GG3 A;  5E9L A;  5IBN A;  5EI4 A;  5EWH A;  3LQH A;  2I8N A;  4YYN A;  3RCW A;  4IR5 A;  4PS5 A;  5FFY A;  5KTU A;  2RNW A;  5A5O A;  3UVW A;  4GPJ A;  4LC2 A;  5L96 A;  4J0S A;  4UIV A;  4YYG A;  5HRV A;  5CU8 A;  4A9M A;  4XY8 A;  4YYK A;  5C87 A;  4LRG A;  5LJ0 A;  4NYW A;  3IU6 A;  5J0D A;  4QSS A;  4UYG A;  3MUL A;  4O72 A;  4QY4 A;  5E9V A;  4YYM A;  4AKH A;  4O74 A;  4ZQL A;  4CUR A;  5C4Q A;  4YAD A;  4NQN A;  5CUG A;  2D9E A;  5DY7 A;  2YEL A;  3MB3 A;  2MJV B;  4QC1 A;  3UV2 A;  5DYC A;  5I1Q A;  4NR9 A;  2DAT A;  4QZS A;  3UVY A;  5EIS A;  3IU5 A;  5HFQ A;  4A9O A;  4PY6 A;  5E7D A;  4PCE A;  5H1V A;  5L99 A;  4LR6 A;  3UV4 A;  1X0J A;  5L98 A;  4YYJ A;  5FDZ A;  5EPR A;  5EQ1 A;  3D7C A;  5C7N A;  5F62 A;  2R0V A;  2YEK A;  4HXO A;  5I88 A;  4UYD A;  4QEW A;  3NXB A;  5EA1 A;  2RI7 A;  5DX4 A;  3U5L A;  3ZYU A;  5I80 A;  5CRZ A;  5A5N A;  2L5E A;  4NUD A;  5IGK A;  5HRW A;  4YH4 A;  3QZS A;  5F25 A;  4LYW A;  3U5N A;  5E0R A;  3LQJ A;  4YYH A;  4CUQ A;  5HCL A;  4TYL A;  4HBY A;  3S91 A;  3O37 A;  4TT2 A;  5KHM A;  4DON A;  4TTE A;  4MR4 A;  2E7N A;  4O7B A;  5EU1 A;  3JVJ A;  4O78 A;  4YC9 A;  4QSR A;  5CQA A;  4CUT A;  3K2J A;  5HEM A;  4YAX A;  4UIU A;  4MEO A;  4NYV A;  4CLB A;  4TS8 A;  5EK9 A;  5EM3 A;  4CUP A;  4HBW A;  5CQ8 A;  4KV4 A;  4NS5 A;  4TZ2 A;  5FG5 A;  5I7Y A;  4NUE A;  4AKN A;  5D7X A;  5ENF A;  4HXK A;  5L97 A;  4ALG A;  5DFD A;  5LVR A;  4OGI A;  4QC3 A;  5ENE A;  5CQ7 A;  5COI A;  4TU4 A;  5E3D A;  5DKH A;  5FG4 A;  3HMF A;  5E73 A;  4CFL A;  4NUC A;  5EWC A;  4LZS A;  4QST A;  5A5Q A;  4QYD A;  5II2 A;  3O34 A;  3DAI A;  5EWW A;  5I83 A;  4CUU A;  5ACY A;  1E6I A;  5FE1 A;  2L85 A;  5FB1 A;  3UVD A;  3P1D A;  5HLS A;  4J3I A;  4O7A A;  5D3J A;  4O76 A;  2RNY A;  5E9K A;  2RS9 B;  5I86 A;  3Q2F A;  4X2I A;  2NXB A;  2R10 A;  4LZR A;  3Q2E A;  5CUA A;  4N4G A;  4QEU A;  4KV1 A;  5II1 A;  3DWY A;  4MR3 A;  4C67 A;  3MXF A;  5D3S A;  3U5K A;  4PTB A;  3QZT A;  5LJ1 A;  4ZW1 A;  5DYA A;  4QNS A;  4ALH A;  5CY9 A;  5FG6 A;  5IGL A;  5H85 A;  4IOR A;  5EP7 A;  5A5S A;  4XY9 A;  4IOQ A;  5LKU A;  5CQ5 A;  1WUM A;  5H1U A;  2F6N A;  4YAB A;  3G0J A;  4TT6 A;  4BW1 A;  4PKL A;  3JVM A;  5FFV A;  4QEV A;  4UIY A;  5I40 A;  3P5O A;  4Z93 A;  5BT3 A;  5KTW A;  5CZG A;  4HXS A;  5FE5 A;  2R0S A;  1JSP B;  4KCX A;  4MEQ A;  5DYX A;  4HXM A;  3U5P A;  4NR4 A;  4Y03 A;  2LSP B;  4Q0O A;  5K29 A;  1ZKR A;  5HEL A;  3UW9 A;  5E9M A;  5D25 A;  5CUB A;  5A5R A;  5FB0 A;  2OO1 A;  5L8T A;  4QR4 A;  4XYA A;  4NR7 A;  4QSU A;  5EPS A;  4Z6I A;  4QSP A;  2WP1 A;  3AQA A;  5E9I A;  2R0Y A;  4NR8 A;  4QB3 A;  5LKX A;  4MR5 A;  3O36 A;  4TQN A;  2YEM A;  5H1T A;  2DKW A;  5A81 A;  4BW2 A;  1ZS5 A;  5FE4 A;  5C89 A;  4LYS A;  4CFK A;  5DW1 A;  4HXN A;  5EWV A;  5CPE A;  4RVR A;  2N9G A;  4UIW A;  4A9F A;  5F61 A;  3UVX A;  2DVS A;  5LJ2 A;  4A9E A;  5FE9 A;  4NRB A;  2YW5 A;  4QSV A;  3U5M A;  5IGM A;  3FKM X;  3LJW A;  3QZV A;  4HXL A;  5EGU A;  5CUE A;  4LYI A;  2H60 A;  5AD2 A;  5KTX A;  4N4H A;  2WP2 A;  5DKD A;  2YDW A;  5EIC A;  5HQ5 A;  4HBV A;  3U5O A;  4N3W A;  2E7O A;  3D1D A;  4TT4 A;  5D3N A;  5LUU A;  5L8U A;  4J0R A;  4HXP A;  5D24 A;  5CQT A;  5AMF A;  4A9I A;  3AAD A;  5DLX A;  5FE0 A;  3HME A;  5FBX A;  5DW2 A;  2RFJ A;  4NRA A;  4MEP A;  4CUS A;  4LDF A;  1PUO A;  3UV5 A;  4XUB A;  5HQ6 A;  4QSQ A;  4YYI A;  5I29 A;  5FH7 A;  5F3A A;  5CGP A;  5FE3 A;  4O7F A;  4YK0 A;  5TB6 A;  5EVA A;  4Q0N A;  4N4F A;  4A9L A;  5JWM A;  2L84 A;  5ENI A;  5F1H A;  5ENJ A;  1WUG A;  5AD3 A;  2F6J A;  4QR3 A;  5D26 A;  5FFW A;  4AKI A;  4HBX A;  5DFC A;  5ETB A;  2DVQ A;  5CUC A;  3MQM A;  4QYL A;  5F5Z A;  4NR5 A;  4BHW A;  3MUK A;  4TU6 A;  5LKT A;  5TCM A;  4WIV A;  3LQI A;  4WHU A;  3SVH A;  4TZ8 A;  4MR6 A;  3HMH A;  4UIT A;  1N72 A;  4O77 A;  5C8G A;  5IGN A;  3D1B A;  5A7C A;  5EPB A;  2DVV A;  5DLZ A;  4A9J A;  4YY6 A;  5CQ6 A;  4A9H A;  4IOO A;  2DWW A;  3P1E A;  5BT5 A;  5C85 A;  3ERR A;  3SVG A;  2GRC A;  4N4I A;  4YY4 A;  5FE6 A;  4YBS A;  4A9K A;  4NR6 A;  2RNX A;  4IR6 A;  5CQ4 A;  4AI6 A;  5DYU A;  5LVQ A;  4IR3 A;  5F60 A;  4QUT A;  4BW4 A;  5CFW A;  4OGJ A;  4AKG A;  5ENG A;  5A5P A;  5DKC A;  2OSS A;  3P1F A;  4UYF B;  4QR5 A;  3JVK A;  5A83 A;  5JI8 A;  5ENC A;  4J1P A;  5EV9 A;  3S92 A;  3TLP A;  3SVF A;  5D3T A;  2EJN A;  5BT4 A;  5DBM A;  5I7X A; 
#chains in the Genus database with same CATH homology
 4NQM A;  5E9Y A;  5D3H A;  4YBT A;  5HQ7 A;  4E96 A;  4HXR A;  4WHW A;  2YQD A;  4NXJ A;  4YH3 A;  5HM0 A;  3ONI A;  4PCI A;  2D82 A;  4UIZ A;  5FH8 A;  5IG6 A;  4YYD A;  5EWD A;  3LXJ A;  4Z1Q A;  4MEN A;  5KU3 A;  5F1L A;  5CRM A;  4OUF A;  2I7K A;  4O71 A;  2RO1 A;  5FE2 A;  5D3R A;  5HJC A;  4FLP A;  5CS8 A;  5F63 A;  4UYE A;  5HEN A;  4Z1S A;  4F3I A;  5AME A;  3G0L A;  5CTL A;  4NRC A;  4UIX A;  5FH6 A;  4QSX A;  5ENB A;  5A82 A;  2KTB B;  3I3J A;  4ZC9 A;  2OUO A;  4O75 A;  2FSA A;  5FE7 A;  1EQF A;  4QUU A;  3JVL A;  4IR4 A;  3MB4 A;  3U5J A;  4BW3 A;  2G4A A;  4O7C A;  3P1C A;  4UYH A;  2DVR A;  5CQ3 A;  5ENH A;  5ETD A;  3O33 A;  2E3K A;  4QBM A;  4YAT A;  5HRX A;  5D3P A;  4CL9 A;  5CP5 A;  5LKZ A;  5HFR A;  4O7E A;  5G4S A;  5D3L A;  5F2P A;  2YYN A;  5D0C A;  5FE8 A;  4Z6H A;  4BJX A;  5E3G A;  4A9N A;  4C66 A;  4XUA A;  4YBM A;  5I89 A;  3O35 A;  1F68 A;  5E74 A;  4LZ2 A;  5IID A;  5KO4 A;  4O70 A;  5DFB A;  5F36 A;  5G4R A;  5CUD A;  4NYX A;  5A85 A;  4QSW A;  1JM4 B;  4UYF A;  3GG3 A;  5E9L A;  5IBN A;  5EI4 A;  5EWH A;  3LQH A;  2I8N A;  4YYN A;  3RCW A;  4IR5 A;  4PS5 A;  5FFY A;  5KTU A;  2RNW A;  5A5O A;  3UVW A;  4GPJ A;  4LC2 A;  5L96 A;  4J0S A;  4UIV A;  4YYG A;  5HRV A;  5CU8 A;  4A9M A;  4XY8 A;  4YYK A;  5C87 A;  4LRG A;  5LJ0 A;  4NYW A;  3IU6 A;  5J0D A;  4QSS A;  4UYG A;  3MUL A;  4O72 A;  4QY4 A;  5E9V A;  4YYM A;  4O74 A;  4ZQL A;  4CUR A;  5C4Q A;  4YAD A;  4NQN A;  5CUG A;  2D9E A;  5DY7 A;  2YEL A;  3MB3 A;  2MJV B;  4QC1 A;  3UV2 A;  5DYC A;  5I1Q A;  4NR9 A;  2DAT A;  4QZS A;  3UVY A;  5EIS A;  3IU5 A;  5HFQ A;  4A9O A;  4PY6 A;  5E7D A;  4PCE A;  5H1V A;  5L99 A;  4LR6 A;  3UV4 A;  1X0J A;  5L98 A;  4YYJ A;  5FDZ A;  5EPR A;  5EQ1 A;  3D7C A;  5C7N A;  5F62 A;  2R0V A;  2YEK A;  4HXO A;  5I88 A;  4UYD A;  4QEW A;  3NXB A;  5EA1 A;  2RI7 A;  5DX4 A;  3U5L A;  3ZYU A;  5I80 A;  5CRZ A;  5A5N A;  2L5E A;  4NUD A;  5IGK A;  5HRW A;  4YH4 A;  3QZS A;  5F25 A;  4LYW A;  3U5N A;  5E0R A;  3LQJ A;  4YYH A;  4CUQ A;  5HCL A;  4TYL A;  4HBY A;  3S91 A;  3O37 A;  4TT2 A;  5KHM A;  4DON A;  4TTE A;  4MR4 A;  2E7N A;  4O7B A;  5EU1 A;  3JVJ A;  4O78 A;  4YC9 A;  4QSR A;  5CQA A;  4CUT A;  3K2J A;  5HEM A;  4YAX A;  4UIU A;  4MEO A;  4NYV A;  4CLB A;  4TS8 A;  5EK9 A;  5EM3 A;  4CUP A;  4HBW A;  5CQ8 A;  4KV4 A;  4NS5 A;  4TZ2 A;  5FG5 A;  5I7Y A;  4NUE A;  4AKN A;  5D7X A;  5ENF A;  4HXK A;  5L97 A;  4ALG A;  5DFD A;  5LVR A;  4OGI A;  4QC3 A;  5ENE A;  5CQ7 A;  5COI A;  4TU4 A;  5E3D A;  5DKH A;  5FG4 A;  3HMF A;  5E73 A;  4CFL A;  4NUC A;  5EWC A;  4LZS A;  4QST A;  5A5Q A;  4QYD A;  5II2 A;  3O34 A;  3DAI A;  5EWW A;  5I83 A;  4CUU A;  5ACY A;  1E6I A;  5FE1 A;  2L85 A;  5FB1 A;  3UVD A;  3P1D A;  5HLS A;  4J3I A;  4O7A A;  5D3J A;  4O76 A;  2RNY A;  5E9K A;  2RS9 B;  5I86 A;  3Q2F A;  4X2I A;  2NXB A;  2R10 A;  4LZR A;  3Q2E A;  5CUA A;  4N4G A;  4QEU A;  4KV1 A;  5II1 A;  3DWY A;  4MR3 A;  4C67 A;  3MXF A;  5D3S A;  3U5K A;  4PTB A;  3QZT A;  5LJ1 A;  4ZW1 A;  5DYA A;  4QNS A;  4ALH A;  5CY9 A;  5FG6 A;  5IGL A;  5H85 A;  4IOR A;  5EP7 A;  5A5S A;  4XY9 A;  4IOQ A;  5LKU A;  5CQ5 A;  1WUM A;  5H1U A;  2F6N A;  4YAB A;  3G0J A;  4TT6 A;  4BW1 A;  4PKL A;  3JVM A;  5FFV A;  4QEV A;  4UIY A;  5I40 A;  3P5O A;  4Z93 A;  5BT3 A;  5KTW A;  5CZG A;  4HXS A;  5FE5 A;  2R0S A;  1JSP B;  4KCX A;  4MEQ A;  5DYX A;  4HXM A;  3U5P A;  4NR4 A;  4Y03 A;  2LSP B;  4Q0O A;  5K29 A;  5HEL A;  3UW9 A;  5E9M A;  5D25 A;  5CUB A;  5A5R A;  5FB0 A;  2OO1 A;  5L8T A;  4QR4 A;  4XYA A;  4NR7 A;  4QSU A;  5EPS A;  4Z6I A;  4QSP A;  2WP1 A;  3AQA A;  5E9I A;  2R0Y A;  4NR8 A;  4QB3 A;  5LKX A;  4MR5 A;  3O36 A;  4TQN A;  2YEM A;  5H1T A;  2DKW A;  5A81 A;  4BW2 A;  1ZS5 A;  5FE4 A;  5C89 A;  4LYS A;  4CFK A;  5DW1 A;  4HXN A;  5EWV A;  5CPE A;  4RVR A;  2N9G A;  4UIW A;  4A9F A;  5F61 A;  3UVX A;  2DVS A;  5LJ2 A;  4A9E A;  5FE9 A;  4NRB A;  2YW5 A;  4QSV A;  3U5M A;  5IGM A;  3FKM X;  3LJW A;  3QZV A;  4HXL A;  5EGU A;  5CUE A;  4LYI A;  2H60 A;  5AD2 A;  5KTX A;  4N4H A;  2WP2 A;  5DKD A;  2YDW A;  5EIC A;  5HQ5 A;  4HBV A;  3U5O A;  4N3W A;  2E7O A;  4TT4 A;  5D3N A;  5LUU A;  5L8U A;  4J0R A;  4HXP A;  5D24 A;  5CQT A;  5AMF A;  4A9I A;  3AAD A;  5DLX A;  5FE0 A;  3HME A;  5FBX A;  5DW2 A;  2RFJ A;  4NRA A;  4MEP A;  4CUS A;  4LDF A;  3UV5 A;  4XUB A;  5HQ6 A;  4QSQ A;  4YYI A;  5I29 A;  5FH7 A;  5F3A A;  5CGP A;  5FE3 A;  4O7F A;  4YK0 A;  5TB6 A;  5EVA A;  4Q0N A;  4N4F A;  4A9L A;  5JWM A;  2L84 A;  5ENI A;  5F1H A;  5ENJ A;  1WUG A;  5AD3 A;  2F6J A;  4QR3 A;  5D26 A;  5FFW A;  4HBX A;  5DFC A;  5ETB A;  2DVQ A;  5CUC A;  3MQM A;  4QYL A;  5F5Z A;  4NR5 A;  4BHW A;  3MUK A;  4TU6 A;  5LKT A;  5TCM A;  4WIV A;  3LQI A;  4WHU A;  3SVH A;  4TZ8 A;  4MR6 A;  3HMH A;  4UIT A;  1N72 A;  4O77 A;  5C8G A;  5IGN A;  5A7C A;  5EPB A;  2DVV A;  5DLZ A;  4A9J A;  4YY6 A;  5CQ6 A;  4A9H A;  4IOO A;  2DWW A;  3P1E A;  5BT5 A;  5C85 A;  3SVG A;  2GRC A;  4N4I A;  4YY4 A;  5FE6 A;  4YBS A;  4A9K A;  4NR6 A;  2RNX A;  4IR6 A;  5CQ4 A;  5DYU A;  5LVQ A;  4IR3 A;  5F60 A;  4QUT A;  4BW4 A;  5CFW A;  4OGJ A;  5ENG A;  5A5P A;  5DKC A;  2OSS A;  3P1F A;  4UYF B;  4QR5 A;  3JVK A;  5A83 A;  5JI8 A;  5ENC A;  4J1P A;  5EV9 A;  3S92 A;  3TLP A;  3SVF A;  5D3T A;  5BT4 A;  5DBM A;  5I7X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...