2MJVB

Solution structures of second bromodomain of brd4 with di-acetylated twist peptide
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
128
structure length
128
Chain Sequence
KDVPDSQQHPAPEKSSKVSEQLKCCSGILKEMFAKKHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Twist-related protein 1
publication title Disrupting the Interaction of BRD4 with Diacetylated Twist Suppresses Tumorigenesis in Basal-like Breast Cancer.
pubmed doi rcsb
source organism Homo sapiens
total genus 34
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2014-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2mjvB00
5LKTA 3IU5A 4NYVA 5FFWA 5FG6A 4A9IA 4YYJA 4NR9A 5FE6A 5E3DA 3NXBA 4Q0OA 5L96A 2YW5A 4IR5A 5II1A 5H1VA 4PY6A 5I88A 4TS8A 3AQAA 4O75A 5I1QA 3RCWA 3O37A 4QYLA 2E3KA 4YYHA 5KHMA 4QSWA 5CPEA 4UIYA 4NYXA 5CS8A 5CZGA 4UYFA 4CUSA 4N4FA 5TB6A 5D3TA 5DW2A 3K2JA 4YYDA 5EWDA 5E9MA 5IGKA 4NR5A 5L98A 3QZTA 5ENFA 5L97A 4O7FA 4O71A 5CRMA 5H1UA 4OGIA 3MXFA 4QEWA 4YYIA 3U5LA 5F60A 3DAIA 4YBSA 5CFWA 4N4HA 5HM0A 4QC3A 5E7DA 4KV4A 2YDWA 5ENGA 5DYUA 3I3JA 4QSRA 4TZ2A 5FE8A 4MEOA 4UIVA 3HMEA 4QR4A 2OSSA 4HBWA 5KTXA 5F25A 3Q2EA 2OUOA 5EPRA 4KCXA 4LYWA 3HMFA 4CFLA 4YAXA 5FH8A 5LJ0A 4NS5A 5HQ7A 2KTBB 4XY8A 4UIWA 4FLPA 1F68A 5D3RA 5HLSA 4IORA 4C67A 3UVXA 5LVRA 4Q0NA 3QZSA 2DATA 5TCMA 2L85A 5L8TA 4BW2A 5J0DA 2LSPB 5BT5A 4J3IA 5FDZA 4YY6A 4CFKA 2RS9B 5D24A 4MR6A 5HENA 5C7NA 5I89A 4N4GA 5DYAA 5I7YA 2I8NA 4YK0A 5K29A 3O36A 5E9LA 2GRCA 4ZC9A 5DBMA 4NRBA 4GPJA 4NR8A 5F1HA 5KTUA 5A85A 4QNSA 2R0YA 2L84A 4YBTA 2RNXA 4HXSA 4IR6A 4A9NA 5HEMA 4A9LA 2RI7A 5A7CA 4LRGA 2L5EA 3LXJA 5FFVA 3JVLA 4PCIA 4QR3A 4HXLA 5CQTA 5FE3A 5A5SA 4IR4A 3DWYA 4QYDA 5DKHA 4YH4A 3UVYA 4LZ2A 4UYHA 5A82A 5CQ4A 4O77A 4HBYA 3P1FA 4QSSA 5HELA 5DLXA 1JSPB 4O7EA 5I86A 5ENCA 3O34A 4QC1A 5I80A 4HXRA 5FB0A 4BW3A 2DVQA 2OO1A 5IBNA 5IGLA 5ETDA 4NR7A 5DFCA 4QEUA 4HXMA 5E74A 4CUTA 2I7KA 4Z93A 4O72A 4NR4A 4UYDA 5F62A 3ONIA 2N9GA 4QB3A 5D3PA 3UV4A 5EK9A 3MUKA 5KO4A 4UYEA 5EPSA 5IG6A 5F3AA 5DX4A 4HXKA 5IIDA 5HQ6A 5CUDA 4A9FA 4YC9A 5A81A 2DVRA 5DYXA 5H1TA 4QR5A 3MULA 3O35A 3U5PA 1E6IA 5D25A 5FE7A 5G4RA 2YEKA 4QY4A 5CUAA 4DONA 4O76A 5JI8A 5D3JA 4ALHA 4MR5A 5D3LA 2RNWA 5CP5A 5EA1A 3LQIA 5HRVA 1EQFA 5E9VA 5G4SA 5CY9A 5KU3A 3FKMX 4ALGA 4XY9A 4MR3A 4BHWA 1ZS5A 4YY4A 2D82A 5E73A 5II2A 5DFBA 5EP7A 4PTBA 5CQ7A 4BW4A 4QUUA 5FH7A 4QSVA 4ZQLA 1N72A 2D9EA 4XUAA 5E0RA 5LKUA 1WUGA 2YELA 5D3SA 4NUDA 5EISA 3P1CA 4PS5A 2YQDA 4J1PA 4O7CA 1X0JA 4E96A 3UVWA 5CRZA 5CQ3A 5HRWA 4NQMA 5IGMA 5ETBA 3LJWA 4TQNA 3ZYUA 3TLPA 5EU1A 4HXPA 4A9JA 5DYCA 3D7CA 4KV1A 5FE0A 5LJ2A 4LYSA 4N3WA 4XUBA 5CU8A 4A9MA 4A9EA 4TYLA 3IU6A 5ENIA 5LVQA 4TT2A 5LUUA 2RNYA 3U5NA 4CUPA 5FH6A 4YH3A 4PKLA 5H85A 4UIXA 5AD2A 5EGUA 5CUCA 5FBXA 2R0SA 5DFDA 2G4AA 3MQMA 5F61A 3MB3A 5DLZA 4LR6A 5FFYA 5EM3A 3U5OA 4YYNA 5HRXA 5JWMA 2RO1A 4RVRA 1WUMA 5ENBA 4MENA 2H60A 4TU6A 5A5RA 5FE5A 3AADA 4N4IA 4XYAA 4TT6A 4YYKA 3JVKA 2E7OA 4MEQA 4LZRA 4TTEA 4BW1A 5EVAA 4QEVA 3G0JA 5CUGA 4HXNA 4CL9A 4LDFA 4O7AA 2WP1A 5F63A 4YBMA 4UYGA 4Z6IA 4IR3A 4NUEA 1JM4B 5A5PA 4NUCA 4A9KA 4QSQA 5C87A 5FG5A 4CUUA 5HFQA 5EICA 3U5MA 2YEMA 5AMEA 4YABA 5I83A 5CUEA 5DY7A 3JVMA 5EV9A 4UYFB 5D7XA 3UV2A 3LQJA 4YYGA 5E9IA 5L99A 5I40A 3Q2FA 4TU4A 3SVGA 5ENHA 3O33A 4LYIA 5EWHA 4A9HA 2R0VA 5EPBA 5HJCA 5CGPA 3GG3A 5ACYA 4WIVA 5I29A 3S91A 5D0CA 4ZW1A 5FE9A 5IGNA 5AD3A 4AKNA 3P5OA 4QBMA 5BT4A 5C4QA 4MR4A 5LKXA 2WP2A 5D26A 4HBVA 4UIZA 5LKZA 4X2IA 5ENEA 4OUFA 4QSXA 4Y03A 5DKDA 4HBXA 5E9KA 3SVHA 4LZSA 4BJXA 4O7BA 3JVJA 4J0RA 5EWWA 4F3IA 5CQAA 5C8GA 2DVSA 2F6NA 4Z1QA 2E7NA 5EI4A 5F1LA 5KTWA 4QSPA 5E9YA 4YYMA 5CQ6A 2NXBA 4NR6A 5FE1A 5HQ5A 3S92A 4QSUA 5EWVA 4QZSA 5DW1A 5LJ1A 4NQNA 2MJVB 2YYNA 2FSAA 4C66A 5BT3A 4O78A 4HXOA 5CUBA 3U5JA 2DWWA 5I7XA 3P1DA 4O70A 4PCEA 2RFJA 3UW9A 5A5OA 5HCLA 5F5ZA 3P1EA 4A9OA 3UVDA 3QZVA 4NRAA 5D3NA 5FG4A 4UITA 4CURA 4LC2A 4MEPA 4QSTA 5F36A 5CQ8A 5FB1A 5A83A 4TZ8A 3HMHA 2R10A 5HFRA 3SVFA 4YATA 4J0SA 4QUTA 5C89A 4WHWA 2DVVA 4NXJA 3U5KA 5AMFA 5COIA 5L8UA 4YADA 5EQ1A 4UIUA 4NRCA 5FE4A 4TT4A 4WHUA 5E3GA 4CLBA 5CQ5A 5CTLA 5A5NA 3LQHA 2F6JA 4IOQA 4Z1SA 5D3HA 4NYWA 3MB4A 5FE2A 5EWCA 2DKWA 5ENJA 4CUQA 4O74A 3UV5A 5F2PA 5A5QA 4OGJA 4IOOA 5DKCA 4Z6HA 3G0LA 5C85A
chains in the Genus database with same CATH superfamily
5LKTA 3IU5A 4NYVA 5FFWA 5FG6A 4A9IA 4YYJA 2EJNA 4NR9A 5FE6A 5E3DA 3NXBA 4Q0OA 5L96A 2YW5A 4IR5A 5II1A 5H1VA 4PY6A 5I88A 4TS8A 3AQAA 4O75A 5I1QA 3RCWA 3O37A 4QYLA 2E3KA 4YYHA 5KHMA 4QSWA 5CPEA 4UIYA 4NYXA 5CS8A 5CZGA 4UYFA 4CUSA 4N4FA 5TB6A 5D3TA 5DW2A 3K2JA 4YYDA 5EWDA 5E9MA 5IGKA 4NR5A 1PUOA 5L98A 3QZTA 5ENFA 5L97A 4O7FA 4O71A 5CRMA 5H1UA 4OGIA 3MXFA 4QEWA 4YYIA 3U5LA 5F60A 3ERRA 3DAIA 4YBSA 5CFWA 4N4HA 5HM0A 4QC3A 5E7DA 4KV4A 2YDWA 5ENGA 5DYUA 3I3JA 4QSRA 4TZ2A 5FE8A 4MEOA 4UIVA 3HMEA 4QR4A 2OSSA 4HBWA 5KTXA 5F25A 3Q2EA 2OUOA 5EPRA 4KCXA 4LYWA 3HMFA 4CFLA 4YAXA 5FH8A 5LJ0A 4NS5A 5HQ7A 2KTBB 4XY8A 4UIWA 4FLPA 1F68A 5D3RA 5HLSA 4IORA 4C67A 3UVXA 5LVRA 4Q0NA 3QZSA 2DATA 5TCMA 2L85A 5L8TA 4BW2A 5J0DA 2LSPB 5BT5A 4J3IA 5FDZA 4YY6A 4CFKA 2RS9B 5D24A 3D1BA 4MR6A 5HENA 5C7NA 5I89A 4N4GA 5DYAA 1ZKRA 5I7YA 2I8NA 4YK0A 5K29A 3O36A 5E9LA 2GRCA 4ZC9A 5DBMA 4NRBA 4GPJA 4NR8A 5F1HA 5KTUA 5A85A 4QNSA 2R0YA 2L84A 4YBTA 2RNXA 4HXSA 4IR6A 4A9NA 5HEMA 4A9LA 2RI7A 5A7CA 4LRGA 2L5EA 3LXJA 5FFVA 3JVLA 4PCIA 4QR3A 4HXLA 5CQTA 5FE3A 5A5SA 4IR4A 3DWYA 4QYDA 5DKHA 4YH4A 3UVYA 4LZ2A 4UYHA 5A82A 5CQ4A 4O77A 4HBYA 3P1FA 4QSSA 5HELA 5DLXA 1JSPB 4O7EA 5I86A 5ENCA 3O34A 4QC1A 5I80A 4HXRA 5FB0A 4BW3A 2DVQA 2OO1A 5IBNA 5IGLA 5ETDA 4NR7A 5DFCA 4QEUA 4HXMA 5E74A 4CUTA 2I7KA 4Z93A 4O72A 4NR4A 4UYDA 5F62A 3ONIA 2N9GA 4QB3A 5D3PA 3UV4A 5EK9A 3MUKA 5KO4A 4UYEA 5EPSA 5IG6A 5F3AA 5DX4A 4HXKA 5IIDA 5HQ6A 5CUDA 4A9FA 4YC9A 5A81A 2DVRA 5DYXA 5H1TA 4QR5A 3MULA 3O35A 3U5PA 1E6IA 5D25A 5FE7A 5G4RA 2YEKA 4QY4A 5CUAA 4DONA 4O76A 5JI8A 5D3JA 4ALHA 4MR5A 5D3LA 2RNWA 5CP5A 5EA1A 3LQIA 5HRVA 1EQFA 5E9VA 5G4SA 5CY9A 5KU3A 3FKMX 4ALGA 4XY9A 4MR3A 4BHWA 1ZS5A 4YY4A 2D82A 5E73A 5II2A 5DFBA 5EP7A 4PTBA 5CQ7A 4BW4A 4QUUA 5FH7A 4QSVA 4ZQLA 1N72A 2D9EA 4XUAA 5E0RA 5LKUA 1WUGA 2YELA 5D3SA 4NUDA 5EISA 3P1CA 4PS5A 2YQDA 4J1PA 4O7CA 1X0JA 4E96A 3UVWA 5CRZA 5CQ3A 5HRWA 4NQMA 5IGMA 5ETBA 3LJWA 4TQNA 3ZYUA 3TLPA 5EU1A 4HXPA 4A9JA 5DYCA 3D7CA 4KV1A 5FE0A 5LJ2A 4LYSA 4N3WA 4XUBA 5CU8A 4A9MA 4A9EA 4TYLA 3IU6A 5ENIA 5LVQA 4TT2A 5LUUA 2RNYA 3U5NA 4CUPA 5FH6A 4YH3A 4PKLA 5H85A 4UIXA 5AD2A 5EGUA 5CUCA 5FBXA 2R0SA 5DFDA 2G4AA 3MQMA 5F61A 3MB3A 5DLZA 4LR6A 5FFYA 5EM3A 3U5OA 4YYNA 5HRXA 5JWMA 2RO1A 4RVRA 1WUMA 5ENBA 4MENA 2H60A 4TU6A 5A5RA 5FE5A 3AADA 4N4IA 4XYAA 4TT6A 4YYKA 3JVKA 4AKGA 2E7OA 4MEQA 4LZRA 4TTEA 4BW1A 5EVAA 4QEVA 3G0JA 5CUGA 4HXNA 3D1DA 4CL9A 4LDFA 4O7AA 2WP1A 5F63A 4YBMA 4UYGA 4Z6IA 4IR3A 4NUEA 1JM4B 5A5PA 4NUCA 4A9KA 4QSQA 5C87A 5FG5A 4CUUA 5HFQA 5EICA 3U5MA 2YEMA 5AMEA 4YABA 5I83A 3VKGA 5CUEA 5DY7A 3JVMA 5EV9A 4UYFB 5D7XA 3UV2A 3LQJA 4YYGA 5E9IA 5L99A 5I40A 3Q2FA 4TU4A 3SVGA 5ENHA 3O33A 4LYIA 5EWHA 4A9HA 2R0VA 5EPBA 5HJCA 5CGPA 3GG3A 5ACYA 4WIVA 5I29A 3S91A 5D0CA 4AI6A 4ZW1A 5FE9A 5IGNA 5AD3A 4AKNA 3P5OA 4QBMA 5BT4A 5C4QA 4MR4A 5LKXA 2WP2A 5D26A 4HBVA 4UIZA 5LKZA 4X2IA 5ENEA 4OUFA 4QSXA 4Y03A 5DKDA 4HBXA 5E9KA 3SVHA 4LZSA 4BJXA 4O7BA 3JVJA 4J0RA 5EWWA 4F3IA 5CQAA 5C8GA 2DVSA 2F6NA 4Z1QA 2E7NA 5EI4A 5F1LA 5KTWA 4QSPA 5E9YA 4YYMA 5CQ6A 2NXBA 4NR6A 5FE1A 5HQ5A 3S92A 4QSUA 5EWVA 4QZSA 5DW1A 5LJ1A 4NQNA 2MJVB 2YYNA 2FSAA 4C66A 5BT3A 4O78A 4HXOA 5CUBA 3U5JA 2DWWA 5I7XA 3P1DA 4O70A 4PCEA 2RFJA 3UW9A 5A5OA 5HCLA 5F5ZA 3P1EA 4A9OA 3UVDA 3QZVA 4NRAA 5D3NA 5FG4A 4UITA 4CURA 4LC2A 4MEPA 4QSTA 5F36A 5CQ8A 5FB1A 5A83A 4TZ8A 3HMHA 2R10A 5HFRA 3SVFA 4YATA 4J0SA 4QUTA 5C89A 4WHWA 2DVVA 4NXJA 3U5KA 5AMFA 5COIA 5L8UA 4YADA 5EQ1A 4UIUA 4NRCA 5FE4A 3VKHA 4TT4A 4WHUA 5E3GA 4CLBA 5CQ5A 5CTLA 5A5NA 3LQHA 2F6JA 4IOQA 4Z1SA 4AKHA 5D3HA 4NYWA 3MB4A 5FE2A 5EWCA 2DKWA 5ENJA 4CUQA 4O74A 3UV5A 5F2PA 5A5QA 4OGJA 4IOOA 5DKCA 4Z6HA 3G0LA 4AKIA 5C85A
chains in the Genus database with same CATH topology
5LKTA 3IU5A 4NYVA 5FFWA 5FG6A 4A9IA 4YYJA 4NR9A 5FE6A 5E3DA 3NXBA 4Q0OA 5L96A 2YW5A 4IR5A 5II1A 5H1VA 4PY6A 5I88A 4TS8A 3AQAA 4O75A 5I1QA 3RCWA 3O37A 4QYLA 2E3KA 4YYHA 5KHMA 4QSWA 5CPEA 4UIYA 4NYXA 5CS8A 5CZGA 4UYFA 4CUSA 4N4FA 5TB6A 5D3TA 5DW2A 3K2JA 4YYDA 5EWDA 5E9MA 5IGKA 4NR5A 5L98A 3QZTA 5ENFA 5L97A 4O7FA 4O71A 5CRMA 5H1UA 4OGIA 3MXFA 4QEWA 4YYIA 3U5LA 5F60A 3DAIA 4YBSA 5CFWA 4N4HA 5HM0A 4QC3A 5E7DA 4KV4A 2YDWA 5ENGA 5DYUA 3I3JA 4QSRA 4TZ2A 5FE8A 4MEOA 4UIVA 3HMEA 4QR4A 2OSSA 4HBWA 5KTXA 5F25A 3Q2EA 2OUOA 5EPRA 4KCXA 4LYWA 3HMFA 4CFLA 4YAXA 5FH8A 5LJ0A 4NS5A 5HQ7A 2KTBB 4XY8A 4UIWA 4FLPA 1F68A 5D3RA 5HLSA 4IORA 4C67A 3UVXA 5LVRA 4Q0NA 3QZSA 2DATA 5TCMA 2L85A 5L8TA 4BW2A 5J0DA 2LSPB 5BT5A 4J3IA 5FDZA 4YY6A 4CFKA 2RS9B 5D24A 4MR6A 5HENA 5C7NA 5I89A 4N4GA 5DYAA 5I7YA 2I8NA 4YK0A 5K29A 3O36A 5E9LA 2GRCA 4ZC9A 5DBMA 4NRBA 4GPJA 4NR8A 5F1HA 5KTUA 5A85A 4QNSA 2R0YA 2L84A 4YBTA 2RNXA 4HXSA 4IR6A 4A9NA 5HEMA 4A9LA 2RI7A 5A7CA 4LRGA 2L5EA 3LXJA 5FFVA 3JVLA 4PCIA 4QR3A 4HXLA 5CQTA 5FE3A 5A5SA 4IR4A 3DWYA 4QYDA 5DKHA 4YH4A 3UVYA 4LZ2A 4UYHA 5A82A 5CQ4A 4O77A 4HBYA 3P1FA 4QSSA 5HELA 5DLXA 1JSPB 4O7EA 5I86A 5ENCA 3O34A 4QC1A 5I80A 4HXRA 5FB0A 4BW3A 2DVQA 2OO1A 5IBNA 5IGLA 5ETDA 4NR7A 5DFCA 4QEUA 4HXMA 5E74A 4CUTA 2I7KA 4Z93A 4O72A 4NR4A 4UYDA 5F62A 3ONIA 2N9GA 4QB3A 5D3PA 3UV4A 5EK9A 3MUKA 5KO4A 4UYEA 5EPSA 5IG6A 5F3AA 5DX4A 4HXKA 5IIDA 5HQ6A 5CUDA 4A9FA 4YC9A 5A81A 2DVRA 5DYXA 5H1TA 4QR5A 3MULA 3O35A 3U5PA 1E6IA 5D25A 5FE7A 5G4RA 2YEKA 4QY4A 5CUAA 4DONA 4O76A 5JI8A 5D3JA 4ALHA 4MR5A 5D3LA 2RNWA 5CP5A 5EA1A 3LQIA 5HRVA 1EQFA 5E9VA 5G4SA 5CY9A 5KU3A 3FKMX 4ALGA 4XY9A 4MR3A 4BHWA 1ZS5A 4YY4A 2D82A 5E73A 5II2A 5DFBA 5EP7A 4PTBA 5CQ7A 4BW4A 4QUUA 5FH7A 4QSVA 4ZQLA 1N72A 2D9EA 4XUAA 5E0RA 5LKUA 1WUGA 2YELA 5D3SA 4NUDA 5EISA 3P1CA 4PS5A 2YQDA 4J1PA 4O7CA 1X0JA 4E96A 3UVWA 5CRZA 5CQ3A 5HRWA 4NQMA 5IGMA 5ETBA 3LJWA 4TQNA 3ZYUA 3TLPA 5EU1A 4HXPA 4A9JA 5DYCA 3D7CA 4KV1A 5FE0A 5LJ2A 4LYSA 4N3WA 4XUBA 5CU8A 4A9MA 4A9EA 4TYLA 3IU6A 5ENIA 5LVQA 4TT2A 5LUUA 2RNYA 3U5NA 4CUPA 5FH6A 4YH3A 4PKLA 5H85A 4UIXA 5AD2A 5EGUA 5CUCA 5FBXA 2R0SA 5DFDA 2G4AA 3MQMA 5F61A 3MB3A 5DLZA 4LR6A 5FFYA 5EM3A 3U5OA 4YYNA 5HRXA 5JWMA 2RO1A 4RVRA 1WUMA 5ENBA 4MENA 2H60A 4TU6A 5A5RA 5FE5A 3AADA 4N4IA 4XYAA 4TT6A 4YYKA 3JVKA 2E7OA 4MEQA 4LZRA 4TTEA 4BW1A 5EVAA 4QEVA 3G0JA 5CUGA 4HXNA 4CL9A 4LDFA 4O7AA 2WP1A 5F63A 4YBMA 4UYGA 4Z6IA 4IR3A 4NUEA 1JM4B 5A5PA 4NUCA 4A9KA 4QSQA 5C87A 5FG5A 4CUUA 5HFQA 5EICA 3U5MA 2YEMA 5AMEA 4YABA 5I83A 5CUEA 5DY7A 3JVMA 5EV9A 4UYFB 5D7XA 3UV2A 3LQJA 4YYGA 5E9IA 5L99A 5I40A 3Q2FA 4TU4A 3SVGA 5ENHA 3O33A 4LYIA 5EWHA 4A9HA 2R0VA 5EPBA 5HJCA 5CGPA 3GG3A 5ACYA 4WIVA 5I29A 3S91A 5D0CA 4ZW1A 5FE9A 5IGNA 5AD3A 4AKNA 3P5OA 4QBMA 5BT4A 5C4QA 4MR4A 5LKXA 2WP2A 5D26A 4HBVA 4UIZA 5LKZA 4X2IA 5ENEA 4OUFA 4QSXA 4Y03A 5DKDA 4HBXA 5E9KA 3SVHA 4LZSA 4BJXA 4O7BA 3JVJA 4J0RA 5EWWA 4F3IA 5CQAA 5C8GA 2DVSA 2F6NA 4Z1QA 2E7NA 5EI4A 5F1LA 5KTWA 4QSPA 5E9YA 4YYMA 5CQ6A 2NXBA 4NR6A 5FE1A 5HQ5A 3S92A 4QSUA 5EWVA 4QZSA 5DW1A 5LJ1A 4NQNA 2MJVB 2YYNA 2FSAA 4C66A 5BT3A 4O78A 4HXOA 5CUBA 3U5JA 2DWWA 5I7XA 3P1DA 4O70A 4PCEA 2RFJA 3UW9A 5A5OA 5HCLA 5F5ZA 3P1EA 4A9OA 3UVDA 3QZVA 4NRAA 5D3NA 5FG4A 4UITA 4CURA 4LC2A 4MEPA 4QSTA 5F36A 5CQ8A 5FB1A 5A83A 4TZ8A 3HMHA 2R10A 5HFRA 3SVFA 4YATA 4J0SA 4QUTA 5C89A 4WHWA 2DVVA 4NXJA 3U5KA 5AMFA 5COIA 5L8UA 4YADA 5EQ1A 4UIUA 4NRCA 5FE4A 4TT4A 4WHUA 5E3GA 4CLBA 5CQ5A 5CTLA 5A5NA 3LQHA 2F6JA 4IOQA 4Z1SA 5D3HA 4NYWA 3MB4A 5FE2A 5EWCA 2DKWA 5ENJA 4CUQA 4O74A 3UV5A 5F2PA 5A5QA 4OGJA 4IOOA 5DKCA 4Z6HA 3G0LA 5C85A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LKT A;  3IU5 A;  4NYV A;  5FFW A;  5FG6 A;  4A9I A;  4YYJ A;  4NR9 A;  5FE6 A;  5E3D A;  3NXB A;  4Q0O A;  5L96 A;  2YW5 A;  4IR5 A;  5II1 A;  5H1V A;  4PY6 A;  5I88 A;  4TS8 A;  3AQA A;  4O75 A;  5I1Q A;  3RCW A;  3O37 A;  4QYL A;  2E3K A;  4YYH A;  5KHM A;  4QSW A;  5CPE A;  4UIY A;  4NYX A;  5CS8 A;  5CZG A;  4UYF A;  4CUS A;  4N4F A;  5TB6 A;  5D3T A;  5DW2 A;  3K2J A;  4YYD A;  5EWD A;  5E9M A;  5IGK A;  4NR5 A;  5L98 A;  3QZT A;  5ENF A;  5L97 A;  4O7F A;  4O71 A;  5CRM A;  5H1U A;  4OGI A;  3MXF A;  4QEW A;  4YYI A;  3U5L A;  5F60 A;  3DAI A;  4YBS A;  5CFW A;  4N4H A;  5HM0 A;  4QC3 A;  5E7D A;  4KV4 A;  2YDW A;  5ENG A;  5DYU A;  3I3J A;  4QSR A;  4TZ2 A;  5FE8 A;  4MEO A;  4UIV A;  3HME A;  4QR4 A;  2OSS A;  4HBW A;  5KTX A;  5F25 A;  3Q2E A;  2OUO A;  5EPR A;  4KCX A;  4LYW A;  3HMF A;  4CFL A;  4YAX A;  5FH8 A;  5LJ0 A;  4NS5 A;  5HQ7 A;  2KTB B;  4XY8 A;  4UIW A;  4FLP A;  1F68 A;  5D3R A;  5HLS A;  4IOR A;  4C67 A;  3UVX A;  5LVR A;  4Q0N A;  3QZS A;  2DAT A;  5TCM A;  2L85 A;  5L8T A;  4BW2 A;  5J0D A;  2LSP B;  5BT5 A;  4J3I A;  5FDZ A;  4YY6 A;  4CFK A;  2RS9 B;  5D24 A;  4MR6 A;  5HEN A;  5C7N A;  5I89 A;  4N4G A;  5DYA A;  5I7Y A;  2I8N A;  4YK0 A;  5K29 A;  3O36 A;  5E9L A;  2GRC A;  4ZC9 A;  5DBM A;  4NRB A;  4GPJ A;  4NR8 A;  5F1H A;  5KTU A;  5A85 A;  4QNS A;  2R0Y A;  2L84 A;  4YBT A;  2RNX A;  4HXS A;  4IR6 A;  4A9N A;  5HEM A;  4A9L A;  2RI7 A;  5A7C A;  4LRG A;  2L5E A;  3LXJ A;  5FFV A;  3JVL A;  4PCI A;  4QR3 A;  4HXL A;  5CQT A;  5FE3 A;  5A5S A;  4IR4 A;  3DWY A;  4QYD A;  5DKH A;  4YH4 A;  3UVY A;  4LZ2 A;  4UYH A;  5A82 A;  5CQ4 A;  4O77 A;  4HBY A;  3P1F A;  4QSS A;  5HEL A;  5DLX A;  1JSP B;  4O7E A;  5I86 A;  5ENC A;  3O34 A;  4QC1 A;  5I80 A;  4HXR A;  5FB0 A;  4BW3 A;  2DVQ A;  2OO1 A;  5IBN A;  5IGL A;  5ETD A;  4NR7 A;  5DFC A;  4QEU A;  4HXM A;  5E74 A;  4CUT A;  2I7K A;  4Z93 A;  4O72 A;  4NR4 A;  4UYD A;  5F62 A;  3ONI A;  2N9G A;  4QB3 A;  5D3P A;  3UV4 A;  5EK9 A;  3MUK A;  5KO4 A;  4UYE A;  5EPS A;  5IG6 A;  5F3A A;  5DX4 A;  4HXK A;  5IID A;  5HQ6 A;  5CUD A;  4A9F A;  4YC9 A;  5A81 A;  2DVR A;  5DYX A;  5H1T A;  4QR5 A;  3MUL A;  3O35 A;  3U5P A;  1E6I A;  5D25 A;  5FE7 A;  5G4R A;  2YEK A;  4QY4 A;  5CUA A;  4DON A;  4O76 A;  5JI8 A;  5D3J A;  4ALH A;  4MR5 A;  5D3L A;  2RNW A;  5CP5 A;  5EA1 A;  3LQI A;  5HRV A;  1EQF A;  5E9V A;  5G4S A;  5CY9 A;  5KU3 A;  3FKM X;  4ALG A;  4XY9 A;  4MR3 A;  4BHW A;  1ZS5 A;  4YY4 A;  2D82 A;  5E73 A;  5II2 A;  5DFB A;  5EP7 A;  4PTB A;  5CQ7 A;  4BW4 A;  4QUU A;  5FH7 A;  4QSV A;  4ZQL A;  1N72 A;  2D9E A;  4XUA A;  5E0R A;  5LKU A;  1WUG A;  2YEL A;  5D3S A;  4NUD A;  5EIS A;  3P1C A;  4PS5 A;  2YQD A;  4J1P A;  4O7C A;  1X0J A;  4E96 A;  3UVW A;  5CRZ A;  5CQ3 A;  5HRW A;  4NQM A;  5IGM A;  5ETB A;  3LJW A;  4TQN A;  3ZYU A;  3TLP A;  5EU1 A;  4HXP A;  4A9J A;  5DYC A;  3D7C A;  4KV1 A;  5FE0 A;  5LJ2 A;  4LYS A;  4N3W A;  4XUB A;  5CU8 A;  4A9M A;  4A9E A;  4TYL A;  3IU6 A;  5ENI A;  5LVQ A;  4TT2 A;  5LUU A;  2RNY A;  3U5N A;  4CUP A;  5FH6 A;  4YH3 A;  4PKL A;  5H85 A;  4UIX A;  5AD2 A;  5EGU A;  5CUC A;  5FBX A;  2R0S A;  5DFD A;  2G4A A;  3MQM A;  5F61 A;  3MB3 A;  5DLZ A;  4LR6 A;  5FFY A;  5EM3 A;  3U5O A;  4YYN A;  5HRX A;  5JWM A;  2RO1 A;  4RVR A;  1WUM A;  5ENB A;  4MEN A;  2H60 A;  4TU6 A;  5A5R A;  5FE5 A;  3AAD A;  4N4I A;  4XYA A;  4TT6 A;  4YYK A;  3JVK A;  2E7O A;  4MEQ A;  4LZR A;  4TTE A;  4BW1 A;  5EVA A;  4QEV A;  3G0J A;  5CUG A;  4HXN A;  4CL9 A;  4LDF A;  4O7A A;  2WP1 A;  5F63 A;  4YBM A;  4UYG A;  4Z6I A;  4IR3 A;  4NUE A;  1JM4 B;  5A5P A;  4NUC A;  4A9K A;  4QSQ A;  5C87 A;  5FG5 A;  4CUU A;  5HFQ A;  5EIC A;  3U5M A;  2YEM A;  5AME A;  4YAB A;  5I83 A;  5CUE A;  5DY7 A;  3JVM A;  5EV9 A;  4UYF B;  5D7X A;  3UV2 A;  3LQJ A;  4YYG A;  5E9I A;  5L99 A;  5I40 A;  3Q2F A;  4TU4 A;  3SVG A;  5ENH A;  3O33 A;  4LYI A;  5EWH A;  4A9H A;  2R0V A;  5EPB A;  5HJC A;  5CGP A;  3GG3 A;  5ACY A;  4WIV A;  5I29 A;  3S91 A;  5D0C A;  4ZW1 A;  5FE9 A;  5IGN A;  5AD3 A;  4AKN A;  3P5O A;  4QBM A;  5BT4 A;  5C4Q A;  4MR4 A;  5LKX A;  2WP2 A;  5D26 A;  4HBV A;  4UIZ A;  5LKZ A;  4X2I A;  5ENE A;  4OUF A;  4QSX A;  4Y03 A;  5DKD A;  4HBX A;  5E9K A;  3SVH A;  4LZS A;  4BJX A;  4O7B A;  3JVJ A;  4J0R A;  5EWW A;  4F3I A;  5CQA A;  5C8G A;  2DVS A;  2F6N A;  4Z1Q A;  2E7N A;  5EI4 A;  5F1L A;  5KTW A;  4QSP A;  5E9Y A;  4YYM A;  5CQ6 A;  2NXB A;  4NR6 A;  5FE1 A;  5HQ5 A;  3S92 A;  4QSU A;  5EWV A;  4QZS A;  5DW1 A;  5LJ1 A;  4NQN A;  2MJV B;  2YYN A;  2FSA A;  4C66 A;  5BT3 A;  4O78 A;  4HXO A;  5CUB A;  3U5J A;  2DWW A;  5I7X A;  3P1D A;  4O70 A;  4PCE A;  2RFJ A;  3UW9 A;  5A5O A;  5HCL A;  5F5Z A;  3P1E A;  4A9O A;  3UVD A;  3QZV A;  4NRA A;  5D3N A;  5FG4 A;  4UIT A;  4CUR A;  4LC2 A;  4MEP A;  4QST A;  5F36 A;  5CQ8 A;  5FB1 A;  5A83 A;  4TZ8 A;  3HMH A;  2R10 A;  5HFR A;  3SVF A;  4YAT A;  4J0S A;  4QUT A;  5C89 A;  4WHW A;  2DVV A;  4NXJ A;  3U5K A;  5AMF A;  5COI A;  5L8U A;  4YAD A;  5EQ1 A;  4UIU A;  4NRC A;  5FE4 A;  4TT4 A;  4WHU A;  5E3G A;  4CLB A;  5CQ5 A;  5CTL A;  5A5N A;  3LQH A;  2F6J A;  4IOQ A;  4Z1S A;  5D3H A;  4NYW A;  3MB4 A;  5FE2 A;  5EWC A;  2DKW A;  5ENJ A;  4CUQ A;  4O74 A;  3UV5 A;  5F2P A;  5A5Q A;  4OGJ A;  4IOO A;  5DKC A;  4Z6H A;  3G0L A;  5C85 A; 
#chains in the Genus database with same CATH topology
 5LKT A;  3IU5 A;  4NYV A;  5FFW A;  5FG6 A;  4A9I A;  4YYJ A;  2EJN A;  4NR9 A;  5FE6 A;  5E3D A;  3NXB A;  4Q0O A;  5L96 A;  2YW5 A;  4IR5 A;  5II1 A;  5H1V A;  4PY6 A;  5I88 A;  4TS8 A;  3AQA A;  4O75 A;  5I1Q A;  3RCW A;  3O37 A;  4QYL A;  2E3K A;  4YYH A;  5KHM A;  4QSW A;  5CPE A;  4UIY A;  4NYX A;  5CS8 A;  5CZG A;  4UYF A;  4CUS A;  4N4F A;  5TB6 A;  5D3T A;  5DW2 A;  3K2J A;  4YYD A;  5EWD A;  5E9M A;  5IGK A;  4NR5 A;  1PUO A;  5L98 A;  3QZT A;  5ENF A;  5L97 A;  4O7F A;  4O71 A;  5CRM A;  5H1U A;  4OGI A;  3MXF A;  4QEW A;  4YYI A;  3U5L A;  5F60 A;  3ERR A;  3DAI A;  4YBS A;  5CFW A;  4N4H A;  5HM0 A;  4QC3 A;  5E7D A;  4KV4 A;  2YDW A;  5ENG A;  5DYU A;  3I3J A;  4QSR A;  4TZ2 A;  5FE8 A;  4MEO A;  4UIV A;  3HME A;  4QR4 A;  2OSS A;  4HBW A;  5KTX A;  5F25 A;  3Q2E A;  2OUO A;  5EPR A;  4KCX A;  4LYW A;  3HMF A;  4CFL A;  4YAX A;  5FH8 A;  5LJ0 A;  4NS5 A;  5HQ7 A;  2KTB B;  4XY8 A;  4UIW A;  4FLP A;  1F68 A;  5D3R A;  5HLS A;  4IOR A;  4C67 A;  3UVX A;  5LVR A;  4Q0N A;  3QZS A;  2DAT A;  5TCM A;  2L85 A;  5L8T A;  4BW2 A;  5J0D A;  2LSP B;  5BT5 A;  4J3I A;  5FDZ A;  4YY6 A;  4CFK A;  2RS9 B;  5D24 A;  3D1B A;  4MR6 A;  5HEN A;  5C7N A;  5I89 A;  4N4G A;  5DYA A;  1ZKR A;  5I7Y A;  2I8N A;  4YK0 A;  5K29 A;  3O36 A;  5E9L A;  2GRC A;  4ZC9 A;  5DBM A;  4NRB A;  4GPJ A;  4NR8 A;  5F1H A;  5KTU A;  5A85 A;  4QNS A;  2R0Y A;  2L84 A;  4YBT A;  2RNX A;  4HXS A;  4IR6 A;  4A9N A;  5HEM A;  4A9L A;  2RI7 A;  5A7C A;  4LRG A;  2L5E A;  3LXJ A;  5FFV A;  3JVL A;  4PCI A;  4QR3 A;  4HXL A;  5CQT A;  5FE3 A;  5A5S A;  4IR4 A;  3DWY A;  4QYD A;  5DKH A;  4YH4 A;  3UVY A;  4LZ2 A;  4UYH A;  5A82 A;  5CQ4 A;  4O77 A;  4HBY A;  3P1F A;  4QSS A;  5HEL A;  5DLX A;  1JSP B;  4O7E A;  5I86 A;  5ENC A;  3O34 A;  4QC1 A;  5I80 A;  4HXR A;  5FB0 A;  4BW3 A;  2DVQ A;  2OO1 A;  5IBN A;  5IGL A;  5ETD A;  4NR7 A;  5DFC A;  4QEU A;  4HXM A;  5E74 A;  4CUT A;  2I7K A;  4Z93 A;  4O72 A;  4NR4 A;  4UYD A;  5F62 A;  3ONI A;  2N9G A;  4QB3 A;  5D3P A;  3UV4 A;  5EK9 A;  3MUK A;  5KO4 A;  4UYE A;  5EPS A;  5IG6 A;  5F3A A;  5DX4 A;  4HXK A;  5IID A;  5HQ6 A;  5CUD A;  4A9F A;  4YC9 A;  5A81 A;  2DVR A;  5DYX A;  5H1T A;  4QR5 A;  3MUL A;  3O35 A;  3U5P A;  1E6I A;  5D25 A;  5FE7 A;  5G4R A;  2YEK A;  4QY4 A;  5CUA A;  4DON A;  4O76 A;  5JI8 A;  5D3J A;  4ALH A;  4MR5 A;  5D3L A;  2RNW A;  5CP5 A;  5EA1 A;  3LQI A;  5HRV A;  1EQF A;  5E9V A;  5G4S A;  5CY9 A;  5KU3 A;  3FKM X;  4ALG A;  4XY9 A;  4MR3 A;  4BHW A;  1ZS5 A;  4YY4 A;  2D82 A;  5E73 A;  5II2 A;  5DFB A;  5EP7 A;  4PTB A;  5CQ7 A;  4BW4 A;  4QUU A;  5FH7 A;  4QSV A;  4ZQL A;  1N72 A;  2D9E A;  4XUA A;  5E0R A;  5LKU A;  1WUG A;  2YEL A;  5D3S A;  4NUD A;  5EIS A;  3P1C A;  4PS5 A;  2YQD A;  4J1P A;  4O7C A;  1X0J A;  4E96 A;  3UVW A;  5CRZ A;  5CQ3 A;  5HRW A;  4NQM A;  5IGM A;  5ETB A;  3LJW A;  4TQN A;  3ZYU A;  3TLP A;  5EU1 A;  4HXP A;  4A9J A;  5DYC A;  3D7C A;  4KV1 A;  5FE0 A;  5LJ2 A;  4LYS A;  4N3W A;  4XUB A;  5CU8 A;  4A9M A;  4A9E A;  4TYL A;  3IU6 A;  5ENI A;  5LVQ A;  4TT2 A;  5LUU A;  2RNY A;  3U5N A;  4CUP A;  5FH6 A;  4YH3 A;  4PKL A;  5H85 A;  4UIX A;  5AD2 A;  5EGU A;  5CUC A;  5FBX A;  2R0S A;  5DFD A;  2G4A A;  3MQM A;  5F61 A;  3MB3 A;  5DLZ A;  4LR6 A;  5FFY A;  5EM3 A;  3U5O A;  4YYN A;  5HRX A;  5JWM A;  2RO1 A;  4RVR A;  1WUM A;  5ENB A;  4MEN A;  2H60 A;  4TU6 A;  5A5R A;  5FE5 A;  3AAD A;  4N4I A;  4XYA A;  4TT6 A;  4YYK A;  3JVK A;  4AKG A;  2E7O A;  4MEQ A;  4LZR A;  4TTE A;  4BW1 A;  5EVA A;  4QEV A;  3G0J A;  5CUG A;  4HXN A;  3D1D A;  4CL9 A;  4LDF A;  4O7A A;  2WP1 A;  5F63 A;  4YBM A;  4UYG A;  4Z6I A;  4IR3 A;  4NUE A;  1JM4 B;  5A5P A;  4NUC A;  4A9K A;  4QSQ A;  5C87 A;  5FG5 A;  4CUU A;  5HFQ A;  5EIC A;  3U5M A;  2YEM A;  5AME A;  4YAB A;  5I83 A;  3VKG A;  5CUE A;  5DY7 A;  3JVM A;  5EV9 A;  4UYF B;  5D7X A;  3UV2 A;  3LQJ A;  4YYG A;  5E9I A;  5L99 A;  5I40 A;  3Q2F A;  4TU4 A;  3SVG A;  5ENH A;  3O33 A;  4LYI A;  5EWH A;  4A9H A;  2R0V A;  5EPB A;  5HJC A;  5CGP A;  3GG3 A;  5ACY A;  4WIV A;  5I29 A;  3S91 A;  5D0C A;  4AI6 A;  4ZW1 A;  5FE9 A;  5IGN A;  5AD3 A;  4AKN A;  3P5O A;  4QBM A;  5BT4 A;  5C4Q A;  4MR4 A;  5LKX A;  2WP2 A;  5D26 A;  4HBV A;  4UIZ A;  5LKZ A;  4X2I A;  5ENE A;  4OUF A;  4QSX A;  4Y03 A;  5DKD A;  4HBX A;  5E9K A;  3SVH A;  4LZS A;  4BJX A;  4O7B A;  3JVJ A;  4J0R A;  5EWW A;  4F3I A;  5CQA A;  5C8G A;  2DVS A;  2F6N A;  4Z1Q A;  2E7N A;  5EI4 A;  5F1L A;  5KTW A;  4QSP A;  5E9Y A;  4YYM A;  5CQ6 A;  2NXB A;  4NR6 A;  5FE1 A;  5HQ5 A;  3S92 A;  4QSU A;  5EWV A;  4QZS A;  5DW1 A;  5LJ1 A;  4NQN A;  2MJV B;  2YYN A;  2FSA A;  4C66 A;  5BT3 A;  4O78 A;  4HXO A;  5CUB A;  3U5J A;  2DWW A;  5I7X A;  3P1D A;  4O70 A;  4PCE A;  2RFJ A;  3UW9 A;  5A5O A;  5HCL A;  5F5Z A;  3P1E A;  4A9O A;  3UVD A;  3QZV A;  4NRA A;  5D3N A;  5FG4 A;  4UIT A;  4CUR A;  4LC2 A;  4MEP A;  4QST A;  5F36 A;  5CQ8 A;  5FB1 A;  5A83 A;  4TZ8 A;  3HMH A;  2R10 A;  5HFR A;  3SVF A;  4YAT A;  4J0S A;  4QUT A;  5C89 A;  4WHW A;  2DVV A;  4NXJ A;  3U5K A;  5AMF A;  5COI A;  5L8U A;  4YAD A;  5EQ1 A;  4UIU A;  4NRC A;  5FE4 A;  3VKH A;  4TT4 A;  4WHU A;  5E3G A;  4CLB A;  5CQ5 A;  5CTL A;  5A5N A;  3LQH A;  2F6J A;  4IOQ A;  4Z1S A;  4AKH A;  5D3H A;  4NYW A;  3MB4 A;  5FE2 A;  5EWC A;  2DKW A;  5ENJ A;  4CUQ A;  4O74 A;  3UV5 A;  5F2P A;  5A5Q A;  4OGJ A;  4IOO A;  5DKC A;  4Z6H A;  3G0L A;  4AKI A;  5C85 A; 
#chains in the Genus database with same CATH homology
 5LKT A;  3IU5 A;  4NYV A;  5FFW A;  5FG6 A;  4A9I A;  4YYJ A;  4NR9 A;  5FE6 A;  5E3D A;  3NXB A;  4Q0O A;  5L96 A;  2YW5 A;  4IR5 A;  5II1 A;  5H1V A;  4PY6 A;  5I88 A;  4TS8 A;  3AQA A;  4O75 A;  5I1Q A;  3RCW A;  3O37 A;  4QYL A;  2E3K A;  4YYH A;  5KHM A;  4QSW A;  5CPE A;  4UIY A;  4NYX A;  5CS8 A;  5CZG A;  4UYF A;  4CUS A;  4N4F A;  5TB6 A;  5D3T A;  5DW2 A;  3K2J A;  4YYD A;  5EWD A;  5E9M A;  5IGK A;  4NR5 A;  5L98 A;  3QZT A;  5ENF A;  5L97 A;  4O7F A;  4O71 A;  5CRM A;  5H1U A;  4OGI A;  3MXF A;  4QEW A;  4YYI A;  3U5L A;  5F60 A;  3DAI A;  4YBS A;  5CFW A;  4N4H A;  5HM0 A;  4QC3 A;  5E7D A;  4KV4 A;  2YDW A;  5ENG A;  5DYU A;  3I3J A;  4QSR A;  4TZ2 A;  5FE8 A;  4MEO A;  4UIV A;  3HME A;  4QR4 A;  2OSS A;  4HBW A;  5KTX A;  5F25 A;  3Q2E A;  2OUO A;  5EPR A;  4KCX A;  4LYW A;  3HMF A;  4CFL A;  4YAX A;  5FH8 A;  5LJ0 A;  4NS5 A;  5HQ7 A;  2KTB B;  4XY8 A;  4UIW A;  4FLP A;  1F68 A;  5D3R A;  5HLS A;  4IOR A;  4C67 A;  3UVX A;  5LVR A;  4Q0N A;  3QZS A;  2DAT A;  5TCM A;  2L85 A;  5L8T A;  4BW2 A;  5J0D A;  2LSP B;  5BT5 A;  4J3I A;  5FDZ A;  4YY6 A;  4CFK A;  2RS9 B;  5D24 A;  4MR6 A;  5HEN A;  5C7N A;  5I89 A;  4N4G A;  5DYA A;  5I7Y A;  2I8N A;  4YK0 A;  5K29 A;  3O36 A;  5E9L A;  2GRC A;  4ZC9 A;  5DBM A;  4NRB A;  4GPJ A;  4NR8 A;  5F1H A;  5KTU A;  5A85 A;  4QNS A;  2R0Y A;  2L84 A;  4YBT A;  2RNX A;  4HXS A;  4IR6 A;  4A9N A;  5HEM A;  4A9L A;  2RI7 A;  5A7C A;  4LRG A;  2L5E A;  3LXJ A;  5FFV A;  3JVL A;  4PCI A;  4QR3 A;  4HXL A;  5CQT A;  5FE3 A;  5A5S A;  4IR4 A;  3DWY A;  4QYD A;  5DKH A;  4YH4 A;  3UVY A;  4LZ2 A;  4UYH A;  5A82 A;  5CQ4 A;  4O77 A;  4HBY A;  3P1F A;  4QSS A;  5HEL A;  5DLX A;  1JSP B;  4O7E A;  5I86 A;  5ENC A;  3O34 A;  4QC1 A;  5I80 A;  4HXR A;  5FB0 A;  4BW3 A;  2DVQ A;  2OO1 A;  5IBN A;  5IGL A;  5ETD A;  4NR7 A;  5DFC A;  4QEU A;  4HXM A;  5E74 A;  4CUT A;  2I7K A;  4Z93 A;  4O72 A;  4NR4 A;  4UYD A;  5F62 A;  3ONI A;  2N9G A;  4QB3 A;  5D3P A;  3UV4 A;  5EK9 A;  3MUK A;  5KO4 A;  4UYE A;  5EPS A;  5IG6 A;  5F3A A;  5DX4 A;  4HXK A;  5IID A;  5HQ6 A;  5CUD A;  4A9F A;  4YC9 A;  5A81 A;  2DVR A;  5DYX A;  5H1T A;  4QR5 A;  3MUL A;  3O35 A;  3U5P A;  1E6I A;  5D25 A;  5FE7 A;  5G4R A;  2YEK A;  4QY4 A;  5CUA A;  4DON A;  4O76 A;  5JI8 A;  5D3J A;  4ALH A;  4MR5 A;  5D3L A;  2RNW A;  5CP5 A;  5EA1 A;  3LQI A;  5HRV A;  1EQF A;  5E9V A;  5G4S A;  5CY9 A;  5KU3 A;  3FKM X;  4ALG A;  4XY9 A;  4MR3 A;  4BHW A;  1ZS5 A;  4YY4 A;  2D82 A;  5E73 A;  5II2 A;  5DFB A;  5EP7 A;  4PTB A;  5CQ7 A;  4BW4 A;  4QUU A;  5FH7 A;  4QSV A;  4ZQL A;  1N72 A;  2D9E A;  4XUA A;  5E0R A;  5LKU A;  1WUG A;  2YEL A;  5D3S A;  4NUD A;  5EIS A;  3P1C A;  4PS5 A;  2YQD A;  4J1P A;  4O7C A;  1X0J A;  4E96 A;  3UVW A;  5CRZ A;  5CQ3 A;  5HRW A;  4NQM A;  5IGM A;  5ETB A;  3LJW A;  4TQN A;  3ZYU A;  3TLP A;  5EU1 A;  4HXP A;  4A9J A;  5DYC A;  3D7C A;  4KV1 A;  5FE0 A;  5LJ2 A;  4LYS A;  4N3W A;  4XUB A;  5CU8 A;  4A9M A;  4A9E A;  4TYL A;  3IU6 A;  5ENI A;  5LVQ A;  4TT2 A;  5LUU A;  2RNY A;  3U5N A;  4CUP A;  5FH6 A;  4YH3 A;  4PKL A;  5H85 A;  4UIX A;  5AD2 A;  5EGU A;  5CUC A;  5FBX A;  2R0S A;  5DFD A;  2G4A A;  3MQM A;  5F61 A;  3MB3 A;  5DLZ A;  4LR6 A;  5FFY A;  5EM3 A;  3U5O A;  4YYN A;  5HRX A;  5JWM A;  2RO1 A;  4RVR A;  1WUM A;  5ENB A;  4MEN A;  2H60 A;  4TU6 A;  5A5R A;  5FE5 A;  3AAD A;  4N4I A;  4XYA A;  4TT6 A;  4YYK A;  3JVK A;  2E7O A;  4MEQ A;  4LZR A;  4TTE A;  4BW1 A;  5EVA A;  4QEV A;  3G0J A;  5CUG A;  4HXN A;  4CL9 A;  4LDF A;  4O7A A;  2WP1 A;  5F63 A;  4YBM A;  4UYG A;  4Z6I A;  4IR3 A;  4NUE A;  1JM4 B;  5A5P A;  4NUC A;  4A9K A;  4QSQ A;  5C87 A;  5FG5 A;  4CUU A;  5HFQ A;  5EIC A;  3U5M A;  2YEM A;  5AME A;  4YAB A;  5I83 A;  5CUE A;  5DY7 A;  3JVM A;  5EV9 A;  4UYF B;  5D7X A;  3UV2 A;  3LQJ A;  4YYG A;  5E9I A;  5L99 A;  5I40 A;  3Q2F A;  4TU4 A;  3SVG A;  5ENH A;  3O33 A;  4LYI A;  5EWH A;  4A9H A;  2R0V A;  5EPB A;  5HJC A;  5CGP A;  3GG3 A;  5ACY A;  4WIV A;  5I29 A;  3S91 A;  5D0C A;  4ZW1 A;  5FE9 A;  5IGN A;  5AD3 A;  4AKN A;  3P5O A;  4QBM A;  5BT4 A;  5C4Q A;  4MR4 A;  5LKX A;  2WP2 A;  5D26 A;  4HBV A;  4UIZ A;  5LKZ A;  4X2I A;  5ENE A;  4OUF A;  4QSX A;  4Y03 A;  5DKD A;  4HBX A;  5E9K A;  3SVH A;  4LZS A;  4BJX A;  4O7B A;  3JVJ A;  4J0R A;  5EWW A;  4F3I A;  5CQA A;  5C8G A;  2DVS A;  2F6N A;  4Z1Q A;  2E7N A;  5EI4 A;  5F1L A;  5KTW A;  4QSP A;  5E9Y A;  4YYM A;  5CQ6 A;  2NXB A;  4NR6 A;  5FE1 A;  5HQ5 A;  3S92 A;  4QSU A;  5EWV A;  4QZS A;  5DW1 A;  5LJ1 A;  4NQN A;  2MJV B;  2YYN A;  2FSA A;  4C66 A;  5BT3 A;  4O78 A;  4HXO A;  5CUB A;  3U5J A;  2DWW A;  5I7X A;  3P1D A;  4O70 A;  4PCE A;  2RFJ A;  3UW9 A;  5A5O A;  5HCL A;  5F5Z A;  3P1E A;  4A9O A;  3UVD A;  3QZV A;  4NRA A;  5D3N A;  5FG4 A;  4UIT A;  4CUR A;  4LC2 A;  4MEP A;  4QST A;  5F36 A;  5CQ8 A;  5FB1 A;  5A83 A;  4TZ8 A;  3HMH A;  2R10 A;  5HFR A;  3SVF A;  4YAT A;  4J0S A;  4QUT A;  5C89 A;  4WHW A;  2DVV A;  4NXJ A;  3U5K A;  5AMF A;  5COI A;  5L8U A;  4YAD A;  5EQ1 A;  4UIU A;  4NRC A;  5FE4 A;  4TT4 A;  4WHU A;  5E3G A;  4CLB A;  5CQ5 A;  5CTL A;  5A5N A;  3LQH A;  2F6J A;  4IOQ A;  4Z1S A;  5D3H A;  4NYW A;  3MB4 A;  5FE2 A;  5EWC A;  2DKW A;  5ENJ A;  4CUQ A;  4O74 A;  3UV5 A;  5F2P A;  5A5Q A;  4OGJ A;  4IOO A;  5DKC A;  4Z6H A;  3G0L A;  5C85 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...