2MJVB

Solution structures of second bromodomain of brd4 with di-acetylated twist peptide
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
128
structure length
128
Chain Sequence
KDVPDSQQHPAPEKSSKVSEQLKCCSGILKEMFAKKHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Twist-related protein 1
publication title Disrupting the Interaction of BRD4 with Diacetylated Twist Suppresses Tumorigenesis in Basal-like Breast Cancer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 34
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2014-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2mjvB00
2YYNA 4KV1A 4QSXA 4ALGA 4UIZA 5KO4A 5C85A 4A9LA 5I7YA 4NRAA 2KTBB 4HBWA 4UIWA 3FKMX 3P5OA 4ZW1A 2YDWA 5F2PA 4NYVA 4CLBA 4TT6A 5LJ1A 5FE1A 4PKLA 5LVQA 5F36A 5EWCA 4LZ2A 2R0VA 5E73A 2H60A 4QC1A 4HXLA 5FE5A 4UYHA 3DWYA 4HXMA 4N4GA 5G4RA 5DKHA 5E9KA 5HM0A 5FG6A 3MQMA 5FB0A 3U5OA 2DVVA 3MULA 4O71A 5CRZA 5CQ8A 5IGKA 4O72A 5II1A 2RNXA 4Z6IA 4TT4A 5CUCA 3UVDA 4TZ2A 1JM4B 4YBSA 5I80A 2RFJA 5FFYA 5LJ2A 4AKNA 4A9HA 5D3SA 3DAIA 5CQTA 3UW9A 4CFKA 4CURA 5EU1A 5EQ1A 3JVLA 5CUDA 4UYGA 3P1FA 4O7BA 4QSVA 5C87A 5AD2A 5A5QA 5FE3A 4O78A 5CU8A 4TU4A 3SVHA 4CUUA 3P1DA 4QUUA 4TYLA 4J1PA 4N3WA 5KTWA 4C67A 5F61A 4HXNA 2D9EA 4KV4A 4YH3A 3HMHA 4NR9A 5D3RA 5L96A 5FFWA 5CUAA 4FLPA 4WHWA 5F63A 4HXPA 5D3LA 4CFLA 5DFDA 5A85A 4YYDA 5EPRA 4QBMA 4N4IA 4XYAA 2YEMA 4NQNA 5CPEA 5F1LA 2D82A 5KTUA 4J0SA 5CQ7A 3U5LA 3ZYUA 5JI8A 5HRXA 4GPJA 4YYHA 1F68A 4LRGA 4J0RA 2LSPB 4IR5A 3S92A 2DWWA 5COIA 4DONA 4LZSA 4QUTA 5FG4A 4UIUA 5DYUA 5C7NA 4BW3A 3O35A 5E7DA 4Z6HA 4NUDA 4WHUA 4ALHA 3GG3A 4OGIA 3LQIA 4IOQA 5II2A 2I7KA 4NR5A 4NUEA 2YW5A 4NR6A 3QZVA 4QSQA 4HXKA 4PY6A 5CQ5A 5ENEA 5BT3A 3O36A 3G0LA 4BW2A 3JVJA 5I40A 2OO1A 4O75A 2E7OA 4YYIA 5E3GA 5K29A 3O33A 2L84A 5IGLA 5EWWA 5CFWA 4QR5A 4MR6A 2L85A 3IU5A 3LQHA 5DKCA 3K2JA 4QR3A 2R10A 2YQDA 4A9OA 5I7XA 5CTLA 2DVSA 5L97A 4QEVA 5CQ6A 5HEMA 3I3JA 4LDFA 5D7XA 2E7NA 5L8TA 5DLXA 5KTXA 5IIDA 2WP2A 3ONIA 5ENFA 5A5RA 4A9IA 3S91A 2YELA 5CS8A 5HFQA 5A81A 1EQFA 5D3HA 3U5NA 4QEUA 3UV5A 5IGMA 4IR3A 4NRBA 5D26A 5DBMA 5DFBA 5LJ0A 5FG5A 4QSPA 5EA1A 5ETDA 4O74A 2I8NA 4MR5A 5A5PA 5TCMA 4IR6A 4UIVA 5DYXA 4NYWA 4TS8A 4CL9A 4N4HA 5I1QA 4UIXA 5E9MA 4NYXA 5LVRA 3U5JA 3IU6A 3O37A 5D3TA 5EM3A 3QZTA 5HCLA 5F1HA 5BT4A 5ENIA 4QSTA 4A9EA 4QEWA 2GRCA 4XY8A 3TLPA 4QC3A 5HQ7A 5LKZA 4A9KA 5E74A 5LKTA 5I86A 4A9NA 4YAXA 2L5EA 5D24A 3SVFA 3U5MA 3JVMA 3NXBA 5CQ3A 3G0JA 4YATA 4NRCA 4BW4A 4QB3A 5A7CA 4J3IA 5FH8A 5ENBA 4TTEA 4PCEA 5EVAA 5H85A 4MEPA 4HXOA 3MB4A 5EPBA 4UYEA 4IR4A 4QSSA 5F3AA 4IORA 4YABA 4F3IA 5DFCA 4YYGA 4LYSA 5EICA 5HQ5A 3P1CA 4XUAA 1WUGA 5HJCA 4YBMA 2N9GA 2RO1A 5G4SA 5E9YA 5F25A 3SVGA 5CP5A 5AMEA 3LXJA 4MR3A 2F6JA 4O7FA 5L98A 4O7EA 4YYMA 4HBXA 4O7CA 2DVRA 4OUFA 4ZQLA 5HELA 4O7AA 1WUMA 5ENJA 5FE2A 5L99A 4NS5A 3U5PA 3MB3A 5FE8A 5IG6A 3O34A 4BW1A 5I89A 5FE6A 3MUKA 1X0JA 4YY6A 4MENA 5CQAA 5E9VA 5L8UA 4XY9A 3HMFA 5C8GA 5D3PA 4LYIA 4TQNA 1ZS5A 2G4AA 5C4QA 4YADA 4CUTA 4HXRA 2YEKA 4QR4A 5CGPA 5FE7A 5HLSA 4A9JA 5IGNA 4O77A 4QZSA 4UITA 4PS5A 5EWDA 5EWVA 5FH6A 4A9FA 5D25A 2RI7A 5CY9A 5ETBA 4YYKA 4YBTA 3UV4A 5A82A 5ENGA 5EISA 4Y03A 5CZGA 4IOOA 5FE9A 4MR4A 3Q2FA 5C89A 5FE0A 4NUCA 5HRVA 3P1EA 5LKXA 5CRMA 4E96A 5I83A 5DY7A 5HRWA 4QNSA 4NR7A 3QZSA 5DYAA 5D3NA 5HENA 4PTBA 5FBXA 4TZ8A 4Z1SA 2DKWA 2RNYA 5CUBA 4OGJA 4TT2A 3LJWA 4QYLA 3RCWA 5F5ZA 4KCXA 5KHMA 5EK9A 5FDZA 3Q2EA 4YC9A 5LUUA 2MJVB 4HXSA 4A9MA 4BJXA 4Z93A 5DLZA 5ENCA 3UVXA 4TU6A 4CUSA 3LQJA 1JSPB 4MEQA 5JWMA 2DATA 4QSWA 4YYJA 5F62A 3JVKA 5DW2A 2RS9B 4C66A 4UYDA 5E9LA 4UIYA 5F60A 5DYCA 5CQ4A 4LR6A 4Z1QA 5CUEA 4Q0OA 3HMEA 4YYNA 5LKUA 5BT5A 2R0SA 5DKDA 1E6IA 4Q0NA 4BHWA 5E0RA 3D7CA 3UVWA 5A5NA 5H1VA 5I29A 5TB6A 5J0DA 4NXJA 4O70A 5IBNA 2R0YA 5E3DA 4NQMA 4CUPA 4LYWA 5A83A 4X2IA 5A5SA 4O76A 5E9IA 5FFVA 5I88A 5ENHA 4QSUA 5DW1A 3AQAA 5EGUA 4QY4A 1N72A 5EWHA 2OSSA 4LZRA 5EPSA 4UYFB 4HBYA 4PCIA 4XUBA 4NR4A 5A5OA 4RVRA 4ZC9A 4CUQA 5ACYA 5EP7A 4HBVA 5AMFA 4NR8A 5FB1A 4N4FA 5CUGA 5FH7A 5EV9A 2DVQA 4QYDA 3UVYA 4WIVA 3U5KA 3UV2A 4YH4A 4YK0A 5H1UA 2E3KA 3AADA 2RNWA 3MXFA 5DX4A 5H1TA 4QSRA 4LC2A 4MEOA 5FE4A 5HQ6A 4UYFA 4YY4A 2WP1A 5D3JA 5D0CA 2OUOA 5EI4A 2NXBA 2F6NA 5HFRA 2FSAA 5KU3A 5AD3A
chains in the Genus database with same CATH superfamily
2YYNA 4KV1A 4QSXA 4ALGA 4UIZA 5KO4A 5C85A 4A9LA 5I7YA 4NRAA 2KTBB 4HBWA 4UIWA 3FKMX 3P5OA 4ZW1A 2YDWA 5F2PA 4NYVA 4CLBA 4TT6A 5LJ1A 5FE1A 4PKLA 5LVQA 5F36A 5EWCA 4LZ2A 2R0VA 5E73A 2H60A 4QC1A 4HXLA 5FE5A 4UYHA 3DWYA 4HXMA 4N4GA 5G4RA 5DKHA 5E9KA 5HM0A 5FG6A 3MQMA 5FB0A 3U5OA 2DVVA 3MULA 4O71A 5CRZA 5CQ8A 5IGKA 4O72A 5II1A 2RNXA 4Z6IA 4TT4A 5CUCA 3UVDA 4TZ2A 1JM4B 1PUOA 4YBSA 5I80A 2RFJA 5FFYA 5LJ2A 4AKNA 4A9HA 5D3SA 3DAIA 5CQTA 3UW9A 4CFKA 4CURA 5EU1A 5EQ1A 3JVLA 5CUDA 4UYGA 3P1FA 4O7BA 4QSVA 5C87A 5AD2A 5A5QA 5FE3A 4O78A 5CU8A 4TU4A 3SVHA 4CUUA 3P1DA 4QUUA 4TYLA 4J1PA 4N3WA 5KTWA 4C67A 5F61A 4HXNA 2D9EA 4KV4A 4YH3A 4AKGA 3HMHA 4NR9A 5D3RA 5L96A 5FFWA 5CUAA 4FLPA 4WHWA 5F63A 4HXPA 5D3LA 4CFLA 5DFDA 5A85A 4YYDA 5EPRA 4QBMA 4N4IA 4XYAA 2YEMA 4NQNA 5CPEA 5F1LA 2D82A 5KTUA 4J0SA 5CQ7A 3U5LA 3ZYUA 1ZKRA 5HRXA 5JI8A 4GPJA 4YYHA 1F68A 4LRGA 4J0RA 4AKHA 2LSPB 4IR5A 3S92A 2DWWA 5COIA 4DONA 3D1DA 4LZSA 4QUTA 5FG4A 4UIUA 5DYUA 5C7NA 4BW3A 3O35A 5E7DA 4Z6HA 4NUDA 4WHUA 4ALHA 3GG3A 4OGIA 3LQIA 4IOQA 5II2A 2I7KA 4NR5A 4NUEA 2YW5A 4NR6A 3QZVA 4QSQA 4HXKA 4PY6A 5CQ5A 5ENEA 5BT3A 3O36A 3G0LA 4BW2A 3JVJA 5I40A 2OO1A 4O75A 2E7OA 4YYIA 5E3GA 5K29A 3O33A 2L84A 5IGLA 5EWWA 5CFWA 4QR5A 2EJNA 4MR6A 2L85A 3IU5A 3LQHA 5DKCA 3K2JA 4QR3A 2R10A 2YQDA 4A9OA 5I7XA 5CTLA 2DVSA 5L97A 4QEVA 5CQ6A 5HEMA 3I3JA 4LDFA 5D7XA 2E7NA 5L8TA 5DLXA 5KTXA 5IIDA 2WP2A 3ONIA 5ENFA 5A5RA 4A9IA 3S91A 2YELA 5CS8A 5HFQA 5A81A 3VKGA 1EQFA 5D3HA 3U5NA 4QEUA 3UV5A 5IGMA 4IR3A 4NRBA 5D26A 5DBMA 5DFBA 5LJ0A 5FG5A 4QSPA 5EA1A 5ETDA 4O74A 2I8NA 4MR5A 5A5PA 5TCMA 4IR6A 4UIVA 5DYXA 4NYWA 4TS8A 4CL9A 4N4HA 5I1QA 4UIXA 5E9MA 4NYXA 5LVRA 3U5JA 3IU6A 3O37A 5D3TA 5EM3A 3QZTA 5HCLA 5F1HA 5BT4A 5ENIA 4QSTA 4A9EA 4QEWA 2GRCA 4XY8A 3TLPA 4QC3A 5HQ7A 5LKZA 4A9KA 5E74A 5LKTA 5I86A 4A9NA 4YAXA 2L5EA 5D24A 3SVFA 3U5MA 3JVMA 3NXBA 5CQ3A 3G0JA 4YATA 4NRCA 4BW4A 4QB3A 5A7CA 4J3IA 5FH8A 5ENBA 4TTEA 4PCEA 5EVAA 5H85A 4MEPA 4HXOA 3MB4A 5EPBA 4UYEA 4IR4A 4QSSA 5F3AA 4IORA 4YABA 4F3IA 5DFCA 4YYGA 4LYSA 5EICA 5HQ5A 3P1CA 4XUAA 1WUGA 5HJCA 4YBMA 2N9GA 2RO1A 5G4SA 5E9YA 5F25A 3SVGA 5CP5A 5AMEA 3LXJA 4MR3A 2F6JA 4O7FA 5L98A 4O7EA 4YYMA 4HBXA 4O7CA 2DVRA 4OUFA 4ZQLA 5HELA 4O7AA 1WUMA 5ENJA 5FE2A 5L99A 4NS5A 3U5PA 3MB3A 5FE8A 5IG6A 3O34A 4BW1A 5I89A 5FE6A 3MUKA 1X0JA 4YY6A 4MENA 5CQAA 5E9VA 5L8UA 4XY9A 3HMFA 5C8GA 5D3PA 4LYIA 4TQNA 1ZS5A 2G4AA 5C4QA 4YADA 4CUTA 4HXRA 2YEKA 4QR4A 5CGPA 5FE7A 5HLSA 4A9JA 5IGNA 4O77A 4QZSA 4UITA 4PS5A 5EWDA 5EWVA 5FH6A 4A9FA 5D25A 2RI7A 3D1BA 5CY9A 5ETBA 4YYKA 4YBTA 3UV4A 5A82A 5ENGA 5EISA 4Y03A 3ERRA 5CZGA 4IOOA 5FE9A 4MR4A 3Q2FA 5C89A 5FE0A 4NUCA 5HRVA 3P1EA 5LKXA 5CRMA 4E96A 5I83A 5DY7A 5HRWA 4QNSA 4NR7A 3QZSA 5DYAA 5D3NA 5HENA 4PTBA 5FBXA 4TZ8A 4Z1SA 2DKWA 2RNYA 5CUBA 4OGJA 4TT2A 3LJWA 4QYLA 3RCWA 5F5ZA 4KCXA 5KHMA 4AKIA 5EK9A 5FDZA 3Q2EA 4YC9A 5LUUA 2MJVB 4HXSA 4A9MA 4BJXA 4Z93A 5DLZA 5ENCA 3UVXA 4TU6A 4CUSA 3LQJA 1JSPB 4MEQA 5JWMA 2DATA 4QSWA 4YYJA 5F62A 3JVKA 5DW2A 2RS9B 4C66A 4UYDA 5E9LA 4UIYA 5F60A 5DYCA 5CQ4A 4LR6A 4Z1QA 5CUEA 4Q0OA 3HMEA 4YYNA 5LKUA 5BT5A 3VKHA 2R0SA 5DKDA 1E6IA 4Q0NA 4BHWA 5E0RA 3D7CA 3UVWA 5A5NA 5H1VA 5I29A 5TB6A 5J0DA 4NXJA 4O70A 5IBNA 2R0YA 5E3DA 4NQMA 4CUPA 4LYWA 5A83A 4X2IA 5A5SA 4O76A 5E9IA 5FFVA 5I88A 5ENHA 4QSUA 5DW1A 3AQAA 5EGUA 4QY4A 1N72A 5EWHA 2OSSA 4LZRA 5EPSA 4UYFB 4HBYA 4PCIA 4XUBA 4NR4A 5A5OA 4RVRA 4ZC9A 4CUQA 5ACYA 5EP7A 4HBVA 5AMFA 4NR8A 5FB1A 4N4FA 5CUGA 5FH7A 5EV9A 2DVQA 4QYDA 3UVYA 4WIVA 3U5KA 3UV2A 4YH4A 4YK0A 5H1UA 2E3KA 3AADA 2RNWA 3MXFA 5DX4A 5H1TA 4QSRA 4LC2A 4MEOA 5FE4A 5HQ6A 4AI6A 4UYFA 4YY4A 2WP1A 5D3JA 5D0CA 2OUOA 5EI4A 2NXBA 2F6NA 5HFRA 2FSAA 5KU3A 5AD3A
chains in the Genus database with same CATH topology
2YYNA 4KV1A 4QSXA 4ALGA 4UIZA 5KO4A 5C85A 4A9LA 5I7YA 4NRAA 2KTBB 4HBWA 4UIWA 3FKMX 3P5OA 4ZW1A 2YDWA 5F2PA 4NYVA 4CLBA 4TT6A 5LJ1A 5FE1A 4PKLA 5LVQA 5F36A 5EWCA 4LZ2A 2R0VA 5E73A 2H60A 4QC1A 4HXLA 5FE5A 4UYHA 3DWYA 4HXMA 4N4GA 5G4RA 5DKHA 5E9KA 5HM0A 5FG6A 3MQMA 5FB0A 3U5OA 2DVVA 3MULA 4O71A 5CRZA 5CQ8A 5IGKA 4O72A 5II1A 2RNXA 4Z6IA 4TT4A 5CUCA 3UVDA 4TZ2A 1JM4B 4YBSA 5I80A 2RFJA 5FFYA 5LJ2A 4AKNA 4A9HA 5D3SA 3DAIA 5CQTA 3UW9A 4CFKA 4CURA 5EU1A 5EQ1A 3JVLA 5CUDA 4UYGA 3P1FA 4O7BA 4QSVA 5C87A 5AD2A 5A5QA 5FE3A 4O78A 5CU8A 4TU4A 3SVHA 4CUUA 3P1DA 4QUUA 4TYLA 4J1PA 4N3WA 5KTWA 4C67A 5F61A 4HXNA 2D9EA 4KV4A 4YH3A 3HMHA 4NR9A 5D3RA 5L96A 5FFWA 5CUAA 4FLPA 4WHWA 5F63A 4HXPA 5D3LA 4CFLA 5DFDA 5A85A 4YYDA 5EPRA 4QBMA 4N4IA 4XYAA 2YEMA 4NQNA 5CPEA 5F1LA 2D82A 5KTUA 4J0SA 5CQ7A 3U5LA 3ZYUA 5JI8A 5HRXA 4GPJA 4YYHA 1F68A 4LRGA 4J0RA 2LSPB 4IR5A 3S92A 2DWWA 5COIA 4DONA 4LZSA 4QUTA 5FG4A 4UIUA 5DYUA 5C7NA 4BW3A 3O35A 5E7DA 4Z6HA 4NUDA 4WHUA 4ALHA 3GG3A 4OGIA 3LQIA 4IOQA 5II2A 2I7KA 4NR5A 4NUEA 2YW5A 4NR6A 3QZVA 4QSQA 4HXKA 4PY6A 5CQ5A 5ENEA 5BT3A 3O36A 3G0LA 4BW2A 3JVJA 5I40A 2OO1A 4O75A 2E7OA 4YYIA 5E3GA 5K29A 3O33A 2L84A 5IGLA 5EWWA 5CFWA 4QR5A 4MR6A 2L85A 3IU5A 3LQHA 5DKCA 3K2JA 4QR3A 2R10A 2YQDA 4A9OA 5I7XA 5CTLA 2DVSA 5L97A 4QEVA 5CQ6A 5HEMA 3I3JA 4LDFA 5D7XA 2E7NA 5L8TA 5DLXA 5KTXA 5IIDA 2WP2A 3ONIA 5ENFA 5A5RA 4A9IA 3S91A 2YELA 5CS8A 5HFQA 5A81A 1EQFA 5D3HA 3U5NA 4QEUA 3UV5A 5IGMA 4IR3A 4NRBA 5D26A 5DBMA 5DFBA 5LJ0A 5FG5A 4QSPA 5EA1A 5ETDA 4O74A 2I8NA 4MR5A 5A5PA 5TCMA 4IR6A 4UIVA 5DYXA 4NYWA 4TS8A 4CL9A 4N4HA 5I1QA 4UIXA 5E9MA 4NYXA 5LVRA 3U5JA 3IU6A 3O37A 5D3TA 5EM3A 3QZTA 5HCLA 5F1HA 5BT4A 5ENIA 4QSTA 4A9EA 4QEWA 2GRCA 4XY8A 3TLPA 4QC3A 5HQ7A 5LKZA 4A9KA 5E74A 5LKTA 5I86A 4A9NA 4YAXA 2L5EA 5D24A 3SVFA 3U5MA 3JVMA 3NXBA 5CQ3A 3G0JA 4YATA 4NRCA 4BW4A 4QB3A 5A7CA 4J3IA 5FH8A 5ENBA 4TTEA 4PCEA 5EVAA 5H85A 4MEPA 4HXOA 3MB4A 5EPBA 4UYEA 4IR4A 4QSSA 5F3AA 4IORA 4YABA 4F3IA 5DFCA 4YYGA 4LYSA 5EICA 5HQ5A 3P1CA 4XUAA 1WUGA 5HJCA 4YBMA 2N9GA 2RO1A 5G4SA 5E9YA 5F25A 3SVGA 5CP5A 5AMEA 3LXJA 4MR3A 2F6JA 4O7FA 5L98A 4O7EA 4YYMA 4HBXA 4O7CA 2DVRA 4OUFA 4ZQLA 5HELA 4O7AA 1WUMA 5ENJA 5FE2A 5L99A 4NS5A 3U5PA 3MB3A 5FE8A 5IG6A 3O34A 4BW1A 5I89A 5FE6A 3MUKA 1X0JA 4YY6A 4MENA 5CQAA 5E9VA 5L8UA 4XY9A 3HMFA 5C8GA 5D3PA 4LYIA 4TQNA 1ZS5A 2G4AA 5C4QA 4YADA 4CUTA 4HXRA 2YEKA 4QR4A 5CGPA 5FE7A 5HLSA 4A9JA 5IGNA 4O77A 4QZSA 4UITA 4PS5A 5EWDA 5EWVA 5FH6A 4A9FA 5D25A 2RI7A 5CY9A 5ETBA 4YYKA 4YBTA 3UV4A 5A82A 5ENGA 5EISA 4Y03A 5CZGA 4IOOA 5FE9A 4MR4A 3Q2FA 5C89A 5FE0A 4NUCA 5HRVA 3P1EA 5LKXA 5CRMA 4E96A 5I83A 5DY7A 5HRWA 4QNSA 4NR7A 3QZSA 5DYAA 5D3NA 5HENA 4PTBA 5FBXA 4TZ8A 4Z1SA 2DKWA 2RNYA 5CUBA 4OGJA 4TT2A 3LJWA 4QYLA 3RCWA 5F5ZA 4KCXA 5KHMA 5EK9A 5FDZA 3Q2EA 4YC9A 5LUUA 2MJVB 4HXSA 4A9MA 4BJXA 4Z93A 5DLZA 5ENCA 3UVXA 4TU6A 4CUSA 3LQJA 1JSPB 4MEQA 5JWMA 2DATA 4QSWA 4YYJA 5F62A 3JVKA 5DW2A 2RS9B 4C66A 4UYDA 5E9LA 4UIYA 5F60A 5DYCA 5CQ4A 4LR6A 4Z1QA 5CUEA 4Q0OA 3HMEA 4YYNA 5LKUA 5BT5A 2R0SA 5DKDA 1E6IA 4Q0NA 4BHWA 5E0RA 3D7CA 3UVWA 5A5NA 5H1VA 5I29A 5TB6A 5J0DA 4NXJA 4O70A 5IBNA 2R0YA 5E3DA 4NQMA 4CUPA 4LYWA 5A83A 4X2IA 5A5SA 4O76A 5E9IA 5FFVA 5I88A 5ENHA 4QSUA 5DW1A 3AQAA 5EGUA 4QY4A 1N72A 5EWHA 2OSSA 4LZRA 5EPSA 4UYFB 4HBYA 4PCIA 4XUBA 4NR4A 5A5OA 4RVRA 4ZC9A 4CUQA 5ACYA 5EP7A 4HBVA 5AMFA 4NR8A 5FB1A 4N4FA 5CUGA 5FH7A 5EV9A 2DVQA 4QYDA 3UVYA 4WIVA 3U5KA 3UV2A 4YH4A 4YK0A 5H1UA 2E3KA 3AADA 2RNWA 3MXFA 5DX4A 5H1TA 4QSRA 4LC2A 4MEOA 5FE4A 5HQ6A 4UYFA 4YY4A 2WP1A 5D3JA 5D0CA 2OUOA 5EI4A 2NXBA 2F6NA 5HFRA 2FSAA 5KU3A 5AD3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YYN A;  4KV1 A;  4QSX A;  4ALG A;  4UIZ A;  5KO4 A;  5C85 A;  4A9L A;  5I7Y A;  4NRA A;  2KTB B;  4HBW A;  4UIW A;  3FKM X;  3P5O A;  4ZW1 A;  2YDW A;  5F2P A;  4NYV A;  4CLB A;  4TT6 A;  5LJ1 A;  5FE1 A;  4PKL A;  5LVQ A;  5F36 A;  5EWC A;  4LZ2 A;  2R0V A;  5E73 A;  2H60 A;  4QC1 A;  4HXL A;  5FE5 A;  4UYH A;  3DWY A;  4HXM A;  4N4G A;  5G4R A;  5DKH A;  5E9K A;  5HM0 A;  5FG6 A;  3MQM A;  5FB0 A;  3U5O A;  2DVV A;  3MUL A;  4O71 A;  5CRZ A;  5CQ8 A;  5IGK A;  4O72 A;  5II1 A;  2RNX A;  4Z6I A;  4TT4 A;  5CUC A;  3UVD A;  4TZ2 A;  1JM4 B;  4YBS A;  5I80 A;  2RFJ A;  5FFY A;  5LJ2 A;  4AKN A;  4A9H A;  5D3S A;  3DAI A;  5CQT A;  3UW9 A;  4CFK A;  4CUR A;  5EU1 A;  5EQ1 A;  3JVL A;  5CUD A;  4UYG A;  3P1F A;  4O7B A;  4QSV A;  5C87 A;  5AD2 A;  5A5Q A;  5FE3 A;  4O78 A;  5CU8 A;  4TU4 A;  3SVH A;  4CUU A;  3P1D A;  4QUU A;  4TYL A;  4J1P A;  4N3W A;  5KTW A;  4C67 A;  5F61 A;  4HXN A;  2D9E A;  4KV4 A;  4YH3 A;  3HMH A;  4NR9 A;  5D3R A;  5L96 A;  5FFW A;  5CUA A;  4FLP A;  4WHW A;  5F63 A;  4HXP A;  5D3L A;  4CFL A;  5DFD A;  5A85 A;  4YYD A;  5EPR A;  4QBM A;  4N4I A;  4XYA A;  2YEM A;  4NQN A;  5CPE A;  5F1L A;  2D82 A;  5KTU A;  4J0S A;  5CQ7 A;  3U5L A;  3ZYU A;  5JI8 A;  5HRX A;  4GPJ A;  4YYH A;  1F68 A;  4LRG A;  4J0R A;  2LSP B;  4IR5 A;  3S92 A;  2DWW A;  5COI A;  4DON A;  4LZS A;  4QUT A;  5FG4 A;  4UIU A;  5DYU A;  5C7N A;  4BW3 A;  3O35 A;  5E7D A;  4Z6H A;  4NUD A;  4WHU A;  4ALH A;  3GG3 A;  4OGI A;  3LQI A;  4IOQ A;  5II2 A;  2I7K A;  4NR5 A;  4NUE A;  2YW5 A;  4NR6 A;  3QZV A;  4QSQ A;  4HXK A;  4PY6 A;  5CQ5 A;  5ENE A;  5BT3 A;  3O36 A;  3G0L A;  4BW2 A;  3JVJ A;  5I40 A;  2OO1 A;  4O75 A;  2E7O A;  4YYI A;  5E3G A;  5K29 A;  3O33 A;  2L84 A;  5IGL A;  5EWW A;  5CFW A;  4QR5 A;  4MR6 A;  2L85 A;  3IU5 A;  3LQH A;  5DKC A;  3K2J A;  4QR3 A;  2R10 A;  2YQD A;  4A9O A;  5I7X A;  5CTL A;  2DVS A;  5L97 A;  4QEV A;  5CQ6 A;  5HEM A;  3I3J A;  4LDF A;  5D7X A;  2E7N A;  5L8T A;  5DLX A;  5KTX A;  5IID A;  2WP2 A;  3ONI A;  5ENF A;  5A5R A;  4A9I A;  3S91 A;  2YEL A;  5CS8 A;  5HFQ A;  5A81 A;  1EQF A;  5D3H A;  3U5N A;  4QEU A;  3UV5 A;  5IGM A;  4IR3 A;  4NRB A;  5D26 A;  5DBM A;  5DFB A;  5LJ0 A;  5FG5 A;  4QSP A;  5EA1 A;  5ETD A;  4O74 A;  2I8N A;  4MR5 A;  5A5P A;  5TCM A;  4IR6 A;  4UIV A;  5DYX A;  4NYW A;  4TS8 A;  4CL9 A;  4N4H A;  5I1Q A;  4UIX A;  5E9M A;  4NYX A;  5LVR A;  3U5J A;  3IU6 A;  3O37 A;  5D3T A;  5EM3 A;  3QZT A;  5HCL A;  5F1H A;  5BT4 A;  5ENI A;  4QST A;  4A9E A;  4QEW A;  2GRC A;  4XY8 A;  3TLP A;  4QC3 A;  5HQ7 A;  5LKZ A;  4A9K A;  5E74 A;  5LKT A;  5I86 A;  4A9N A;  4YAX A;  2L5E A;  5D24 A;  3SVF A;  3U5M A;  3JVM A;  3NXB A;  5CQ3 A;  3G0J A;  4YAT A;  4NRC A;  4BW4 A;  4QB3 A;  5A7C A;  4J3I A;  5FH8 A;  5ENB A;  4TTE A;  4PCE A;  5EVA A;  5H85 A;  4MEP A;  4HXO A;  3MB4 A;  5EPB A;  4UYE A;  4IR4 A;  4QSS A;  5F3A A;  4IOR A;  4YAB A;  4F3I A;  5DFC A;  4YYG A;  4LYS A;  5EIC A;  5HQ5 A;  3P1C A;  4XUA A;  1WUG A;  5HJC A;  4YBM A;  2N9G A;  2RO1 A;  5G4S A;  5E9Y A;  5F25 A;  3SVG A;  5CP5 A;  5AME A;  3LXJ A;  4MR3 A;  2F6J A;  4O7F A;  5L98 A;  4O7E A;  4YYM A;  4HBX A;  4O7C A;  2DVR A;  4OUF A;  4ZQL A;  5HEL A;  4O7A A;  1WUM A;  5ENJ A;  5FE2 A;  5L99 A;  4NS5 A;  3U5P A;  3MB3 A;  5FE8 A;  5IG6 A;  3O34 A;  4BW1 A;  5I89 A;  5FE6 A;  3MUK A;  1X0J A;  4YY6 A;  4MEN A;  5CQA A;  5E9V A;  5L8U A;  4XY9 A;  3HMF A;  5C8G A;  5D3P A;  4LYI A;  4TQN A;  1ZS5 A;  2G4A A;  5C4Q A;  4YAD A;  4CUT A;  4HXR A;  2YEK A;  4QR4 A;  5CGP A;  5FE7 A;  5HLS A;  4A9J A;  5IGN A;  4O77 A;  4QZS A;  4UIT A;  4PS5 A;  5EWD A;  5EWV A;  5FH6 A;  4A9F A;  5D25 A;  2RI7 A;  5CY9 A;  5ETB A;  4YYK A;  4YBT A;  3UV4 A;  5A82 A;  5ENG A;  5EIS A;  4Y03 A;  5CZG A;  4IOO A;  5FE9 A;  4MR4 A;  3Q2F A;  5C89 A;  5FE0 A;  4NUC A;  5HRV A;  3P1E A;  5LKX A;  5CRM A;  4E96 A;  5I83 A;  5DY7 A;  5HRW A;  4QNS A;  4NR7 A;  3QZS A;  5DYA A;  5D3N A;  5HEN A;  4PTB A;  5FBX A;  4TZ8 A;  4Z1S A;  2DKW A;  2RNY A;  5CUB A;  4OGJ A;  4TT2 A;  3LJW A;  4QYL A;  3RCW A;  5F5Z A;  4KCX A;  5KHM A;  5EK9 A;  5FDZ A;  3Q2E A;  4YC9 A;  5LUU A;  2MJV B;  4HXS A;  4A9M A;  4BJX A;  4Z93 A;  5DLZ A;  5ENC A;  3UVX A;  4TU6 A;  4CUS A;  3LQJ A;  1JSP B;  4MEQ A;  5JWM A;  2DAT A;  4QSW A;  4YYJ A;  5F62 A;  3JVK A;  5DW2 A;  2RS9 B;  4C66 A;  4UYD A;  5E9L A;  4UIY A;  5F60 A;  5DYC A;  5CQ4 A;  4LR6 A;  4Z1Q A;  5CUE A;  4Q0O A;  3HME A;  4YYN A;  5LKU A;  5BT5 A;  2R0S A;  5DKD A;  1E6I A;  4Q0N A;  4BHW A;  5E0R A;  3D7C A;  3UVW A;  5A5N A;  5H1V A;  5I29 A;  5TB6 A;  5J0D A;  4NXJ A;  4O70 A;  5IBN A;  2R0Y A;  5E3D A;  4NQM A;  4CUP A;  4LYW A;  5A83 A;  4X2I A;  5A5S A;  4O76 A;  5E9I A;  5FFV A;  5I88 A;  5ENH A;  4QSU A;  5DW1 A;  3AQA A;  5EGU A;  4QY4 A;  1N72 A;  5EWH A;  2OSS A;  4LZR A;  5EPS A;  4UYF B;  4HBY A;  4PCI A;  4XUB A;  4NR4 A;  5A5O A;  4RVR A;  4ZC9 A;  4CUQ A;  5ACY A;  5EP7 A;  4HBV A;  5AMF A;  4NR8 A;  5FB1 A;  4N4F A;  5CUG A;  5FH7 A;  5EV9 A;  2DVQ A;  4QYD A;  3UVY A;  4WIV A;  3U5K A;  3UV2 A;  4YH4 A;  4YK0 A;  5H1U A;  2E3K A;  3AAD A;  2RNW A;  3MXF A;  5DX4 A;  5H1T A;  4QSR A;  4LC2 A;  4MEO A;  5FE4 A;  5HQ6 A;  4UYF A;  4YY4 A;  2WP1 A;  5D3J A;  5D0C A;  2OUO A;  5EI4 A;  2NXB A;  2F6N A;  5HFR A;  2FSA A;  5KU3 A;  5AD3 A; 
#chains in the Genus database with same CATH topology
 2YYN A;  4KV1 A;  4QSX A;  4ALG A;  4UIZ A;  5KO4 A;  5C85 A;  4A9L A;  5I7Y A;  4NRA A;  2KTB B;  4HBW A;  4UIW A;  3FKM X;  3P5O A;  4ZW1 A;  2YDW A;  5F2P A;  4NYV A;  4CLB A;  4TT6 A;  5LJ1 A;  5FE1 A;  4PKL A;  5LVQ A;  5F36 A;  5EWC A;  4LZ2 A;  2R0V A;  5E73 A;  2H60 A;  4QC1 A;  4HXL A;  5FE5 A;  4UYH A;  3DWY A;  4HXM A;  4N4G A;  5G4R A;  5DKH A;  5E9K A;  5HM0 A;  5FG6 A;  3MQM A;  5FB0 A;  3U5O A;  2DVV A;  3MUL A;  4O71 A;  5CRZ A;  5CQ8 A;  5IGK A;  4O72 A;  5II1 A;  2RNX A;  4Z6I A;  4TT4 A;  5CUC A;  3UVD A;  4TZ2 A;  1JM4 B;  1PUO A;  4YBS A;  5I80 A;  2RFJ A;  5FFY A;  5LJ2 A;  4AKN A;  4A9H A;  5D3S A;  3DAI A;  5CQT A;  3UW9 A;  4CFK A;  4CUR A;  5EU1 A;  5EQ1 A;  3JVL A;  5CUD A;  4UYG A;  3P1F A;  4O7B A;  4QSV A;  5C87 A;  5AD2 A;  5A5Q A;  5FE3 A;  4O78 A;  5CU8 A;  4TU4 A;  3SVH A;  4CUU A;  3P1D A;  4QUU A;  4TYL A;  4J1P A;  4N3W A;  5KTW A;  4C67 A;  5F61 A;  4HXN A;  2D9E A;  4KV4 A;  4YH3 A;  4AKG A;  3HMH A;  4NR9 A;  5D3R A;  5L96 A;  5FFW A;  5CUA A;  4FLP A;  4WHW A;  5F63 A;  4HXP A;  5D3L A;  4CFL A;  5DFD A;  5A85 A;  4YYD A;  5EPR A;  4QBM A;  4N4I A;  4XYA A;  2YEM A;  4NQN A;  5CPE A;  5F1L A;  2D82 A;  5KTU A;  4J0S A;  5CQ7 A;  3U5L A;  3ZYU A;  1ZKR A;  5HRX A;  5JI8 A;  4GPJ A;  4YYH A;  1F68 A;  4LRG A;  4J0R A;  4AKH A;  2LSP B;  4IR5 A;  3S92 A;  2DWW A;  5COI A;  4DON A;  3D1D A;  4LZS A;  4QUT A;  5FG4 A;  4UIU A;  5DYU A;  5C7N A;  4BW3 A;  3O35 A;  5E7D A;  4Z6H A;  4NUD A;  4WHU A;  4ALH A;  3GG3 A;  4OGI A;  3LQI A;  4IOQ A;  5II2 A;  2I7K A;  4NR5 A;  4NUE A;  2YW5 A;  4NR6 A;  3QZV A;  4QSQ A;  4HXK A;  4PY6 A;  5CQ5 A;  5ENE A;  5BT3 A;  3O36 A;  3G0L A;  4BW2 A;  3JVJ A;  5I40 A;  2OO1 A;  4O75 A;  2E7O A;  4YYI A;  5E3G A;  5K29 A;  3O33 A;  2L84 A;  5IGL A;  5EWW A;  5CFW A;  4QR5 A;  2EJN A;  4MR6 A;  2L85 A;  3IU5 A;  3LQH A;  5DKC A;  3K2J A;  4QR3 A;  2R10 A;  2YQD A;  4A9O A;  5I7X A;  5CTL A;  2DVS A;  5L97 A;  4QEV A;  5CQ6 A;  5HEM A;  3I3J A;  4LDF A;  5D7X A;  2E7N A;  5L8T A;  5DLX A;  5KTX A;  5IID A;  2WP2 A;  3ONI A;  5ENF A;  5A5R A;  4A9I A;  3S91 A;  2YEL A;  5CS8 A;  5HFQ A;  5A81 A;  3VKG A;  1EQF A;  5D3H A;  3U5N A;  4QEU A;  3UV5 A;  5IGM A;  4IR3 A;  4NRB A;  5D26 A;  5DBM A;  5DFB A;  5LJ0 A;  5FG5 A;  4QSP A;  5EA1 A;  5ETD A;  4O74 A;  2I8N A;  4MR5 A;  5A5P A;  5TCM A;  4IR6 A;  4UIV A;  5DYX A;  4NYW A;  4TS8 A;  4CL9 A;  4N4H A;  5I1Q A;  4UIX A;  5E9M A;  4NYX A;  5LVR A;  3U5J A;  3IU6 A;  3O37 A;  5D3T A;  5EM3 A;  3QZT A;  5HCL A;  5F1H A;  5BT4 A;  5ENI A;  4QST A;  4A9E A;  4QEW A;  2GRC A;  4XY8 A;  3TLP A;  4QC3 A;  5HQ7 A;  5LKZ A;  4A9K A;  5E74 A;  5LKT A;  5I86 A;  4A9N A;  4YAX A;  2L5E A;  5D24 A;  3SVF A;  3U5M A;  3JVM A;  3NXB A;  5CQ3 A;  3G0J A;  4YAT A;  4NRC A;  4BW4 A;  4QB3 A;  5A7C A;  4J3I A;  5FH8 A;  5ENB A;  4TTE A;  4PCE A;  5EVA A;  5H85 A;  4MEP A;  4HXO A;  3MB4 A;  5EPB A;  4UYE A;  4IR4 A;  4QSS A;  5F3A A;  4IOR A;  4YAB A;  4F3I A;  5DFC A;  4YYG A;  4LYS A;  5EIC A;  5HQ5 A;  3P1C A;  4XUA A;  1WUG A;  5HJC A;  4YBM A;  2N9G A;  2RO1 A;  5G4S A;  5E9Y A;  5F25 A;  3SVG A;  5CP5 A;  5AME A;  3LXJ A;  4MR3 A;  2F6J A;  4O7F A;  5L98 A;  4O7E A;  4YYM A;  4HBX A;  4O7C A;  2DVR A;  4OUF A;  4ZQL A;  5HEL A;  4O7A A;  1WUM A;  5ENJ A;  5FE2 A;  5L99 A;  4NS5 A;  3U5P A;  3MB3 A;  5FE8 A;  5IG6 A;  3O34 A;  4BW1 A;  5I89 A;  5FE6 A;  3MUK A;  1X0J A;  4YY6 A;  4MEN A;  5CQA A;  5E9V A;  5L8U A;  4XY9 A;  3HMF A;  5C8G A;  5D3P A;  4LYI A;  4TQN A;  1ZS5 A;  2G4A A;  5C4Q A;  4YAD A;  4CUT A;  4HXR A;  2YEK A;  4QR4 A;  5CGP A;  5FE7 A;  5HLS A;  4A9J A;  5IGN A;  4O77 A;  4QZS A;  4UIT A;  4PS5 A;  5EWD A;  5EWV A;  5FH6 A;  4A9F A;  5D25 A;  2RI7 A;  3D1B A;  5CY9 A;  5ETB A;  4YYK A;  4YBT A;  3UV4 A;  5A82 A;  5ENG A;  5EIS A;  4Y03 A;  3ERR A;  5CZG A;  4IOO A;  5FE9 A;  4MR4 A;  3Q2F A;  5C89 A;  5FE0 A;  4NUC A;  5HRV A;  3P1E A;  5LKX A;  5CRM A;  4E96 A;  5I83 A;  5DY7 A;  5HRW A;  4QNS A;  4NR7 A;  3QZS A;  5DYA A;  5D3N A;  5HEN A;  4PTB A;  5FBX A;  4TZ8 A;  4Z1S A;  2DKW A;  2RNY A;  5CUB A;  4OGJ A;  4TT2 A;  3LJW A;  4QYL A;  3RCW A;  5F5Z A;  4KCX A;  5KHM A;  4AKI A;  5EK9 A;  5FDZ A;  3Q2E A;  4YC9 A;  5LUU A;  2MJV B;  4HXS A;  4A9M A;  4BJX A;  4Z93 A;  5DLZ A;  5ENC A;  3UVX A;  4TU6 A;  4CUS A;  3LQJ A;  1JSP B;  4MEQ A;  5JWM A;  2DAT A;  4QSW A;  4YYJ A;  5F62 A;  3JVK A;  5DW2 A;  2RS9 B;  4C66 A;  4UYD A;  5E9L A;  4UIY A;  5F60 A;  5DYC A;  5CQ4 A;  4LR6 A;  4Z1Q A;  5CUE A;  4Q0O A;  3HME A;  4YYN A;  5LKU A;  5BT5 A;  3VKH A;  2R0S A;  5DKD A;  1E6I A;  4Q0N A;  4BHW A;  5E0R A;  3D7C A;  3UVW A;  5A5N A;  5H1V A;  5I29 A;  5TB6 A;  5J0D A;  4NXJ A;  4O70 A;  5IBN A;  2R0Y A;  5E3D A;  4NQM A;  4CUP A;  4LYW A;  5A83 A;  4X2I A;  5A5S A;  4O76 A;  5E9I A;  5FFV A;  5I88 A;  5ENH A;  4QSU A;  5DW1 A;  3AQA A;  5EGU A;  4QY4 A;  1N72 A;  5EWH A;  2OSS A;  4LZR A;  5EPS A;  4UYF B;  4HBY A;  4PCI A;  4XUB A;  4NR4 A;  5A5O A;  4RVR A;  4ZC9 A;  4CUQ A;  5ACY A;  5EP7 A;  4HBV A;  5AMF A;  4NR8 A;  5FB1 A;  4N4F A;  5CUG A;  5FH7 A;  5EV9 A;  2DVQ A;  4QYD A;  3UVY A;  4WIV A;  3U5K A;  3UV2 A;  4YH4 A;  4YK0 A;  5H1U A;  2E3K A;  3AAD A;  2RNW A;  3MXF A;  5DX4 A;  5H1T A;  4QSR A;  4LC2 A;  4MEO A;  5FE4 A;  5HQ6 A;  4AI6 A;  4UYF A;  4YY4 A;  2WP1 A;  5D3J A;  5D0C A;  2OUO A;  5EI4 A;  2NXB A;  2F6N A;  5HFR A;  2FSA A;  5KU3 A;  5AD3 A; 
#chains in the Genus database with same CATH homology
 2YYN A;  4KV1 A;  4QSX A;  4ALG A;  4UIZ A;  5KO4 A;  5C85 A;  4A9L A;  5I7Y A;  4NRA A;  2KTB B;  4HBW A;  4UIW A;  3FKM X;  3P5O A;  4ZW1 A;  2YDW A;  5F2P A;  4NYV A;  4CLB A;  4TT6 A;  5LJ1 A;  5FE1 A;  4PKL A;  5LVQ A;  5F36 A;  5EWC A;  4LZ2 A;  2R0V A;  5E73 A;  2H60 A;  4QC1 A;  4HXL A;  5FE5 A;  4UYH A;  3DWY A;  4HXM A;  4N4G A;  5G4R A;  5DKH A;  5E9K A;  5HM0 A;  5FG6 A;  3MQM A;  5FB0 A;  3U5O A;  2DVV A;  3MUL A;  4O71 A;  5CRZ A;  5CQ8 A;  5IGK A;  4O72 A;  5II1 A;  2RNX A;  4Z6I A;  4TT4 A;  5CUC A;  3UVD A;  4TZ2 A;  1JM4 B;  4YBS A;  5I80 A;  2RFJ A;  5FFY A;  5LJ2 A;  4AKN A;  4A9H A;  5D3S A;  3DAI A;  5CQT A;  3UW9 A;  4CFK A;  4CUR A;  5EU1 A;  5EQ1 A;  3JVL A;  5CUD A;  4UYG A;  3P1F A;  4O7B A;  4QSV A;  5C87 A;  5AD2 A;  5A5Q A;  5FE3 A;  4O78 A;  5CU8 A;  4TU4 A;  3SVH A;  4CUU A;  3P1D A;  4QUU A;  4TYL A;  4J1P A;  4N3W A;  5KTW A;  4C67 A;  5F61 A;  4HXN A;  2D9E A;  4KV4 A;  4YH3 A;  3HMH A;  4NR9 A;  5D3R A;  5L96 A;  5FFW A;  5CUA A;  4FLP A;  4WHW A;  5F63 A;  4HXP A;  5D3L A;  4CFL A;  5DFD A;  5A85 A;  4YYD A;  5EPR A;  4QBM A;  4N4I A;  4XYA A;  2YEM A;  4NQN A;  5CPE A;  5F1L A;  2D82 A;  5KTU A;  4J0S A;  5CQ7 A;  3U5L A;  3ZYU A;  5JI8 A;  5HRX A;  4GPJ A;  4YYH A;  1F68 A;  4LRG A;  4J0R A;  2LSP B;  4IR5 A;  3S92 A;  2DWW A;  5COI A;  4DON A;  4LZS A;  4QUT A;  5FG4 A;  4UIU A;  5DYU A;  5C7N A;  4BW3 A;  3O35 A;  5E7D A;  4Z6H A;  4NUD A;  4WHU A;  4ALH A;  3GG3 A;  4OGI A;  3LQI A;  4IOQ A;  5II2 A;  2I7K A;  4NR5 A;  4NUE A;  2YW5 A;  4NR6 A;  3QZV A;  4QSQ A;  4HXK A;  4PY6 A;  5CQ5 A;  5ENE A;  5BT3 A;  3O36 A;  3G0L A;  4BW2 A;  3JVJ A;  5I40 A;  2OO1 A;  4O75 A;  2E7O A;  4YYI A;  5E3G A;  5K29 A;  3O33 A;  2L84 A;  5IGL A;  5EWW A;  5CFW A;  4QR5 A;  4MR6 A;  2L85 A;  3IU5 A;  3LQH A;  5DKC A;  3K2J A;  4QR3 A;  2R10 A;  2YQD A;  4A9O A;  5I7X A;  5CTL A;  2DVS A;  5L97 A;  4QEV A;  5CQ6 A;  5HEM A;  3I3J A;  4LDF A;  5D7X A;  2E7N A;  5L8T A;  5DLX A;  5KTX A;  5IID A;  2WP2 A;  3ONI A;  5ENF A;  5A5R A;  4A9I A;  3S91 A;  2YEL A;  5CS8 A;  5HFQ A;  5A81 A;  1EQF A;  5D3H A;  3U5N A;  4QEU A;  3UV5 A;  5IGM A;  4IR3 A;  4NRB A;  5D26 A;  5DBM A;  5DFB A;  5LJ0 A;  5FG5 A;  4QSP A;  5EA1 A;  5ETD A;  4O74 A;  2I8N A;  4MR5 A;  5A5P A;  5TCM A;  4IR6 A;  4UIV A;  5DYX A;  4NYW A;  4TS8 A;  4CL9 A;  4N4H A;  5I1Q A;  4UIX A;  5E9M A;  4NYX A;  5LVR A;  3U5J A;  3IU6 A;  3O37 A;  5D3T A;  5EM3 A;  3QZT A;  5HCL A;  5F1H A;  5BT4 A;  5ENI A;  4QST A;  4A9E A;  4QEW A;  2GRC A;  4XY8 A;  3TLP A;  4QC3 A;  5HQ7 A;  5LKZ A;  4A9K A;  5E74 A;  5LKT A;  5I86 A;  4A9N A;  4YAX A;  2L5E A;  5D24 A;  3SVF A;  3U5M A;  3JVM A;  3NXB A;  5CQ3 A;  3G0J A;  4YAT A;  4NRC A;  4BW4 A;  4QB3 A;  5A7C A;  4J3I A;  5FH8 A;  5ENB A;  4TTE A;  4PCE A;  5EVA A;  5H85 A;  4MEP A;  4HXO A;  3MB4 A;  5EPB A;  4UYE A;  4IR4 A;  4QSS A;  5F3A A;  4IOR A;  4YAB A;  4F3I A;  5DFC A;  4YYG A;  4LYS A;  5EIC A;  5HQ5 A;  3P1C A;  4XUA A;  1WUG A;  5HJC A;  4YBM A;  2N9G A;  2RO1 A;  5G4S A;  5E9Y A;  5F25 A;  3SVG A;  5CP5 A;  5AME A;  3LXJ A;  4MR3 A;  2F6J A;  4O7F A;  5L98 A;  4O7E A;  4YYM A;  4HBX A;  4O7C A;  2DVR A;  4OUF A;  4ZQL A;  5HEL A;  4O7A A;  1WUM A;  5ENJ A;  5FE2 A;  5L99 A;  4NS5 A;  3U5P A;  3MB3 A;  5FE8 A;  5IG6 A;  3O34 A;  4BW1 A;  5I89 A;  5FE6 A;  3MUK A;  1X0J A;  4YY6 A;  4MEN A;  5CQA A;  5E9V A;  5L8U A;  4XY9 A;  3HMF A;  5C8G A;  5D3P A;  4LYI A;  4TQN A;  1ZS5 A;  2G4A A;  5C4Q A;  4YAD A;  4CUT A;  4HXR A;  2YEK A;  4QR4 A;  5CGP A;  5FE7 A;  5HLS A;  4A9J A;  5IGN A;  4O77 A;  4QZS A;  4UIT A;  4PS5 A;  5EWD A;  5EWV A;  5FH6 A;  4A9F A;  5D25 A;  2RI7 A;  5CY9 A;  5ETB A;  4YYK A;  4YBT A;  3UV4 A;  5A82 A;  5ENG A;  5EIS A;  4Y03 A;  5CZG A;  4IOO A;  5FE9 A;  4MR4 A;  3Q2F A;  5C89 A;  5FE0 A;  4NUC A;  5HRV A;  3P1E A;  5LKX A;  5CRM A;  4E96 A;  5I83 A;  5DY7 A;  5HRW A;  4QNS A;  4NR7 A;  3QZS A;  5DYA A;  5D3N A;  5HEN A;  4PTB A;  5FBX A;  4TZ8 A;  4Z1S A;  2DKW A;  2RNY A;  5CUB A;  4OGJ A;  4TT2 A;  3LJW A;  4QYL A;  3RCW A;  5F5Z A;  4KCX A;  5KHM A;  5EK9 A;  5FDZ A;  3Q2E A;  4YC9 A;  5LUU A;  2MJV B;  4HXS A;  4A9M A;  4BJX A;  4Z93 A;  5DLZ A;  5ENC A;  3UVX A;  4TU6 A;  4CUS A;  3LQJ A;  1JSP B;  4MEQ A;  5JWM A;  2DAT A;  4QSW A;  4YYJ A;  5F62 A;  3JVK A;  5DW2 A;  2RS9 B;  4C66 A;  4UYD A;  5E9L A;  4UIY A;  5F60 A;  5DYC A;  5CQ4 A;  4LR6 A;  4Z1Q A;  5CUE A;  4Q0O A;  3HME A;  4YYN A;  5LKU A;  5BT5 A;  2R0S A;  5DKD A;  1E6I A;  4Q0N A;  4BHW A;  5E0R A;  3D7C A;  3UVW A;  5A5N A;  5H1V A;  5I29 A;  5TB6 A;  5J0D A;  4NXJ A;  4O70 A;  5IBN A;  2R0Y A;  5E3D A;  4NQM A;  4CUP A;  4LYW A;  5A83 A;  4X2I A;  5A5S A;  4O76 A;  5E9I A;  5FFV A;  5I88 A;  5ENH A;  4QSU A;  5DW1 A;  3AQA A;  5EGU A;  4QY4 A;  1N72 A;  5EWH A;  2OSS A;  4LZR A;  5EPS A;  4UYF B;  4HBY A;  4PCI A;  4XUB A;  4NR4 A;  5A5O A;  4RVR A;  4ZC9 A;  4CUQ A;  5ACY A;  5EP7 A;  4HBV A;  5AMF A;  4NR8 A;  5FB1 A;  4N4F A;  5CUG A;  5FH7 A;  5EV9 A;  2DVQ A;  4QYD A;  3UVY A;  4WIV A;  3U5K A;  3UV2 A;  4YH4 A;  4YK0 A;  5H1U A;  2E3K A;  3AAD A;  2RNW A;  3MXF A;  5DX4 A;  5H1T A;  4QSR A;  4LC2 A;  4MEO A;  5FE4 A;  5HQ6 A;  4UYF A;  4YY4 A;  2WP1 A;  5D3J A;  5D0C A;  2OUO A;  5EI4 A;  2NXB A;  2F6N A;  5HFR A;  2FSA A;  5KU3 A;  5AD3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...