3P1DA

Crystal structure of the bromodomain of human crebbp in complex with n-methyl-2-pyrrolidone (nmp)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
115
structure length
115
Chain Sequence
KIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CREB-binding protein
publication title Histone recognition and large-scale structural analysis of the human bromodomain family.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 40
structure length 115
sequence length 115
chains with identical sequence B
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2010-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3p1dA00
4O77A 2MJVB 5CQ8A 5FE1A 4ALHA 4NRBA 2OSSA 4IR5A 5DYXA 5KTXA 5I29A 4TT4A 5CP5A 5D24A 4C67A 5FE2A 4NR6A 5E9LA 4O7CA 4LZSA 5DKHA 5E74A 5KTWA 5CTLA 5F1LA 3O33A 4QUTA 4LR6A 4MR4A 4QZSA 4TYLA 3S91A 3MB3A 4UIVA 5F25A 3FKMX 5A5PA 3LXJA 5CQAA 4YY4A 5HELA 5FDZA 5I1QA 3RCWA 5A82A 5C4QA 3LQIA 4NRCA 4F3IA 4QSUA 1ZS5A 2F6NA 4A9MA 2YEKA 5ETBA 3SVFA 5CQ3A 5TCMA 5E9MA 1EQFA 5ENEA 5LJ0A 4HXKA 5CU8A 5D3JA 5ENGA 2RFJA 5IBNA 5BT4A 4QSSA 2LSPB 5F3AA 5FBXA 5FE6A 4A9HA 5H1TA 5CY9A 5LVQA 5FH7A 4BJXA 5CS8A 5I80A 5CRZA 3P1FA 3Q2EA 5DW2A 5E9VA 2RS9B 5LJ1A 4O75A 4QUUA 4BW2A 5FH6A 2DKWA 3LQJA 4MEOA 5I40A 4O70A 5CUEA 4Q0NA 5A5OA 5C85A 3G0LA 4MEPA 4QEVA 4YYNA 3UV2A 2DVVA 4NR8A 4XUAA 2GRCA 3P5OA 5EWWA 3O34A 5EU1A 2RNXA 4X2IA 4OGJA 4LC2A 4IORA 3K2JA 5EWCA 4UYFA 5II2A 4YYDA 5EQ1A 4MR6A 1N72A 4LDFA 5HEMA 4CLBA 3P1EA 3P1DA 1E6IA 4HBYA 2N9GA 4NUEA 5CQTA 5ENBA 5CUGA 4CUTA 1X0JA 4NQMA 4QBMA 5KU3A 4LZRA 3UV4A 4YYJA 5KHMA 5DFCA 4UYFB 5KO4A 5EA1A 4NR4A 4XUBA 5ACYA 5EP7A 4OGIA 3U5OA 5L97A 4O71A 4O7FA 3MB4A 3UW9A 1JM4B 5JWMA 3MULA 5I7YA 3AQAA 4HXMA 2R10A 4N4IA 5CQ6A 5EWDA 3U5KA 4BW1A 2H60A 5CQ7A 4O74A 3SVHA 5A5QA 2E7OA 5D3LA 4CUUA 4BW3A 3HMEA 5FFYA 4PTBA 4QR5A 5D3PA 4WHUA 5AMEA 2OUOA 5DFBA 2YDWA 3UV5A 4UIWA 5CUDA 5D7XA 4UYGA 4UYEA 2DVRA 5DYCA 2L85A 3P1CA 4QSXA 4TU4A 3QZVA 5CRMA 5IGNA 3JVMA 5AD3A 5AMFA 4CUSA 4QSQA 5EPSA 5HQ7A 2YW5A 3QZSA 5D3RA 4A9KA 4KV4A 5DKCA 5HFQA 5HENA 4NYWA 3NXBA 2DWWA 4GPJA 4QYDA 4NYVA 5BT5A 5HRVA 5DBMA 2L84A 4A9JA 4MENA 4TZ8A 4ZW1A 4LYSA 5D25A 4MEQA 4NYXA 5COIA 2DVQA 5BT3A 5LKTA 5CQ5A 4A9FA 3HMFA 4TTEA 4A9OA 2L5EA 2R0SA 3IU5A 4Z6IA 5F5ZA 3IU6A 3JVJA 2RI7A 5HQ5A 4QSPA 4MR5A 5DYAA 4QSTA 2G4AA 4NS5A 4UIXA 5J0DA 4WIVA 4QB3A 4XY8A 5CFWA 5A5SA 4J0RA 5DKDA 5C89A 5G4RA 3UVYA 5FE8A 5EGUA 5F36A 5E9YA 3UVDA 4YK0A 4YBMA 4Z6HA 4HBVA 5DY7A 5DYUA 4CFLA 5A81A 3TLPA 5LVRA 4LZ2A 4UIYA 4YYMA 5TB6A 5CGPA 5ENJA 4KV1A 4UIZA 4DONA 4N4FA 4PY6A 4NXJA 2R0YA 3O36A 4FLPA 4YAXA 5F61A 4CL9A 4QSRA 2NXBA 5EISA 5FFWA 5E9KA 5H1UA 5II1A 5HCLA 5E3GA 5FG4A 4YBSA 4ZC9A 5A7CA 5DLXA 4Z93A 4O78A 5LKXA 5E73A 5F2PA 2WP2A 4CUPA 2I8NA 5D0CA 4XYAA 5FFVA 4QR3A 5JI8A 2I7KA 5H85A 4A9LA 5E7DA 5IG6A 2YEMA 5FG6A 4YH3A 1F68A 4HBXA 4YYGA 3UVWA 4E96A 4Z1QA 4YYKA 3LJWA 3AADA 4ALGA 4J3IA 4O7BA 5L98A 4HBWA 5LKUA 2D9EA 4C66A 2KTBB 4HXNA 5DX4A 4LRGA 4NUCA 5I89A 4BW4A 4J1PA 5ETDA 4QR4A 4Y03A 4QNSA 5L99A 3Q2FA 2E7NA 4IOQA 3MXFA 4QY4A 5EWVA 3D7CA 5F62A 4YYHA 3I3JA 1JSPB 4CFKA 5A83A 2E3KA 5EPBA 4KCXA 4LYWA 3O37A 2RO1A 4WHWA 1WUMA 5CUBA 2D82A 4TT6A 3ZYUA 5A5RA 5FE3A 5FH8A 4Z1SA 5FG5A 1WUGA 5CQ4A 5EVAA 4YABA 4A9IA 5F1HA 4NQNA 5CUCA 5DLZA 4QC3A 4HXLA 4AKNA 4MR3A 5IGMA 4BHWA 3S92A 4O76A 2WP1A 4QEUA 5H1VA 5IGLA 5ENCA 3U5MA 5CPEA 4OUFA 5I7XA 5D3HA 4IOOA 2DATA 4HXSA 5L8UA 4HXOA 4LYIA 4NR7A 5ENFA 4NR9A 4N4HA 5I86A 5FE7A 4UIUA 4QSVA 5G4SA 5C7NA 3U5NA 5CZGA 5FE5A 4YY6A 2YQDA 4YATA 4PKLA 4PS5A 3DAIA 3JVKA 4N4GA 4UYHA 3QZTA 4QC1A 3UVXA 4PCEA 4TS8A 4IR4A 3G0JA 4QEWA 4IR3A 5A85A 3U5PA 4TU6A 5HFRA 4YBTA 2RNWA 4O7EA 3LQHA 4YYIA 5LUUA 5EWHA 5E3DA 3U5JA 4HXPA 3SVGA 3O35A 4A9EA 4TT2A 5A5NA 5HRXA 5IGKA 4A9NA 5I83A 3HMHA 5D3TA 4NUDA 4QSWA 5F63A 5HJCA 4XY9A 3MQMA 5KTUA 2YYNA 5K29A 4YC9A 5DW1A 4Q0OA 4N3WA 5E0RA 2F6JA 4J0SA 4HXRA 3MUKA 5DFDA 3GG3A 4O72A 2RNYA 5FB1A 3JVLA 5ENIA 5HQ6A 3DWYA 4CUQA 5EK9A 2YELA 5C87A 4UYDA 4TZ2A 5EI4A 4YH4A 5ENHA 3U5LA 2FSAA 4UITA 2R0VA 5IIDA 4TQNA 5EICA 4CURA 4YADA 4O7AA 5F60A 5HLSA 3ONIA 5E9IA 5LKZA 4NR5A 5I88A 5EV9A 2DVSA 5D3NA 5FE0A 5CUAA 5FE9A 4PCIA 5FB0A 5HM0A 5LJ2A 5FE4A 5L8TA 4IR6A 5AD2A 5C8GA 4ZQLA 5D26A 2OO1A 4RVRA 5D3SA 5EPRA 5L96A 5HRWA 4QYLA 5EM3A 4NRAA
chains in the Genus database with same CATH superfamily
4O77A 2MJVB 5CQ8A 4AI6A 5FE1A 4ALHA 4AKHA 4NRBA 2OSSA 4IR5A 5DYXA 5KTXA 5I29A 4TT4A 5CP5A 5D24A 4C67A 5FE2A 4NR6A 5E9LA 4O7CA 4LZSA 5DKHA 5E74A 5KTWA 5CTLA 5F1LA 4AKGA 3O33A 4QUTA 4LR6A 4MR4A 4QZSA 4TYLA 3S91A 3MB3A 4UIVA 5F25A 3FKMX 5A5PA 3LXJA 5CQAA 4YY4A 5HELA 5FDZA 5I1QA 3RCWA 5A82A 5C4QA 3LQIA 4NRCA 4F3IA 4QSUA 1ZS5A 2F6NA 4A9MA 2YEKA 5ETBA 3SVFA 5CQ3A 5TCMA 5E9MA 1EQFA 5ENEA 5LJ0A 4HXKA 5CU8A 5D3JA 5ENGA 2RFJA 5IBNA 5BT4A 4QSSA 2LSPB 5F3AA 5FBXA 5FE6A 4A9HA 5H1TA 5CY9A 5LVQA 5FH7A 4BJXA 5CS8A 5I80A 5CRZA 3P1FA 3Q2EA 5DW2A 5E9VA 2RS9B 5LJ1A 4O75A 4QUUA 4BW2A 5FH6A 2DKWA 3LQJA 4MEOA 5I40A 4O70A 5CUEA 4Q0NA 5A5OA 5C85A 3G0LA 4MEPA 4QEVA 4YYNA 3UV2A 2DVVA 4NR8A 4XUAA 2GRCA 3P5OA 5EWWA 3O34A 5EU1A 2RNXA 4X2IA 3VKHA 4OGJA 4LC2A 4IORA 3K2JA 5EWCA 4AKIA 4UYFA 5II2A 4YYDA 5EQ1A 4MR6A 1N72A 4LDFA 5HEMA 4CLBA 3P1EA 3P1DA 1E6IA 4HBYA 2N9GA 4NUEA 5CQTA 5ENBA 5CUGA 4CUTA 1X0JA 4NQMA 4QBMA 5KU3A 4LZRA 3UV4A 4YYJA 5KHMA 5DFCA 4UYFB 5KO4A 5EA1A 4NR4A 4XUBA 5ACYA 5EP7A 4OGIA 3U5OA 5L97A 4O71A 4O7FA 3MB4A 3UW9A 1JM4B 5JWMA 3MULA 5I7YA 3AQAA 4HXMA 2R10A 4N4IA 5CQ6A 5EWDA 3U5KA 4BW1A 2H60A 5CQ7A 4O74A 3SVHA 5A5QA 2E7OA 5D3LA 4CUUA 4BW3A 3HMEA 5FFYA 4PTBA 4QR5A 5D3PA 4WHUA 5AMEA 2OUOA 5DFBA 2YDWA 3UV5A 1PUOA 4UIWA 5CUDA 5D7XA 4UYGA 4UYEA 2DVRA 5DYCA 2L85A 3P1CA 4QSXA 4TU4A 3QZVA 5CRMA 5IGNA 3JVMA 5AD3A 5AMFA 4CUSA 4QSQA 5EPSA 5HQ7A 2YW5A 3QZSA 5D3RA 4A9KA 4KV4A 5DKCA 3D1DA 5HFQA 5HENA 4NYWA 3NXBA 2DWWA 4GPJA 4QYDA 4NYVA 5BT5A 5HRVA 5DBMA 2L84A 4A9JA 4MENA 4TZ8A 4ZW1A 4LYSA 5D25A 4MEQA 4NYXA 5COIA 2DVQA 5BT3A 5LKTA 5CQ5A 4A9FA 3HMFA 4TTEA 4A9OA 2L5EA 2R0SA 3IU5A 4Z6IA 5F5ZA 3IU6A 3JVJA 2RI7A 5HQ5A 4QSPA 4MR5A 5DYAA 4QSTA 2G4AA 4NS5A 4UIXA 5J0DA 4WIVA 4QB3A 4XY8A 5CFWA 5A5SA 4J0RA 5DKDA 5C89A 5G4RA 3UVYA 5FE8A 5EGUA 5F36A 5E9YA 3UVDA 4YK0A 4YBMA 4Z6HA 4HBVA 5DY7A 5DYUA 4CFLA 5A81A 3TLPA 5LVRA 4LZ2A 4UIYA 4YYMA 5TB6A 5CGPA 5ENJA 4KV1A 4UIZA 4DONA 4N4FA 4PY6A 4NXJA 2R0YA 3O36A 4FLPA 4YAXA 5F61A 4CL9A 4QSRA 2NXBA 5EISA 5FFWA 5E9KA 5H1UA 5II1A 5HCLA 5E3GA 5FG4A 4YBSA 4ZC9A 5A7CA 5DLXA 4Z93A 4O78A 5LKXA 5E73A 5F2PA 2WP2A 4CUPA 2I8NA 5D0CA 4XYAA 5FFVA 4QR3A 5JI8A 2I7KA 5H85A 4A9LA 5E7DA 5IG6A 2YEMA 5FG6A 4YH3A 1F68A 4HBXA 4YYGA 3UVWA 4E96A 4Z1QA 4YYKA 3LJWA 3AADA 4ALGA 4J3IA 4O7BA 5L98A 4HBWA 5LKUA 2D9EA 4C66A 2KTBB 4HXNA 5DX4A 4LRGA 4NUCA 5I89A 4BW4A 4J1PA 5ETDA 2EJNA 4QR4A 4Y03A 4QNSA 5L99A 3Q2FA 2E7NA 4IOQA 3ERRA 3MXFA 4QY4A 5EWVA 3D7CA 5F62A 4YYHA 3I3JA 1JSPB 4CFKA 5A83A 2E3KA 5EPBA 4KCXA 4LYWA 3O37A 2RO1A 4WHWA 1WUMA 5CUBA 2D82A 4TT6A 1ZKRA 3ZYUA 5A5RA 5FE3A 5FH8A 4Z1SA 5FG5A 1WUGA 5CQ4A 5EVAA 4YABA 4A9IA 5F1HA 4NQNA 5CUCA 5DLZA 3D1BA 4QC3A 4HXLA 4AKNA 4MR3A 5IGMA 4BHWA 3S92A 4O76A 2WP1A 4QEUA 5H1VA 5IGLA 5ENCA 3U5MA 5CPEA 4OUFA 5I7XA 5D3HA 4IOOA 2DATA 4HXSA 5L8UA 4HXOA 4LYIA 4NR7A 5ENFA 4NR9A 4N4HA 5I86A 5FE7A 4UIUA 4QSVA 5G4SA 5C7NA 3U5NA 5CZGA 5FE5A 4YY6A 2YQDA 4YATA 4PKLA 4PS5A 3DAIA 3JVKA 4N4GA 4UYHA 3QZTA 4QC1A 3UVXA 4PCEA 4TS8A 4IR4A 3G0JA 4QEWA 4IR3A 5A85A 3U5PA 4TU6A 5HFRA 4YBTA 2RNWA 4O7EA 3LQHA 4YYIA 5LUUA 5EWHA 5E3DA 3U5JA 4HXPA 3SVGA 3O35A 4A9EA 4TT2A 5A5NA 3VKGA 5HRXA 5IGKA 4A9NA 5I83A 3HMHA 5D3TA 4NUDA 4QSWA 5F63A 5HJCA 4XY9A 3MQMA 5KTUA 2YYNA 5K29A 4YC9A 5DW1A 4Q0OA 4N3WA 5E0RA 2F6JA 4J0SA 4HXRA 3MUKA 5DFDA 3GG3A 4O72A 2RNYA 5FB1A 3JVLA 5ENIA 5HQ6A 3DWYA 4CUQA 5EK9A 2YELA 5C87A 4UYDA 4TZ2A 5EI4A 4YH4A 5ENHA 3U5LA 2FSAA 4UITA 2R0VA 5IIDA 4TQNA 5EICA 4CURA 4YADA 4O7AA 5F60A 5HLSA 3ONIA 5E9IA 5LKZA 4NR5A 5I88A 5EV9A 2DVSA 5D3NA 5FE0A 5CUAA 5FE9A 4PCIA 5FB0A 5HM0A 5LJ2A 5FE4A 5L8TA 4IR6A 5AD2A 5C8GA 4ZQLA 5D26A 2OO1A 4RVRA 5D3SA 5EPRA 5L96A 5HRWA 4QYLA 5EM3A 4NRAA
chains in the Genus database with same CATH topology
4O77A 2MJVB 5CQ8A 5FE1A 4ALHA 4NRBA 2OSSA 4IR5A 5DYXA 5KTXA 5I29A 4TT4A 5CP5A 5D24A 4C67A 5FE2A 4NR6A 5E9LA 4O7CA 4LZSA 5DKHA 5E74A 5KTWA 5CTLA 5F1LA 3O33A 4QUTA 4LR6A 4MR4A 4QZSA 4TYLA 3S91A 3MB3A 4UIVA 5F25A 3FKMX 5A5PA 3LXJA 5CQAA 4YY4A 5HELA 5FDZA 5I1QA 3RCWA 5A82A 5C4QA 3LQIA 4NRCA 4F3IA 4QSUA 1ZS5A 2F6NA 4A9MA 2YEKA 5ETBA 3SVFA 5CQ3A 5TCMA 5E9MA 1EQFA 5ENEA 5LJ0A 4HXKA 5CU8A 5D3JA 5ENGA 2RFJA 5IBNA 5BT4A 4QSSA 2LSPB 5F3AA 5FBXA 5FE6A 4A9HA 5H1TA 5CY9A 5LVQA 5FH7A 4BJXA 5CS8A 5I80A 5CRZA 3P1FA 3Q2EA 5DW2A 5E9VA 2RS9B 5LJ1A 4O75A 4QUUA 4BW2A 5FH6A 2DKWA 3LQJA 4MEOA 5I40A 4O70A 5CUEA 4Q0NA 5A5OA 5C85A 3G0LA 4MEPA 4QEVA 4YYNA 3UV2A 2DVVA 4NR8A 4XUAA 2GRCA 3P5OA 5EWWA 3O34A 5EU1A 2RNXA 4X2IA 4OGJA 4LC2A 4IORA 3K2JA 5EWCA 4UYFA 5II2A 4YYDA 5EQ1A 4MR6A 1N72A 4LDFA 5HEMA 4CLBA 3P1EA 3P1DA 1E6IA 4HBYA 2N9GA 4NUEA 5CQTA 5ENBA 5CUGA 4CUTA 1X0JA 4NQMA 4QBMA 5KU3A 4LZRA 3UV4A 4YYJA 5KHMA 5DFCA 4UYFB 5KO4A 5EA1A 4NR4A 4XUBA 5ACYA 5EP7A 4OGIA 3U5OA 5L97A 4O71A 4O7FA 3MB4A 3UW9A 1JM4B 5JWMA 3MULA 5I7YA 3AQAA 4HXMA 2R10A 4N4IA 5CQ6A 5EWDA 3U5KA 4BW1A 2H60A 5CQ7A 4O74A 3SVHA 5A5QA 2E7OA 5D3LA 4CUUA 4BW3A 3HMEA 5FFYA 4PTBA 4QR5A 5D3PA 4WHUA 5AMEA 2OUOA 5DFBA 2YDWA 3UV5A 4UIWA 5CUDA 5D7XA 4UYGA 4UYEA 2DVRA 5DYCA 2L85A 3P1CA 4QSXA 4TU4A 3QZVA 5CRMA 5IGNA 3JVMA 5AD3A 5AMFA 4CUSA 4QSQA 5EPSA 5HQ7A 2YW5A 3QZSA 5D3RA 4A9KA 4KV4A 5DKCA 5HFQA 5HENA 4NYWA 3NXBA 2DWWA 4GPJA 4QYDA 4NYVA 5BT5A 5HRVA 5DBMA 2L84A 4A9JA 4MENA 4TZ8A 4ZW1A 4LYSA 5D25A 4MEQA 4NYXA 5COIA 2DVQA 5BT3A 5LKTA 5CQ5A 4A9FA 3HMFA 4TTEA 4A9OA 2L5EA 2R0SA 3IU5A 4Z6IA 5F5ZA 3IU6A 3JVJA 2RI7A 5HQ5A 4QSPA 4MR5A 5DYAA 4QSTA 2G4AA 4NS5A 4UIXA 5J0DA 4WIVA 4QB3A 4XY8A 5CFWA 5A5SA 4J0RA 5DKDA 5C89A 5G4RA 3UVYA 5FE8A 5EGUA 5F36A 5E9YA 3UVDA 4YK0A 4YBMA 4Z6HA 4HBVA 5DY7A 5DYUA 4CFLA 5A81A 3TLPA 5LVRA 4LZ2A 4UIYA 4YYMA 5TB6A 5CGPA 5ENJA 4KV1A 4UIZA 4DONA 4N4FA 4PY6A 4NXJA 2R0YA 3O36A 4FLPA 4YAXA 5F61A 4CL9A 4QSRA 2NXBA 5EISA 5FFWA 5E9KA 5H1UA 5II1A 5HCLA 5E3GA 5FG4A 4YBSA 4ZC9A 5A7CA 5DLXA 4Z93A 4O78A 5LKXA 5E73A 5F2PA 2WP2A 4CUPA 2I8NA 5D0CA 4XYAA 5FFVA 4QR3A 5JI8A 2I7KA 5H85A 4A9LA 5E7DA 5IG6A 2YEMA 5FG6A 4YH3A 1F68A 4HBXA 4YYGA 3UVWA 4E96A 4Z1QA 4YYKA 3LJWA 3AADA 4ALGA 4J3IA 4O7BA 5L98A 4HBWA 5LKUA 2D9EA 4C66A 2KTBB 4HXNA 5DX4A 4LRGA 4NUCA 5I89A 4BW4A 4J1PA 5ETDA 4QR4A 4Y03A 4QNSA 5L99A 3Q2FA 2E7NA 4IOQA 3MXFA 4QY4A 5EWVA 3D7CA 5F62A 4YYHA 3I3JA 1JSPB 4CFKA 5A83A 2E3KA 5EPBA 4KCXA 4LYWA 3O37A 2RO1A 4WHWA 1WUMA 5CUBA 2D82A 4TT6A 3ZYUA 5A5RA 5FE3A 5FH8A 4Z1SA 5FG5A 1WUGA 5CQ4A 5EVAA 4YABA 4A9IA 5F1HA 4NQNA 5CUCA 5DLZA 4QC3A 4HXLA 4AKNA 4MR3A 5IGMA 4BHWA 3S92A 4O76A 2WP1A 4QEUA 5H1VA 5IGLA 5ENCA 3U5MA 5CPEA 4OUFA 5I7XA 5D3HA 4IOOA 2DATA 4HXSA 5L8UA 4HXOA 4LYIA 4NR7A 5ENFA 4NR9A 4N4HA 5I86A 5FE7A 4UIUA 4QSVA 5G4SA 5C7NA 3U5NA 5CZGA 5FE5A 4YY6A 2YQDA 4YATA 4PKLA 4PS5A 3DAIA 3JVKA 4N4GA 4UYHA 3QZTA 4QC1A 3UVXA 4PCEA 4TS8A 4IR4A 3G0JA 4QEWA 4IR3A 5A85A 3U5PA 4TU6A 5HFRA 4YBTA 2RNWA 4O7EA 3LQHA 4YYIA 5LUUA 5EWHA 5E3DA 3U5JA 4HXPA 3SVGA 3O35A 4A9EA 4TT2A 5A5NA 5HRXA 5IGKA 4A9NA 5I83A 3HMHA 5D3TA 4NUDA 4QSWA 5F63A 5HJCA 4XY9A 3MQMA 5KTUA 2YYNA 5K29A 4YC9A 5DW1A 4Q0OA 4N3WA 5E0RA 2F6JA 4J0SA 4HXRA 3MUKA 5DFDA 3GG3A 4O72A 2RNYA 5FB1A 3JVLA 5ENIA 5HQ6A 3DWYA 4CUQA 5EK9A 2YELA 5C87A 4UYDA 4TZ2A 5EI4A 4YH4A 5ENHA 3U5LA 2FSAA 4UITA 2R0VA 5IIDA 4TQNA 5EICA 4CURA 4YADA 4O7AA 5F60A 5HLSA 3ONIA 5E9IA 5LKZA 4NR5A 5I88A 5EV9A 2DVSA 5D3NA 5FE0A 5CUAA 5FE9A 4PCIA 5FB0A 5HM0A 5LJ2A 5FE4A 5L8TA 4IR6A 5AD2A 5C8GA 4ZQLA 5D26A 2OO1A 4RVRA 5D3SA 5EPRA 5L96A 5HRWA 4QYLA 5EM3A 4NRAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O77 A;  2MJV B;  5CQ8 A;  5FE1 A;  4ALH A;  4NRB A;  2OSS A;  4IR5 A;  5DYX A;  5KTX A;  5I29 A;  4TT4 A;  5CP5 A;  5D24 A;  4C67 A;  5FE2 A;  4NR6 A;  5E9L A;  4O7C A;  4LZS A;  5DKH A;  5E74 A;  5KTW A;  5CTL A;  5F1L A;  3O33 A;  4QUT A;  4LR6 A;  4MR4 A;  4QZS A;  4TYL A;  3S91 A;  3MB3 A;  4UIV A;  5F25 A;  3FKM X;  5A5P A;  3LXJ A;  5CQA A;  4YY4 A;  5HEL A;  5FDZ A;  5I1Q A;  3RCW A;  5A82 A;  5C4Q A;  3LQI A;  4NRC A;  4F3I A;  4QSU A;  1ZS5 A;  2F6N A;  4A9M A;  2YEK A;  5ETB A;  3SVF A;  5CQ3 A;  5TCM A;  5E9M A;  1EQF A;  5ENE A;  5LJ0 A;  4HXK A;  5CU8 A;  5D3J A;  5ENG A;  2RFJ A;  5IBN A;  5BT4 A;  4QSS A;  2LSP B;  5F3A A;  5FBX A;  5FE6 A;  4A9H A;  5H1T A;  5CY9 A;  5LVQ A;  5FH7 A;  4BJX A;  5CS8 A;  5I80 A;  5CRZ A;  3P1F A;  3Q2E A;  5DW2 A;  5E9V A;  2RS9 B;  5LJ1 A;  4O75 A;  4QUU A;  4BW2 A;  5FH6 A;  2DKW A;  3LQJ A;  4MEO A;  5I40 A;  4O70 A;  5CUE A;  4Q0N A;  5A5O A;  5C85 A;  3G0L A;  4MEP A;  4QEV A;  4YYN A;  3UV2 A;  2DVV A;  4NR8 A;  4XUA A;  2GRC A;  3P5O A;  5EWW A;  3O34 A;  5EU1 A;  2RNX A;  4X2I A;  4OGJ A;  4LC2 A;  4IOR A;  3K2J A;  5EWC A;  4UYF A;  5II2 A;  4YYD A;  5EQ1 A;  4MR6 A;  1N72 A;  4LDF A;  5HEM A;  4CLB A;  3P1E A;  3P1D A;  1E6I A;  4HBY A;  2N9G A;  4NUE A;  5CQT A;  5ENB A;  5CUG A;  4CUT A;  1X0J A;  4NQM A;  4QBM A;  5KU3 A;  4LZR A;  3UV4 A;  4YYJ A;  5KHM A;  5DFC A;  4UYF B;  5KO4 A;  5EA1 A;  4NR4 A;  4XUB A;  5ACY A;  5EP7 A;  4OGI A;  3U5O A;  5L97 A;  4O71 A;  4O7F A;  3MB4 A;  3UW9 A;  1JM4 B;  5JWM A;  3MUL A;  5I7Y A;  3AQA A;  4HXM A;  2R10 A;  4N4I A;  5CQ6 A;  5EWD A;  3U5K A;  4BW1 A;  2H60 A;  5CQ7 A;  4O74 A;  3SVH A;  5A5Q A;  2E7O A;  5D3L A;  4CUU A;  4BW3 A;  3HME A;  5FFY A;  4PTB A;  4QR5 A;  5D3P A;  4WHU A;  5AME A;  2OUO A;  5DFB A;  2YDW A;  3UV5 A;  4UIW A;  5CUD A;  5D7X A;  4UYG A;  4UYE A;  2DVR A;  5DYC A;  2L85 A;  3P1C A;  4QSX A;  4TU4 A;  3QZV A;  5CRM A;  5IGN A;  3JVM A;  5AD3 A;  5AMF A;  4CUS A;  4QSQ A;  5EPS A;  5HQ7 A;  2YW5 A;  3QZS A;  5D3R A;  4A9K A;  4KV4 A;  5DKC A;  5HFQ A;  5HEN A;  4NYW A;  3NXB A;  2DWW A;  4GPJ A;  4QYD A;  4NYV A;  5BT5 A;  5HRV A;  5DBM A;  2L84 A;  4A9J A;  4MEN A;  4TZ8 A;  4ZW1 A;  4LYS A;  5D25 A;  4MEQ A;  4NYX A;  5COI A;  2DVQ A;  5BT3 A;  5LKT A;  5CQ5 A;  4A9F A;  3HMF A;  4TTE A;  4A9O A;  2L5E A;  2R0S A;  3IU5 A;  4Z6I A;  5F5Z A;  3IU6 A;  3JVJ A;  2RI7 A;  5HQ5 A;  4QSP A;  4MR5 A;  5DYA A;  4QST A;  2G4A A;  4NS5 A;  4UIX A;  5J0D A;  4WIV A;  4QB3 A;  4XY8 A;  5CFW A;  5A5S A;  4J0R A;  5DKD A;  5C89 A;  5G4R A;  3UVY A;  5FE8 A;  5EGU A;  5F36 A;  5E9Y A;  3UVD A;  4YK0 A;  4YBM A;  4Z6H A;  4HBV A;  5DY7 A;  5DYU A;  4CFL A;  5A81 A;  3TLP A;  5LVR A;  4LZ2 A;  4UIY A;  4YYM A;  5TB6 A;  5CGP A;  5ENJ A;  4KV1 A;  4UIZ A;  4DON A;  4N4F A;  4PY6 A;  4NXJ A;  2R0Y A;  3O36 A;  4FLP A;  4YAX A;  5F61 A;  4CL9 A;  4QSR A;  2NXB A;  5EIS A;  5FFW A;  5E9K A;  5H1U A;  5II1 A;  5HCL A;  5E3G A;  5FG4 A;  4YBS A;  4ZC9 A;  5A7C A;  5DLX A;  4Z93 A;  4O78 A;  5LKX A;  5E73 A;  5F2P A;  2WP2 A;  4CUP A;  2I8N A;  5D0C A;  4XYA A;  5FFV A;  4QR3 A;  5JI8 A;  2I7K A;  5H85 A;  4A9L A;  5E7D A;  5IG6 A;  2YEM A;  5FG6 A;  4YH3 A;  1F68 A;  4HBX A;  4YYG A;  3UVW A;  4E96 A;  4Z1Q A;  4YYK A;  3LJW A;  3AAD A;  4ALG A;  4J3I A;  4O7B A;  5L98 A;  4HBW A;  5LKU A;  2D9E A;  4C66 A;  2KTB B;  4HXN A;  5DX4 A;  4LRG A;  4NUC A;  5I89 A;  4BW4 A;  4J1P A;  5ETD A;  4QR4 A;  4Y03 A;  4QNS A;  5L99 A;  3Q2F A;  2E7N A;  4IOQ A;  3MXF A;  4QY4 A;  5EWV A;  3D7C A;  5F62 A;  4YYH A;  3I3J A;  1JSP B;  4CFK A;  5A83 A;  2E3K A;  5EPB A;  4KCX A;  4LYW A;  3O37 A;  2RO1 A;  4WHW A;  1WUM A;  5CUB A;  2D82 A;  4TT6 A;  3ZYU A;  5A5R A;  5FE3 A;  5FH8 A;  4Z1S A;  5FG5 A;  1WUG A;  5CQ4 A;  5EVA A;  4YAB A;  4A9I A;  5F1H A;  4NQN A;  5CUC A;  5DLZ A;  4QC3 A;  4HXL A;  4AKN A;  4MR3 A;  5IGM A;  4BHW A;  3S92 A;  4O76 A;  2WP1 A;  4QEU A;  5H1V A;  5IGL A;  5ENC A;  3U5M A;  5CPE A;  4OUF A;  5I7X A;  5D3H A;  4IOO A;  2DAT A;  4HXS A;  5L8U A;  4HXO A;  4LYI A;  4NR7 A;  5ENF A;  4NR9 A;  4N4H A;  5I86 A;  5FE7 A;  4UIU A;  4QSV A;  5G4S A;  5C7N A;  3U5N A;  5CZG A;  5FE5 A;  4YY6 A;  2YQD A;  4YAT A;  4PKL A;  4PS5 A;  3DAI A;  3JVK A;  4N4G A;  4UYH A;  3QZT A;  4QC1 A;  3UVX A;  4PCE A;  4TS8 A;  4IR4 A;  3G0J A;  4QEW A;  4IR3 A;  5A85 A;  3U5P A;  4TU6 A;  5HFR A;  4YBT A;  2RNW A;  4O7E A;  3LQH A;  4YYI A;  5LUU A;  5EWH A;  5E3D A;  3U5J A;  4HXP A;  3SVG A;  3O35 A;  4A9E A;  4TT2 A;  5A5N A;  5HRX A;  5IGK A;  4A9N A;  5I83 A;  3HMH A;  5D3T A;  4NUD A;  4QSW A;  5F63 A;  5HJC A;  4XY9 A;  3MQM A;  5KTU A;  2YYN A;  5K29 A;  4YC9 A;  5DW1 A;  4Q0O A;  4N3W A;  5E0R A;  2F6J A;  4J0S A;  4HXR A;  3MUK A;  5DFD A;  3GG3 A;  4O72 A;  2RNY A;  5FB1 A;  3JVL A;  5ENI A;  5HQ6 A;  3DWY A;  4CUQ A;  5EK9 A;  2YEL A;  5C87 A;  4UYD A;  4TZ2 A;  5EI4 A;  4YH4 A;  5ENH A;  3U5L A;  2FSA A;  4UIT A;  2R0V A;  5IID A;  4TQN A;  5EIC A;  4CUR A;  4YAD A;  4O7A A;  5F60 A;  5HLS A;  3ONI A;  5E9I A;  5LKZ A;  4NR5 A;  5I88 A;  5EV9 A;  2DVS A;  5D3N A;  5FE0 A;  5CUA A;  5FE9 A;  4PCI A;  5FB0 A;  5HM0 A;  5LJ2 A;  5FE4 A;  5L8T A;  4IR6 A;  5AD2 A;  5C8G A;  4ZQL A;  5D26 A;  2OO1 A;  4RVR A;  5D3S A;  5EPR A;  5L96 A;  5HRW A;  4QYL A;  5EM3 A;  4NRA A; 
#chains in the Genus database with same CATH topology
 4O77 A;  2MJV B;  5CQ8 A;  4AI6 A;  5FE1 A;  4ALH A;  4AKH A;  4NRB A;  2OSS A;  4IR5 A;  5DYX A;  5KTX A;  5I29 A;  4TT4 A;  5CP5 A;  5D24 A;  4C67 A;  5FE2 A;  4NR6 A;  5E9L A;  4O7C A;  4LZS A;  5DKH A;  5E74 A;  5KTW A;  5CTL A;  5F1L A;  4AKG A;  3O33 A;  4QUT A;  4LR6 A;  4MR4 A;  4QZS A;  4TYL A;  3S91 A;  3MB3 A;  4UIV A;  5F25 A;  3FKM X;  5A5P A;  3LXJ A;  5CQA A;  4YY4 A;  5HEL A;  5FDZ A;  5I1Q A;  3RCW A;  5A82 A;  5C4Q A;  3LQI A;  4NRC A;  4F3I A;  4QSU A;  1ZS5 A;  2F6N A;  4A9M A;  2YEK A;  5ETB A;  3SVF A;  5CQ3 A;  5TCM A;  5E9M A;  1EQF A;  5ENE A;  5LJ0 A;  4HXK A;  5CU8 A;  5D3J A;  5ENG A;  2RFJ A;  5IBN A;  5BT4 A;  4QSS A;  2LSP B;  5F3A A;  5FBX A;  5FE6 A;  4A9H A;  5H1T A;  5CY9 A;  5LVQ A;  5FH7 A;  4BJX A;  5CS8 A;  5I80 A;  5CRZ A;  3P1F A;  3Q2E A;  5DW2 A;  5E9V A;  2RS9 B;  5LJ1 A;  4O75 A;  4QUU A;  4BW2 A;  5FH6 A;  2DKW A;  3LQJ A;  4MEO A;  5I40 A;  4O70 A;  5CUE A;  4Q0N A;  5A5O A;  5C85 A;  3G0L A;  4MEP A;  4QEV A;  4YYN A;  3UV2 A;  2DVV A;  4NR8 A;  4XUA A;  2GRC A;  3P5O A;  5EWW A;  3O34 A;  5EU1 A;  2RNX A;  4X2I A;  3VKH A;  4OGJ A;  4LC2 A;  4IOR A;  3K2J A;  5EWC A;  4AKI A;  4UYF A;  5II2 A;  4YYD A;  5EQ1 A;  4MR6 A;  1N72 A;  4LDF A;  5HEM A;  4CLB A;  3P1E A;  3P1D A;  1E6I A;  4HBY A;  2N9G A;  4NUE A;  5CQT A;  5ENB A;  5CUG A;  4CUT A;  1X0J A;  4NQM A;  4QBM A;  5KU3 A;  4LZR A;  3UV4 A;  4YYJ A;  5KHM A;  5DFC A;  4UYF B;  5KO4 A;  5EA1 A;  4NR4 A;  4XUB A;  5ACY A;  5EP7 A;  4OGI A;  3U5O A;  5L97 A;  4O71 A;  4O7F A;  3MB4 A;  3UW9 A;  1JM4 B;  5JWM A;  3MUL A;  5I7Y A;  3AQA A;  4HXM A;  2R10 A;  4N4I A;  5CQ6 A;  5EWD A;  3U5K A;  4BW1 A;  2H60 A;  5CQ7 A;  4O74 A;  3SVH A;  5A5Q A;  2E7O A;  5D3L A;  4CUU A;  4BW3 A;  3HME A;  5FFY A;  4PTB A;  4QR5 A;  5D3P A;  4WHU A;  5AME A;  2OUO A;  5DFB A;  2YDW A;  3UV5 A;  1PUO A;  4UIW A;  5CUD A;  5D7X A;  4UYG A;  4UYE A;  2DVR A;  5DYC A;  2L85 A;  3P1C A;  4QSX A;  4TU4 A;  3QZV A;  5CRM A;  5IGN A;  3JVM A;  5AD3 A;  5AMF A;  4CUS A;  4QSQ A;  5EPS A;  5HQ7 A;  2YW5 A;  3QZS A;  5D3R A;  4A9K A;  4KV4 A;  5DKC A;  3D1D A;  5HFQ A;  5HEN A;  4NYW A;  3NXB A;  2DWW A;  4GPJ A;  4QYD A;  4NYV A;  5BT5 A;  5HRV A;  5DBM A;  2L84 A;  4A9J A;  4MEN A;  4TZ8 A;  4ZW1 A;  4LYS A;  5D25 A;  4MEQ A;  4NYX A;  5COI A;  2DVQ A;  5BT3 A;  5LKT A;  5CQ5 A;  4A9F A;  3HMF A;  4TTE A;  4A9O A;  2L5E A;  2R0S A;  3IU5 A;  4Z6I A;  5F5Z A;  3IU6 A;  3JVJ A;  2RI7 A;  5HQ5 A;  4QSP A;  4MR5 A;  5DYA A;  4QST A;  2G4A A;  4NS5 A;  4UIX A;  5J0D A;  4WIV A;  4QB3 A;  4XY8 A;  5CFW A;  5A5S A;  4J0R A;  5DKD A;  5C89 A;  5G4R A;  3UVY A;  5FE8 A;  5EGU A;  5F36 A;  5E9Y A;  3UVD A;  4YK0 A;  4YBM A;  4Z6H A;  4HBV A;  5DY7 A;  5DYU A;  4CFL A;  5A81 A;  3TLP A;  5LVR A;  4LZ2 A;  4UIY A;  4YYM A;  5TB6 A;  5CGP A;  5ENJ A;  4KV1 A;  4UIZ A;  4DON A;  4N4F A;  4PY6 A;  4NXJ A;  2R0Y A;  3O36 A;  4FLP A;  4YAX A;  5F61 A;  4CL9 A;  4QSR A;  2NXB A;  5EIS A;  5FFW A;  5E9K A;  5H1U A;  5II1 A;  5HCL A;  5E3G A;  5FG4 A;  4YBS A;  4ZC9 A;  5A7C A;  5DLX A;  4Z93 A;  4O78 A;  5LKX A;  5E73 A;  5F2P A;  2WP2 A;  4CUP A;  2I8N A;  5D0C A;  4XYA A;  5FFV A;  4QR3 A;  5JI8 A;  2I7K A;  5H85 A;  4A9L A;  5E7D A;  5IG6 A;  2YEM A;  5FG6 A;  4YH3 A;  1F68 A;  4HBX A;  4YYG A;  3UVW A;  4E96 A;  4Z1Q A;  4YYK A;  3LJW A;  3AAD A;  4ALG A;  4J3I A;  4O7B A;  5L98 A;  4HBW A;  5LKU A;  2D9E A;  4C66 A;  2KTB B;  4HXN A;  5DX4 A;  4LRG A;  4NUC A;  5I89 A;  4BW4 A;  4J1P A;  5ETD A;  2EJN A;  4QR4 A;  4Y03 A;  4QNS A;  5L99 A;  3Q2F A;  2E7N A;  4IOQ A;  3ERR A;  3MXF A;  4QY4 A;  5EWV A;  3D7C A;  5F62 A;  4YYH A;  3I3J A;  1JSP B;  4CFK A;  5A83 A;  2E3K A;  5EPB A;  4KCX A;  4LYW A;  3O37 A;  2RO1 A;  4WHW A;  1WUM A;  5CUB A;  2D82 A;  4TT6 A;  1ZKR A;  3ZYU A;  5A5R A;  5FE3 A;  5FH8 A;  4Z1S A;  5FG5 A;  1WUG A;  5CQ4 A;  5EVA A;  4YAB A;  4A9I A;  5F1H A;  4NQN A;  5CUC A;  5DLZ A;  3D1B A;  4QC3 A;  4HXL A;  4AKN A;  4MR3 A;  5IGM A;  4BHW A;  3S92 A;  4O76 A;  2WP1 A;  4QEU A;  5H1V A;  5IGL A;  5ENC A;  3U5M A;  5CPE A;  4OUF A;  5I7X A;  5D3H A;  4IOO A;  2DAT A;  4HXS A;  5L8U A;  4HXO A;  4LYI A;  4NR7 A;  5ENF A;  4NR9 A;  4N4H A;  5I86 A;  5FE7 A;  4UIU A;  4QSV A;  5G4S A;  5C7N A;  3U5N A;  5CZG A;  5FE5 A;  4YY6 A;  2YQD A;  4YAT A;  4PKL A;  4PS5 A;  3DAI A;  3JVK A;  4N4G A;  4UYH A;  3QZT A;  4QC1 A;  3UVX A;  4PCE A;  4TS8 A;  4IR4 A;  3G0J A;  4QEW A;  4IR3 A;  5A85 A;  3U5P A;  4TU6 A;  5HFR A;  4YBT A;  2RNW A;  4O7E A;  3LQH A;  4YYI A;  5LUU A;  5EWH A;  5E3D A;  3U5J A;  4HXP A;  3SVG A;  3O35 A;  4A9E A;  4TT2 A;  5A5N A;  3VKG A;  5HRX A;  5IGK A;  4A9N A;  5I83 A;  3HMH A;  5D3T A;  4NUD A;  4QSW A;  5F63 A;  5HJC A;  4XY9 A;  3MQM A;  5KTU A;  2YYN A;  5K29 A;  4YC9 A;  5DW1 A;  4Q0O A;  4N3W A;  5E0R A;  2F6J A;  4J0S A;  4HXR A;  3MUK A;  5DFD A;  3GG3 A;  4O72 A;  2RNY A;  5FB1 A;  3JVL A;  5ENI A;  5HQ6 A;  3DWY A;  4CUQ A;  5EK9 A;  2YEL A;  5C87 A;  4UYD A;  4TZ2 A;  5EI4 A;  4YH4 A;  5ENH A;  3U5L A;  2FSA A;  4UIT A;  2R0V A;  5IID A;  4TQN A;  5EIC A;  4CUR A;  4YAD A;  4O7A A;  5F60 A;  5HLS A;  3ONI A;  5E9I A;  5LKZ A;  4NR5 A;  5I88 A;  5EV9 A;  2DVS A;  5D3N A;  5FE0 A;  5CUA A;  5FE9 A;  4PCI A;  5FB0 A;  5HM0 A;  5LJ2 A;  5FE4 A;  5L8T A;  4IR6 A;  5AD2 A;  5C8G A;  4ZQL A;  5D26 A;  2OO1 A;  4RVR A;  5D3S A;  5EPR A;  5L96 A;  5HRW A;  4QYL A;  5EM3 A;  4NRA A; 
#chains in the Genus database with same CATH homology
 4O77 A;  2MJV B;  5CQ8 A;  5FE1 A;  4ALH A;  4NRB A;  2OSS A;  4IR5 A;  5DYX A;  5KTX A;  5I29 A;  4TT4 A;  5CP5 A;  5D24 A;  4C67 A;  5FE2 A;  4NR6 A;  5E9L A;  4O7C A;  4LZS A;  5DKH A;  5E74 A;  5KTW A;  5CTL A;  5F1L A;  3O33 A;  4QUT A;  4LR6 A;  4MR4 A;  4QZS A;  4TYL A;  3S91 A;  3MB3 A;  4UIV A;  5F25 A;  3FKM X;  5A5P A;  3LXJ A;  5CQA A;  4YY4 A;  5HEL A;  5FDZ A;  5I1Q A;  3RCW A;  5A82 A;  5C4Q A;  3LQI A;  4NRC A;  4F3I A;  4QSU A;  1ZS5 A;  2F6N A;  4A9M A;  2YEK A;  5ETB A;  3SVF A;  5CQ3 A;  5TCM A;  5E9M A;  1EQF A;  5ENE A;  5LJ0 A;  4HXK A;  5CU8 A;  5D3J A;  5ENG A;  2RFJ A;  5IBN A;  5BT4 A;  4QSS A;  2LSP B;  5F3A A;  5FBX A;  5FE6 A;  4A9H A;  5H1T A;  5CY9 A;  5LVQ A;  5FH7 A;  4BJX A;  5CS8 A;  5I80 A;  5CRZ A;  3P1F A;  3Q2E A;  5DW2 A;  5E9V A;  2RS9 B;  5LJ1 A;  4O75 A;  4QUU A;  4BW2 A;  5FH6 A;  2DKW A;  3LQJ A;  4MEO A;  5I40 A;  4O70 A;  5CUE A;  4Q0N A;  5A5O A;  5C85 A;  3G0L A;  4MEP A;  4QEV A;  4YYN A;  3UV2 A;  2DVV A;  4NR8 A;  4XUA A;  2GRC A;  3P5O A;  5EWW A;  3O34 A;  5EU1 A;  2RNX A;  4X2I A;  4OGJ A;  4LC2 A;  4IOR A;  3K2J A;  5EWC A;  4UYF A;  5II2 A;  4YYD A;  5EQ1 A;  4MR6 A;  1N72 A;  4LDF A;  5HEM A;  4CLB A;  3P1E A;  3P1D A;  1E6I A;  4HBY A;  2N9G A;  4NUE A;  5CQT A;  5ENB A;  5CUG A;  4CUT A;  1X0J A;  4NQM A;  4QBM A;  5KU3 A;  4LZR A;  3UV4 A;  4YYJ A;  5KHM A;  5DFC A;  4UYF B;  5KO4 A;  5EA1 A;  4NR4 A;  4XUB A;  5ACY A;  5EP7 A;  4OGI A;  3U5O A;  5L97 A;  4O71 A;  4O7F A;  3MB4 A;  3UW9 A;  1JM4 B;  5JWM A;  3MUL A;  5I7Y A;  3AQA A;  4HXM A;  2R10 A;  4N4I A;  5CQ6 A;  5EWD A;  3U5K A;  4BW1 A;  2H60 A;  5CQ7 A;  4O74 A;  3SVH A;  5A5Q A;  2E7O A;  5D3L A;  4CUU A;  4BW3 A;  3HME A;  5FFY A;  4PTB A;  4QR5 A;  5D3P A;  4WHU A;  5AME A;  2OUO A;  5DFB A;  2YDW A;  3UV5 A;  4UIW A;  5CUD A;  5D7X A;  4UYG A;  4UYE A;  2DVR A;  5DYC A;  2L85 A;  3P1C A;  4QSX A;  4TU4 A;  3QZV A;  5CRM A;  5IGN A;  3JVM A;  5AD3 A;  5AMF A;  4CUS A;  4QSQ A;  5EPS A;  5HQ7 A;  2YW5 A;  3QZS A;  5D3R A;  4A9K A;  4KV4 A;  5DKC A;  5HFQ A;  5HEN A;  4NYW A;  3NXB A;  2DWW A;  4GPJ A;  4QYD A;  4NYV A;  5BT5 A;  5HRV A;  5DBM A;  2L84 A;  4A9J A;  4MEN A;  4TZ8 A;  4ZW1 A;  4LYS A;  5D25 A;  4MEQ A;  4NYX A;  5COI A;  2DVQ A;  5BT3 A;  5LKT A;  5CQ5 A;  4A9F A;  3HMF A;  4TTE A;  4A9O A;  2L5E A;  2R0S A;  3IU5 A;  4Z6I A;  5F5Z A;  3IU6 A;  3JVJ A;  2RI7 A;  5HQ5 A;  4QSP A;  4MR5 A;  5DYA A;  4QST A;  2G4A A;  4NS5 A;  4UIX A;  5J0D A;  4WIV A;  4QB3 A;  4XY8 A;  5CFW A;  5A5S A;  4J0R A;  5DKD A;  5C89 A;  5G4R A;  3UVY A;  5FE8 A;  5EGU A;  5F36 A;  5E9Y A;  3UVD A;  4YK0 A;  4YBM A;  4Z6H A;  4HBV A;  5DY7 A;  5DYU A;  4CFL A;  5A81 A;  3TLP A;  5LVR A;  4LZ2 A;  4UIY A;  4YYM A;  5TB6 A;  5CGP A;  5ENJ A;  4KV1 A;  4UIZ A;  4DON A;  4N4F A;  4PY6 A;  4NXJ A;  2R0Y A;  3O36 A;  4FLP A;  4YAX A;  5F61 A;  4CL9 A;  4QSR A;  2NXB A;  5EIS A;  5FFW A;  5E9K A;  5H1U A;  5II1 A;  5HCL A;  5E3G A;  5FG4 A;  4YBS A;  4ZC9 A;  5A7C A;  5DLX A;  4Z93 A;  4O78 A;  5LKX A;  5E73 A;  5F2P A;  2WP2 A;  4CUP A;  2I8N A;  5D0C A;  4XYA A;  5FFV A;  4QR3 A;  5JI8 A;  2I7K A;  5H85 A;  4A9L A;  5E7D A;  5IG6 A;  2YEM A;  5FG6 A;  4YH3 A;  1F68 A;  4HBX A;  4YYG A;  3UVW A;  4E96 A;  4Z1Q A;  4YYK A;  3LJW A;  3AAD A;  4ALG A;  4J3I A;  4O7B A;  5L98 A;  4HBW A;  5LKU A;  2D9E A;  4C66 A;  2KTB B;  4HXN A;  5DX4 A;  4LRG A;  4NUC A;  5I89 A;  4BW4 A;  4J1P A;  5ETD A;  4QR4 A;  4Y03 A;  4QNS A;  5L99 A;  3Q2F A;  2E7N A;  4IOQ A;  3MXF A;  4QY4 A;  5EWV A;  3D7C A;  5F62 A;  4YYH A;  3I3J A;  1JSP B;  4CFK A;  5A83 A;  2E3K A;  5EPB A;  4KCX A;  4LYW A;  3O37 A;  2RO1 A;  4WHW A;  1WUM A;  5CUB A;  2D82 A;  4TT6 A;  3ZYU A;  5A5R A;  5FE3 A;  5FH8 A;  4Z1S A;  5FG5 A;  1WUG A;  5CQ4 A;  5EVA A;  4YAB A;  4A9I A;  5F1H A;  4NQN A;  5CUC A;  5DLZ A;  4QC3 A;  4HXL A;  4AKN A;  4MR3 A;  5IGM A;  4BHW A;  3S92 A;  4O76 A;  2WP1 A;  4QEU A;  5H1V A;  5IGL A;  5ENC A;  3U5M A;  5CPE A;  4OUF A;  5I7X A;  5D3H A;  4IOO A;  2DAT A;  4HXS A;  5L8U A;  4HXO A;  4LYI A;  4NR7 A;  5ENF A;  4NR9 A;  4N4H A;  5I86 A;  5FE7 A;  4UIU A;  4QSV A;  5G4S A;  5C7N A;  3U5N A;  5CZG A;  5FE5 A;  4YY6 A;  2YQD A;  4YAT A;  4PKL A;  4PS5 A;  3DAI A;  3JVK A;  4N4G A;  4UYH A;  3QZT A;  4QC1 A;  3UVX A;  4PCE A;  4TS8 A;  4IR4 A;  3G0J A;  4QEW A;  4IR3 A;  5A85 A;  3U5P A;  4TU6 A;  5HFR A;  4YBT A;  2RNW A;  4O7E A;  3LQH A;  4YYI A;  5LUU A;  5EWH A;  5E3D A;  3U5J A;  4HXP A;  3SVG A;  3O35 A;  4A9E A;  4TT2 A;  5A5N A;  5HRX A;  5IGK A;  4A9N A;  5I83 A;  3HMH A;  5D3T A;  4NUD A;  4QSW A;  5F63 A;  5HJC A;  4XY9 A;  3MQM A;  5KTU A;  2YYN A;  5K29 A;  4YC9 A;  5DW1 A;  4Q0O A;  4N3W A;  5E0R A;  2F6J A;  4J0S A;  4HXR A;  3MUK A;  5DFD A;  3GG3 A;  4O72 A;  2RNY A;  5FB1 A;  3JVL A;  5ENI A;  5HQ6 A;  3DWY A;  4CUQ A;  5EK9 A;  2YEL A;  5C87 A;  4UYD A;  4TZ2 A;  5EI4 A;  4YH4 A;  5ENH A;  3U5L A;  2FSA A;  4UIT A;  2R0V A;  5IID A;  4TQN A;  5EIC A;  4CUR A;  4YAD A;  4O7A A;  5F60 A;  5HLS A;  3ONI A;  5E9I A;  5LKZ A;  4NR5 A;  5I88 A;  5EV9 A;  2DVS A;  5D3N A;  5FE0 A;  5CUA A;  5FE9 A;  4PCI A;  5FB0 A;  5HM0 A;  5LJ2 A;  5FE4 A;  5L8T A;  4IR6 A;  5AD2 A;  5C8G A;  4ZQL A;  5D26 A;  2OO1 A;  4RVR A;  5D3S A;  5EPR A;  5L96 A;  5HRW A;  4QYL A;  5EM3 A;  4NRA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...