3P1DA

Crystal structure of the bromodomain of human crebbp in complex with n-methyl-2-pyrrolidone (nmp)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
115
structure length
115
Chain Sequence
KIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords CREB-binding protein
publication title Histone recognition and large-scale structural analysis of the human bromodomain family.
pubmed doi rcsb
source organism Homo sapiens
total genus 40
structure length 115
sequence length 115
chains with identical sequence B
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2010-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3p1dA00
5CUAA 4LRGA 4A9IA 5A82A 5FE1A 5I88A 5DKHA 4NR6A 4HXMA 5FB0A 4C67A 5C7NA 1E6IA 5DLXA 4CFKA 2YELA 4UIWA 2DVSA 4AKNA 5E9KA 5ENIA 5C89A 2E7NA 4LYWA 2F6NA 4BJXA 4OUFA 4QEVA 5F36A 4UIVA 5I83A 4QSVA 3S92A 4PY6A 2F6JA 4IR5A 4MEOA 1WUGA 3SVFA 5D0CA 5EI4A 4KV4A 4UITA 5HENA 3O35A 5ENCA 3UVYA 2RFJA 5FBXA 4YABA 4NQMA 5FE5A 2YYNA 4WIVA 5LKZA 3MB4A 5LVRA 4NYVA 4LYSA 4A9JA 4O70A 5FE4A 5CUEA 4YK0A 2DWWA 5E3DA 5L98A 5HLSA 5EQ1A 3SVGA 4QR5A 4PCEA 5CQ6A 2G4AA 3U5JA 4TQNA 4O7AA 3IU6A 5K29A 5D3NA 5HQ6A 4QSQA 4J1PA 5IIDA 5II2A 5E9VA 5F1LA 4WHUA 5D3LA 4LZRA 4PS5A 2YQDA 5ACYA 4LC2A 5I7YA 5CQ3A 5E0RA 5COIA 5EISA 4YAXA 5ENJA 2I8NA 2DATA 4O74A 4O7CA 3U5MA 5FG5A 5CU8A 4A9LA 2RS9B 5I86A 4KCXA 5CUCA 3U5PA 5FH6A 4J0RA 4MR3A 3O34A 4NR8A 4TT4A 5AD2A 5IGKA 3Q2EA 5H85A 5HFRA 4NR9A 4YYNA 5F61A 5C85A 5II1A 5F63A 2N9GA 5EVAA 5E74A 2E3KA 4LR6A 5EWDA 4LZ2A 5G4SA 5L8TA 2WP2A 5DW2A 4LYIA 4HXOA 4Z1QA 3NXBA 4YYKA 2R0VA 4LDFA 2D9EA 5ENHA 4UIYA 4IOQA 5KTUA 5CS8A 4YADA 4QSXA 5JI8A 4YH3A 3U5LA 2GRCA 4Q0NA 5CZGA 4YYJA 5DYUA 5H1VA 4NYXA 4MR4A 1ZS5A 4NRAA 4A9OA 4YYDA 3FKMX 4HBVA 4Q0OA 3ONIA 4YATA 5ETBA 5D26A 3QZSA 4CUSA 3G0LA 3I3JA 5IGNA 4TZ8A 5KU3A 4TU4A 5E73A 4PCIA 2OSSA 5FDZA 2YEKA 5DFBA 5EK9A 4UYGA 2DVQA 2LSPB 4MR5A 5IGMA 5E7DA 4YBSA 5D3SA 2R10A 4UYFA 4IOOA 4PTBA 5CRMA 4MENA 3UV5A 2DKWA 3JVKA 5CGPA 5DYCA 4QSRA 5EPBA 5CQ5A 5TB6A 5LVQA 4HXKA 4TT2A 5D3HA 5AMEA 2NXBA 5ETDA 5EU1A 3UV2A 4IR6A 5DYXA 2YDWA 4YY4A 3LXJA 5E3GA 5G4RA 3K2JA 3MULA 5EICA 3G0JA 5DKCA 4TTEA 5H1UA 4O7FA 4NR4A 4NUDA 3QZVA 5DFDA 5LJ1A 5A5SA 4FLPA 4QR3A 5CUGA 4YBTA 2RNWA 5HM0A 5KO4A 3Q2FA 4KV1A 4Z93A 4ALGA 2L5EA 5I1QA 3DWYA 1F68A 2I7KA 4UIUA 2DVRA 3HMEA 1JSPB 4UYDA 4HBXA 4N4FA 5EWWA 5HQ7A 4LZSA 3P1EA 5KHMA 2YW5A 5CUBA 5AMFA 4BW2A 4QSTA 5DYAA 5EM3A 4A9NA 5FG6A 5LKUA 3UV4A 3P1DA 5DFCA 5L97A 5D25A 5C8GA 4UYEA 5FE2A 4QEUA 5D7XA 2R0SA 4QC3A 4NRBA 4XYAA 1JM4B 4MEPA 4QSPA 4QBMA 5A81A 4OGIA 5CQ7A 3P1FA 3SVHA 5A5OA 4NRCA 3MQMA 4QUTA 5CTLA 5EP7A 5E9YA 4YYMA 2OO1A 4CFLA 5AD3A 4QSUA 4QUUA 5I89A 1EQFA 4MEQA 4NUCA 4A9KA 5DY7A 5EPSA 4ZQLA 4O7BA 4ZW1A 2R0YA 4YY6A 4O78A 4C66A 5E9LA 4QNSA 1N72A 4UIXA 5IBNA 4CURA 5LUUA 5F3AA 4PKLA 5JWMA 4Z6HA 5L99A 3U5OA 5CQAA 4TYLA 4XUAA 5C87A 3ZYUA 5A7CA 4QYLA 4BHWA 4TS8A 4HBWA 3MUKA 5DLZA 5FB1A 3JVJA 4O76A 4TZ2A 4E96A 5CUDA 4ZC9A 3U5NA 4TT6A 5I80A 3IU5A 4QR4A 3P1CA 5LJ0A 3U5KA 5C4QA 5FG4A 4QZSA 3LQJA 5DBMA 4YYGA 5EA1A 5ENEA 5A83A 5CPEA 5CFWA 4WHWA 2RO1A 2YEMA 2OUOA 5EGUA 5KTXA 2MJVB 4CUPA 5FH7A 5HELA 3UVWA 4RVRA 4NYWA 4XY8A 4NS5A 4YC9A 4YYIA 4HXSA 2H60A 5ENFA 2DVVA 5FFYA 3MB3A 2D82A 5F5ZA 5A5QA 4O7EA 4TU6A 5E9IA 4X2IA 5IG6A 4ALHA 5HQ5A 4F3IA 3AQAA 4NXJA 4QSWA 4O71A 5EV9A 4DONA 5LKXA 4UIZA 4XUBA 4BW3A 4HXRA 5I7XA 5FE6A 5CQ8A 3RCWA 5ENBA 4CLBA 5TCMA 3HMHA 4OGJA 5BT4A 5HJCA 5J0DA 3JVMA 4HXLA 4YH4A 5F60A 3GG3A 3AADA 4QSSA 4GPJA 3D7CA 4N3WA 4Y03A 3O37A 2L84A 5LJ2A 5FE8A 5FFVA 4A9EA 3O36A 5L8UA 5A5PA 5IGLA 2FSAA 4Z6IA 5KTWA 5A5RA 2RI7A 2RNYA 4CUUA 5F25A 4XY9A 5EWVA 4J0SA 4QB3A 3UVXA 5EPRA 5CY9A 2L85A 5DKDA 5DW1A 5A85A 3QZTA 4IR4A 5FE7A 1X0JA 2KTBB 5FH8A 4UYFB 3HMFA 3LQHA 5BT5A 5A5NA 3LJWA 4IR3A 3S91A 4NR5A 4NR7A 5FFWA 3DAIA 5EWHA 4YBMA 4CL9A 5L96A 4N4IA 2E7OA 5HFQA 4A9HA 4CUTA 4IORA 4BW1A 4J3IA 5D24A 5CRZA 5FE9A 5HRWA 4O75A 4UYHA 5HRVA 5D3JA 5D3TA 4YYHA 3MXFA 5BT3A 5CQ4A 5CQTA 2RNXA 5LKTA 5H1TA 4QC1A 4CUQA 3JVLA 3O33A 4N4HA 5I29A 4N4GA 5FE0A 4QY4A 4BW4A 5EWCA 5E9MA 1WUMA 5F2PA 4MR6A 4NQNA 4Z1SA 4A9FA 5HEMA 4HBYA 3UVDA 5HRXA 5CP5A 4HXNA 5D3RA 5ENGA 5FE3A 5DX4A 5F62A 4HXPA 4A9MA 4QYDA 4QEWA 5F1HA 2WP1A 4O77A 5HCLA 3TLPA 3UW9A 4O72A 4NUEA 5D3PA 5I40A 3LQIA 3P5OA
chains in the Genus database with same CATH superfamily
5CUAA 4LRGA 4A9IA 5A82A 5FE1A 5I88A 5DKHA 4NR6A 4HXMA 5FB0A 4C67A 5C7NA 1E6IA 5DLXA 4CFKA 2YELA 4UIWA 2DVSA 4AKNA 5E9KA 5ENIA 5C89A 2E7NA 4LYWA 2F6NA 4BJXA 4OUFA 4QEVA 5F36A 4UIVA 5I83A 4QSVA 2EJNA 3S92A 4PY6A 2F6JA 4IR5A 4MEOA 1WUGA 3SVFA 5D0CA 5EI4A 4KV4A 4UITA 3VKGA 5HENA 3O35A 5ENCA 3UVYA 2RFJA 5FBXA 4YABA 4NQMA 5FE5A 4AKHA 2YYNA 4WIVA 5LKZA 3MB4A 5LVRA 4NYVA 4LYSA 4AI6A 4A9JA 4O70A 5FE4A 5CUEA 4YK0A 2DWWA 5E3DA 5L98A 5HLSA 5EQ1A 3SVGA 4QR5A 4PCEA 5CQ6A 2G4AA 3U5JA 4TQNA 4O7AA 3IU6A 5K29A 5D3NA 5HQ6A 4QSQA 4J1PA 5IIDA 5II2A 5E9VA 5F1LA 4WHUA 5D3LA 4LZRA 4PS5A 2YQDA 5ACYA 4LC2A 5I7YA 5CQ3A 5E0RA 5COIA 5EISA 4YAXA 5ENJA 2I8NA 2DATA 4O74A 4O7CA 3U5MA 5FG5A 5CU8A 4A9LA 2RS9B 3D1BA 5I86A 4KCXA 5CUCA 3U5PA 5FH6A 4J0RA 4MR3A 3O34A 4NR8A 4TT4A 5AD2A 5IGKA 3Q2EA 5H85A 5HFRA 4NR9A 4YYNA 5F61A 5C85A 5II1A 5F63A 2N9GA 5EVAA 3ERRA 5E74A 2E3KA 4LR6A 5EWDA 4LZ2A 5G4SA 5L8TA 2WP2A 5DW2A 4LYIA 4HXOA 4Z1QA 3NXBA 4YYKA 2R0VA 4LDFA 2D9EA 5ENHA 4UIYA 4IOQA 5KTUA 5CS8A 4YADA 4QSXA 5JI8A 4YH3A 3U5LA 2GRCA 4Q0NA 5CZGA 4YYJA 5DYUA 5H1VA 4NYXA 4MR4A 1ZS5A 4NRAA 4A9OA 4YYDA 3FKMX 4HBVA 4Q0OA 3ONIA 4YATA 5ETBA 5D26A 3QZSA 4CUSA 3G0LA 3I3JA 5IGNA 4TZ8A 5KU3A 4TU4A 5E73A 4PCIA 2OSSA 5FDZA 2YEKA 5DFBA 5EK9A 4UYGA 2DVQA 2LSPB 4MR5A 5IGMA 5E7DA 4YBSA 5D3SA 2R10A 4UYFA 4IOOA 4PTBA 5CRMA 4MENA 3UV5A 2DKWA 3JVKA 5CGPA 5DYCA 4QSRA 5EPBA 5CQ5A 5TB6A 5LVQA 4HXKA 4TT2A 5D3HA 5AMEA 2NXBA 5ETDA 5EU1A 3UV2A 4IR6A 5DYXA 2YDWA 4YY4A 3LXJA 5E3GA 5G4RA 3K2JA 3MULA 5EICA 3G0JA 5DKCA 4TTEA 5H1UA 4O7FA 4NR4A 4NUDA 3QZVA 5DFDA 5LJ1A 4AKIA 5A5SA 4FLPA 4QR3A 5CUGA 4YBTA 2RNWA 5HM0A 5KO4A 3Q2FA 4KV1A 4Z93A 4ALGA 2L5EA 5I1QA 3DWYA 1F68A 2I7KA 4UIUA 2DVRA 3HMEA 1JSPB 4UYDA 4HBXA 4N4FA 5EWWA 5HQ7A 4LZSA 3P1EA 5KHMA 2YW5A 5CUBA 5AMFA 4BW2A 4QSTA 5DYAA 5EM3A 4A9NA 5FG6A 5LKUA 3UV4A 3P1DA 5DFCA 5L97A 5D25A 5C8GA 4UYEA 5FE2A 4QEUA 5D7XA 2R0SA 4QC3A 4NRBA 4XYAA 1JM4B 4MEPA 4QSPA 4QBMA 5A81A 4OGIA 5CQ7A 3P1FA 3SVHA 5A5OA 4NRCA 3MQMA 4QUTA 5CTLA 5EP7A 5E9YA 4YYMA 2OO1A 4CFLA 5AD3A 4QSUA 4QUUA 5I89A 1EQFA 4MEQA 4NUCA 4A9KA 5DY7A 5EPSA 4ZQLA 4O7BA 4ZW1A 2R0YA 4YY6A 4O78A 4C66A 5E9LA 4QNSA 1N72A 4UIXA 5IBNA 4CURA 5LUUA 5F3AA 4PKLA 5JWMA 4Z6HA 5L99A 3U5OA 5CQAA 4TYLA 4XUAA 5C87A 3ZYUA 5A7CA 4QYLA 4BHWA 4TS8A 4HBWA 3MUKA 5DLZA 5FB1A 3JVJA 4O76A 4TZ2A 4E96A 5CUDA 4ZC9A 3U5NA 4TT6A 5I80A 3IU5A 4QR4A 3P1CA 1ZKRA 5LJ0A 3U5KA 5C4QA 5FG4A 4QZSA 3LQJA 5DBMA 4YYGA 5EA1A 5ENEA 5A83A 5CPEA 5CFWA 1PUOA 4WHWA 2RO1A 2YEMA 2OUOA 5EGUA 5KTXA 2MJVB 4CUPA 5FH7A 5HELA 3UVWA 4RVRA 4NYWA 4XY8A 4NS5A 4YC9A 4YYIA 4HXSA 2H60A 5ENFA 2DVVA 5FFYA 3MB3A 3VKHA 2D82A 5F5ZA 5A5QA 4O7EA 4TU6A 5E9IA 4X2IA 5IG6A 4ALHA 5HQ5A 4F3IA 3AQAA 4NXJA 4QSWA 4O71A 5EV9A 4DONA 5LKXA 4UIZA 4XUBA 4BW3A 4HXRA 5I7XA 4AKGA 5FE6A 5CQ8A 3RCWA 5ENBA 4CLBA 5TCMA 3HMHA 4OGJA 5BT4A 5HJCA 5J0DA 3JVMA 4HXLA 4YH4A 5F60A 3GG3A 3AADA 4QSSA 4GPJA 3D7CA 4N3WA 4Y03A 3O37A 2L84A 5LJ2A 5FE8A 5FFVA 4A9EA 3O36A 5L8UA 5A5PA 5IGLA 2FSAA 4Z6IA 5KTWA 5A5RA 2RI7A 2RNYA 4CUUA 5F25A 4XY9A 5EWVA 4J0SA 4QB3A 3UVXA 5EPRA 5CY9A 2L85A 5DKDA 5DW1A 5A85A 3QZTA 4IR4A 5FE7A 1X0JA 2KTBB 5FH8A 4UYFB 3HMFA 3LQHA 5BT5A 5A5NA 3LJWA 4IR3A 3S91A 4NR5A 4NR7A 5FFWA 3DAIA 5EWHA 4YBMA 4CL9A 5L96A 4N4IA 2E7OA 5HFQA 4A9HA 4CUTA 4IORA 4BW1A 4J3IA 5D24A 5CRZA 5FE9A 3D1DA 4O75A 5HRWA 4UYHA 5HRVA 5D3JA 5D3TA 4YYHA 3MXFA 5BT3A 5CQ4A 5CQTA 2RNXA 5LKTA 5H1TA 4QC1A 4CUQA 3JVLA 3O33A 4N4HA 5I29A 4N4GA 5FE0A 4QY4A 4BW4A 5EWCA 5E9MA 1WUMA 5F2PA 4MR6A 4NQNA 4Z1SA 4A9FA 5HEMA 4HBYA 3UVDA 5HRXA 5CP5A 4HXNA 5D3RA 5ENGA 5FE3A 5DX4A 5F62A 4HXPA 4A9MA 4QYDA 4QEWA 5F1HA 2WP1A 4O77A 5HCLA 3TLPA 3UW9A 4O72A 4NUEA 5D3PA 5I40A 3LQIA 3P5OA
chains in the Genus database with same CATH topology
5CUAA 4LRGA 4A9IA 5A82A 5FE1A 5I88A 5DKHA 4NR6A 4HXMA 5FB0A 4C67A 5C7NA 1E6IA 5DLXA 4CFKA 2YELA 4UIWA 2DVSA 4AKNA 5E9KA 5ENIA 5C89A 2E7NA 4LYWA 2F6NA 4BJXA 4OUFA 4QEVA 5F36A 4UIVA 5I83A 4QSVA 3S92A 4PY6A 2F6JA 4IR5A 4MEOA 1WUGA 3SVFA 5D0CA 5EI4A 4KV4A 4UITA 5HENA 3O35A 5ENCA 3UVYA 2RFJA 5FBXA 4YABA 4NQMA 5FE5A 2YYNA 4WIVA 5LKZA 3MB4A 5LVRA 4NYVA 4LYSA 4A9JA 4O70A 5FE4A 5CUEA 4YK0A 2DWWA 5E3DA 5L98A 5HLSA 5EQ1A 3SVGA 4QR5A 4PCEA 5CQ6A 2G4AA 3U5JA 4TQNA 4O7AA 3IU6A 5K29A 5D3NA 5HQ6A 4QSQA 4J1PA 5IIDA 5II2A 5E9VA 5F1LA 4WHUA 5D3LA 4LZRA 4PS5A 2YQDA 5ACYA 4LC2A 5I7YA 5CQ3A 5E0RA 5COIA 5EISA 4YAXA 5ENJA 2I8NA 2DATA 4O74A 4O7CA 3U5MA 5FG5A 5CU8A 4A9LA 2RS9B 5I86A 4KCXA 5CUCA 3U5PA 5FH6A 4J0RA 4MR3A 3O34A 4NR8A 4TT4A 5AD2A 5IGKA 3Q2EA 5H85A 5HFRA 4NR9A 4YYNA 5F61A 5C85A 5II1A 5F63A 2N9GA 5EVAA 5E74A 2E3KA 4LR6A 5EWDA 4LZ2A 5G4SA 5L8TA 2WP2A 5DW2A 4LYIA 4HXOA 4Z1QA 3NXBA 4YYKA 2R0VA 4LDFA 2D9EA 5ENHA 4UIYA 4IOQA 5KTUA 5CS8A 4YADA 4QSXA 5JI8A 4YH3A 3U5LA 2GRCA 4Q0NA 5CZGA 4YYJA 5DYUA 5H1VA 4NYXA 4MR4A 1ZS5A 4NRAA 4A9OA 4YYDA 3FKMX 4HBVA 4Q0OA 3ONIA 4YATA 5ETBA 5D26A 3QZSA 4CUSA 3G0LA 3I3JA 5IGNA 4TZ8A 5KU3A 4TU4A 5E73A 4PCIA 2OSSA 5FDZA 2YEKA 5DFBA 5EK9A 4UYGA 2DVQA 2LSPB 4MR5A 5IGMA 5E7DA 4YBSA 5D3SA 2R10A 4UYFA 4IOOA 4PTBA 5CRMA 4MENA 3UV5A 2DKWA 3JVKA 5CGPA 5DYCA 4QSRA 5EPBA 5CQ5A 5TB6A 5LVQA 4HXKA 4TT2A 5D3HA 5AMEA 2NXBA 5ETDA 5EU1A 3UV2A 4IR6A 5DYXA 2YDWA 4YY4A 3LXJA 5E3GA 5G4RA 3K2JA 3MULA 5EICA 3G0JA 5DKCA 4TTEA 5H1UA 4O7FA 4NR4A 4NUDA 3QZVA 5DFDA 5LJ1A 5A5SA 4FLPA 4QR3A 5CUGA 4YBTA 2RNWA 5HM0A 5KO4A 3Q2FA 4KV1A 4Z93A 4ALGA 2L5EA 5I1QA 3DWYA 1F68A 2I7KA 4UIUA 2DVRA 3HMEA 1JSPB 4UYDA 4HBXA 4N4FA 5EWWA 5HQ7A 4LZSA 3P1EA 5KHMA 2YW5A 5CUBA 5AMFA 4BW2A 4QSTA 5DYAA 5EM3A 4A9NA 5FG6A 5LKUA 3UV4A 3P1DA 5DFCA 5L97A 5D25A 5C8GA 4UYEA 5FE2A 4QEUA 5D7XA 2R0SA 4QC3A 4NRBA 4XYAA 1JM4B 4MEPA 4QSPA 4QBMA 5A81A 4OGIA 5CQ7A 3P1FA 3SVHA 5A5OA 4NRCA 3MQMA 4QUTA 5CTLA 5EP7A 5E9YA 4YYMA 2OO1A 4CFLA 5AD3A 4QSUA 4QUUA 5I89A 1EQFA 4MEQA 4NUCA 4A9KA 5DY7A 5EPSA 4ZQLA 4O7BA 4ZW1A 2R0YA 4YY6A 4O78A 4C66A 5E9LA 4QNSA 1N72A 4UIXA 5IBNA 4CURA 5LUUA 5F3AA 4PKLA 5JWMA 4Z6HA 5L99A 3U5OA 5CQAA 4TYLA 4XUAA 5C87A 3ZYUA 5A7CA 4QYLA 4BHWA 4TS8A 4HBWA 3MUKA 5DLZA 5FB1A 3JVJA 4O76A 4TZ2A 4E96A 5CUDA 4ZC9A 3U5NA 4TT6A 5I80A 3IU5A 4QR4A 3P1CA 5LJ0A 3U5KA 5C4QA 5FG4A 4QZSA 3LQJA 5DBMA 4YYGA 5EA1A 5ENEA 5A83A 5CPEA 5CFWA 4WHWA 2RO1A 2YEMA 2OUOA 5EGUA 5KTXA 2MJVB 4CUPA 5FH7A 5HELA 3UVWA 4RVRA 4NYWA 4XY8A 4NS5A 4YC9A 4YYIA 4HXSA 2H60A 5ENFA 2DVVA 5FFYA 3MB3A 2D82A 5F5ZA 5A5QA 4O7EA 4TU6A 5E9IA 4X2IA 5IG6A 4ALHA 5HQ5A 4F3IA 3AQAA 4NXJA 4QSWA 4O71A 5EV9A 4DONA 5LKXA 4UIZA 4XUBA 4BW3A 4HXRA 5I7XA 5FE6A 5CQ8A 3RCWA 5ENBA 4CLBA 5TCMA 3HMHA 4OGJA 5BT4A 5HJCA 5J0DA 3JVMA 4HXLA 4YH4A 5F60A 3GG3A 3AADA 4QSSA 4GPJA 3D7CA 4N3WA 4Y03A 3O37A 2L84A 5LJ2A 5FE8A 5FFVA 4A9EA 3O36A 5L8UA 5A5PA 5IGLA 2FSAA 4Z6IA 5KTWA 5A5RA 2RI7A 2RNYA 4CUUA 5F25A 4XY9A 5EWVA 4J0SA 4QB3A 3UVXA 5EPRA 5CY9A 2L85A 5DKDA 5DW1A 5A85A 3QZTA 4IR4A 5FE7A 1X0JA 2KTBB 5FH8A 4UYFB 3HMFA 3LQHA 5BT5A 5A5NA 3LJWA 4IR3A 3S91A 4NR5A 4NR7A 5FFWA 3DAIA 5EWHA 4YBMA 4CL9A 5L96A 4N4IA 2E7OA 5HFQA 4A9HA 4CUTA 4IORA 4BW1A 4J3IA 5D24A 5CRZA 5FE9A 5HRWA 4O75A 4UYHA 5HRVA 5D3JA 5D3TA 4YYHA 3MXFA 5BT3A 5CQ4A 5CQTA 2RNXA 5LKTA 5H1TA 4QC1A 4CUQA 3JVLA 3O33A 4N4HA 5I29A 4N4GA 5FE0A 4QY4A 4BW4A 5EWCA 5E9MA 1WUMA 5F2PA 4MR6A 4NQNA 4Z1SA 4A9FA 5HEMA 4HBYA 3UVDA 5HRXA 5CP5A 4HXNA 5D3RA 5ENGA 5FE3A 5DX4A 5F62A 4HXPA 4A9MA 4QYDA 4QEWA 5F1HA 2WP1A 4O77A 5HCLA 3TLPA 3UW9A 4O72A 4NUEA 5D3PA 5I40A 3LQIA 3P5OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CUA A;  4LRG A;  4A9I A;  5A82 A;  5FE1 A;  5I88 A;  5DKH A;  4NR6 A;  4HXM A;  5FB0 A;  4C67 A;  5C7N A;  1E6I A;  5DLX A;  4CFK A;  2YEL A;  4UIW A;  2DVS A;  4AKN A;  5E9K A;  5ENI A;  5C89 A;  2E7N A;  4LYW A;  2F6N A;  4BJX A;  4OUF A;  4QEV A;  5F36 A;  4UIV A;  5I83 A;  4QSV A;  3S92 A;  4PY6 A;  2F6J A;  4IR5 A;  4MEO A;  1WUG A;  3SVF A;  5D0C A;  5EI4 A;  4KV4 A;  4UIT A;  5HEN A;  3O35 A;  5ENC A;  3UVY A;  2RFJ A;  5FBX A;  4YAB A;  4NQM A;  5FE5 A;  2YYN A;  4WIV A;  5LKZ A;  3MB4 A;  5LVR A;  4NYV A;  4LYS A;  4A9J A;  4O70 A;  5FE4 A;  5CUE A;  4YK0 A;  2DWW A;  5E3D A;  5L98 A;  5HLS A;  5EQ1 A;  3SVG A;  4QR5 A;  4PCE A;  5CQ6 A;  2G4A A;  3U5J A;  4TQN A;  4O7A A;  3IU6 A;  5K29 A;  5D3N A;  5HQ6 A;  4QSQ A;  4J1P A;  5IID A;  5II2 A;  5E9V A;  5F1L A;  4WHU A;  5D3L A;  4LZR A;  4PS5 A;  2YQD A;  5ACY A;  4LC2 A;  5I7Y A;  5CQ3 A;  5E0R A;  5COI A;  5EIS A;  4YAX A;  5ENJ A;  2I8N A;  2DAT A;  4O74 A;  4O7C A;  3U5M A;  5FG5 A;  5CU8 A;  4A9L A;  2RS9 B;  5I86 A;  4KCX A;  5CUC A;  3U5P A;  5FH6 A;  4J0R A;  4MR3 A;  3O34 A;  4NR8 A;  4TT4 A;  5AD2 A;  5IGK A;  3Q2E A;  5H85 A;  5HFR A;  4NR9 A;  4YYN A;  5F61 A;  5C85 A;  5II1 A;  5F63 A;  2N9G A;  5EVA A;  5E74 A;  2E3K A;  4LR6 A;  5EWD A;  4LZ2 A;  5G4S A;  5L8T A;  2WP2 A;  5DW2 A;  4LYI A;  4HXO A;  4Z1Q A;  3NXB A;  4YYK A;  2R0V A;  4LDF A;  2D9E A;  5ENH A;  4UIY A;  4IOQ A;  5KTU A;  5CS8 A;  4YAD A;  4QSX A;  5JI8 A;  4YH3 A;  3U5L A;  2GRC A;  4Q0N A;  5CZG A;  4YYJ A;  5DYU A;  5H1V A;  4NYX A;  4MR4 A;  1ZS5 A;  4NRA A;  4A9O A;  4YYD A;  3FKM X;  4HBV A;  4Q0O A;  3ONI A;  4YAT A;  5ETB A;  5D26 A;  3QZS A;  4CUS A;  3G0L A;  3I3J A;  5IGN A;  4TZ8 A;  5KU3 A;  4TU4 A;  5E73 A;  4PCI A;  2OSS A;  5FDZ A;  2YEK A;  5DFB A;  5EK9 A;  4UYG A;  2DVQ A;  2LSP B;  4MR5 A;  5IGM A;  5E7D A;  4YBS A;  5D3S A;  2R10 A;  4UYF A;  4IOO A;  4PTB A;  5CRM A;  4MEN A;  3UV5 A;  2DKW A;  3JVK A;  5CGP A;  5DYC A;  4QSR A;  5EPB A;  5CQ5 A;  5TB6 A;  5LVQ A;  4HXK A;  4TT2 A;  5D3H A;  5AME A;  2NXB A;  5ETD A;  5EU1 A;  3UV2 A;  4IR6 A;  5DYX A;  2YDW A;  4YY4 A;  3LXJ A;  5E3G A;  5G4R A;  3K2J A;  3MUL A;  5EIC A;  3G0J A;  5DKC A;  4TTE A;  5H1U A;  4O7F A;  4NR4 A;  4NUD A;  3QZV A;  5DFD A;  5LJ1 A;  5A5S A;  4FLP A;  4QR3 A;  5CUG A;  4YBT A;  2RNW A;  5HM0 A;  5KO4 A;  3Q2F A;  4KV1 A;  4Z93 A;  4ALG A;  2L5E A;  5I1Q A;  3DWY A;  1F68 A;  2I7K A;  4UIU A;  2DVR A;  3HME A;  1JSP B;  4UYD A;  4HBX A;  4N4F A;  5EWW A;  5HQ7 A;  4LZS A;  3P1E A;  5KHM A;  2YW5 A;  5CUB A;  5AMF A;  4BW2 A;  4QST A;  5DYA A;  5EM3 A;  4A9N A;  5FG6 A;  5LKU A;  3UV4 A;  3P1D A;  5DFC A;  5L97 A;  5D25 A;  5C8G A;  4UYE A;  5FE2 A;  4QEU A;  5D7X A;  2R0S A;  4QC3 A;  4NRB A;  4XYA A;  1JM4 B;  4MEP A;  4QSP A;  4QBM A;  5A81 A;  4OGI A;  5CQ7 A;  3P1F A;  3SVH A;  5A5O A;  4NRC A;  3MQM A;  4QUT A;  5CTL A;  5EP7 A;  5E9Y A;  4YYM A;  2OO1 A;  4CFL A;  5AD3 A;  4QSU A;  4QUU A;  5I89 A;  1EQF A;  4MEQ A;  4NUC A;  4A9K A;  5DY7 A;  5EPS A;  4ZQL A;  4O7B A;  4ZW1 A;  2R0Y A;  4YY6 A;  4O78 A;  4C66 A;  5E9L A;  4QNS A;  1N72 A;  4UIX A;  5IBN A;  4CUR A;  5LUU A;  5F3A A;  4PKL A;  5JWM A;  4Z6H A;  5L99 A;  3U5O A;  5CQA A;  4TYL A;  4XUA A;  5C87 A;  3ZYU A;  5A7C A;  4QYL A;  4BHW A;  4TS8 A;  4HBW A;  3MUK A;  5DLZ A;  5FB1 A;  3JVJ A;  4O76 A;  4TZ2 A;  4E96 A;  5CUD A;  4ZC9 A;  3U5N A;  4TT6 A;  5I80 A;  3IU5 A;  4QR4 A;  3P1C A;  5LJ0 A;  3U5K A;  5C4Q A;  5FG4 A;  4QZS A;  3LQJ A;  5DBM A;  4YYG A;  5EA1 A;  5ENE A;  5A83 A;  5CPE A;  5CFW A;  4WHW A;  2RO1 A;  2YEM A;  2OUO A;  5EGU A;  5KTX A;  2MJV B;  4CUP A;  5FH7 A;  5HEL A;  3UVW A;  4RVR A;  4NYW A;  4XY8 A;  4NS5 A;  4YC9 A;  4YYI A;  4HXS A;  2H60 A;  5ENF A;  2DVV A;  5FFY A;  3MB3 A;  2D82 A;  5F5Z A;  5A5Q A;  4O7E A;  4TU6 A;  5E9I A;  4X2I A;  5IG6 A;  4ALH A;  5HQ5 A;  4F3I A;  3AQA A;  4NXJ A;  4QSW A;  4O71 A;  5EV9 A;  4DON A;  5LKX A;  4UIZ A;  4XUB A;  4BW3 A;  4HXR A;  5I7X A;  5FE6 A;  5CQ8 A;  3RCW A;  5ENB A;  4CLB A;  5TCM A;  3HMH A;  4OGJ A;  5BT4 A;  5HJC A;  5J0D A;  3JVM A;  4HXL A;  4YH4 A;  5F60 A;  3GG3 A;  3AAD A;  4QSS A;  4GPJ A;  3D7C A;  4N3W A;  4Y03 A;  3O37 A;  2L84 A;  5LJ2 A;  5FE8 A;  5FFV A;  4A9E A;  3O36 A;  5L8U A;  5A5P A;  5IGL A;  2FSA A;  4Z6I A;  5KTW A;  5A5R A;  2RI7 A;  2RNY A;  4CUU A;  5F25 A;  4XY9 A;  5EWV A;  4J0S A;  4QB3 A;  3UVX A;  5EPR A;  5CY9 A;  2L85 A;  5DKD A;  5DW1 A;  5A85 A;  3QZT A;  4IR4 A;  5FE7 A;  1X0J A;  2KTB B;  5FH8 A;  4UYF B;  3HMF A;  3LQH A;  5BT5 A;  5A5N A;  3LJW A;  4IR3 A;  3S91 A;  4NR5 A;  4NR7 A;  5FFW A;  3DAI A;  5EWH A;  4YBM A;  4CL9 A;  5L96 A;  4N4I A;  2E7O A;  5HFQ A;  4A9H A;  4CUT A;  4IOR A;  4BW1 A;  4J3I A;  5D24 A;  5CRZ A;  5FE9 A;  5HRW A;  4O75 A;  4UYH A;  5HRV A;  5D3J A;  5D3T A;  4YYH A;  3MXF A;  5BT3 A;  5CQ4 A;  5CQT A;  2RNX A;  5LKT A;  5H1T A;  4QC1 A;  4CUQ A;  3JVL A;  3O33 A;  4N4H A;  5I29 A;  4N4G A;  5FE0 A;  4QY4 A;  4BW4 A;  5EWC A;  5E9M A;  1WUM A;  5F2P A;  4MR6 A;  4NQN A;  4Z1S A;  4A9F A;  5HEM A;  4HBY A;  3UVD A;  5HRX A;  5CP5 A;  4HXN A;  5D3R A;  5ENG A;  5FE3 A;  5DX4 A;  5F62 A;  4HXP A;  4A9M A;  4QYD A;  4QEW A;  5F1H A;  2WP1 A;  4O77 A;  5HCL A;  3TLP A;  3UW9 A;  4O72 A;  4NUE A;  5D3P A;  5I40 A;  3LQI A;  3P5O A; 
#chains in the Genus database with same CATH topology
 5CUA A;  4LRG A;  4A9I A;  5A82 A;  5FE1 A;  5I88 A;  5DKH A;  4NR6 A;  4HXM A;  5FB0 A;  4C67 A;  5C7N A;  1E6I A;  5DLX A;  4CFK A;  2YEL A;  4UIW A;  2DVS A;  4AKN A;  5E9K A;  5ENI A;  5C89 A;  2E7N A;  4LYW A;  2F6N A;  4BJX A;  4OUF A;  4QEV A;  5F36 A;  4UIV A;  5I83 A;  4QSV A;  2EJN A;  3S92 A;  4PY6 A;  2F6J A;  4IR5 A;  4MEO A;  1WUG A;  3SVF A;  5D0C A;  5EI4 A;  4KV4 A;  4UIT A;  3VKG A;  5HEN A;  3O35 A;  5ENC A;  3UVY A;  2RFJ A;  5FBX A;  4YAB A;  4NQM A;  5FE5 A;  4AKH A;  2YYN A;  4WIV A;  5LKZ A;  3MB4 A;  5LVR A;  4NYV A;  4LYS A;  4AI6 A;  4A9J A;  4O70 A;  5FE4 A;  5CUE A;  4YK0 A;  2DWW A;  5E3D A;  5L98 A;  5HLS A;  5EQ1 A;  3SVG A;  4QR5 A;  4PCE A;  5CQ6 A;  2G4A A;  3U5J A;  4TQN A;  4O7A A;  3IU6 A;  5K29 A;  5D3N A;  5HQ6 A;  4QSQ A;  4J1P A;  5IID A;  5II2 A;  5E9V A;  5F1L A;  4WHU A;  5D3L A;  4LZR A;  4PS5 A;  2YQD A;  5ACY A;  4LC2 A;  5I7Y A;  5CQ3 A;  5E0R A;  5COI A;  5EIS A;  4YAX A;  5ENJ A;  2I8N A;  2DAT A;  4O74 A;  4O7C A;  3U5M A;  5FG5 A;  5CU8 A;  4A9L A;  2RS9 B;  3D1B A;  5I86 A;  4KCX A;  5CUC A;  3U5P A;  5FH6 A;  4J0R A;  4MR3 A;  3O34 A;  4NR8 A;  4TT4 A;  5AD2 A;  5IGK A;  3Q2E A;  5H85 A;  5HFR A;  4NR9 A;  4YYN A;  5F61 A;  5C85 A;  5II1 A;  5F63 A;  2N9G A;  5EVA A;  3ERR A;  5E74 A;  2E3K A;  4LR6 A;  5EWD A;  4LZ2 A;  5G4S A;  5L8T A;  2WP2 A;  5DW2 A;  4LYI A;  4HXO A;  4Z1Q A;  3NXB A;  4YYK A;  2R0V A;  4LDF A;  2D9E A;  5ENH A;  4UIY A;  4IOQ A;  5KTU A;  5CS8 A;  4YAD A;  4QSX A;  5JI8 A;  4YH3 A;  3U5L A;  2GRC A;  4Q0N A;  5CZG A;  4YYJ A;  5DYU A;  5H1V A;  4NYX A;  4MR4 A;  1ZS5 A;  4NRA A;  4A9O A;  4YYD A;  3FKM X;  4HBV A;  4Q0O A;  3ONI A;  4YAT A;  5ETB A;  5D26 A;  3QZS A;  4CUS A;  3G0L A;  3I3J A;  5IGN A;  4TZ8 A;  5KU3 A;  4TU4 A;  5E73 A;  4PCI A;  2OSS A;  5FDZ A;  2YEK A;  5DFB A;  5EK9 A;  4UYG A;  2DVQ A;  2LSP B;  4MR5 A;  5IGM A;  5E7D A;  4YBS A;  5D3S A;  2R10 A;  4UYF A;  4IOO A;  4PTB A;  5CRM A;  4MEN A;  3UV5 A;  2DKW A;  3JVK A;  5CGP A;  5DYC A;  4QSR A;  5EPB A;  5CQ5 A;  5TB6 A;  5LVQ A;  4HXK A;  4TT2 A;  5D3H A;  5AME A;  2NXB A;  5ETD A;  5EU1 A;  3UV2 A;  4IR6 A;  5DYX A;  2YDW A;  4YY4 A;  3LXJ A;  5E3G A;  5G4R A;  3K2J A;  3MUL A;  5EIC A;  3G0J A;  5DKC A;  4TTE A;  5H1U A;  4O7F A;  4NR4 A;  4NUD A;  3QZV A;  5DFD A;  5LJ1 A;  4AKI A;  5A5S A;  4FLP A;  4QR3 A;  5CUG A;  4YBT A;  2RNW A;  5HM0 A;  5KO4 A;  3Q2F A;  4KV1 A;  4Z93 A;  4ALG A;  2L5E A;  5I1Q A;  3DWY A;  1F68 A;  2I7K A;  4UIU A;  2DVR A;  3HME A;  1JSP B;  4UYD A;  4HBX A;  4N4F A;  5EWW A;  5HQ7 A;  4LZS A;  3P1E A;  5KHM A;  2YW5 A;  5CUB A;  5AMF A;  4BW2 A;  4QST A;  5DYA A;  5EM3 A;  4A9N A;  5FG6 A;  5LKU A;  3UV4 A;  3P1D A;  5DFC A;  5L97 A;  5D25 A;  5C8G A;  4UYE A;  5FE2 A;  4QEU A;  5D7X A;  2R0S A;  4QC3 A;  4NRB A;  4XYA A;  1JM4 B;  4MEP A;  4QSP A;  4QBM A;  5A81 A;  4OGI A;  5CQ7 A;  3P1F A;  3SVH A;  5A5O A;  4NRC A;  3MQM A;  4QUT A;  5CTL A;  5EP7 A;  5E9Y A;  4YYM A;  2OO1 A;  4CFL A;  5AD3 A;  4QSU A;  4QUU A;  5I89 A;  1EQF A;  4MEQ A;  4NUC A;  4A9K A;  5DY7 A;  5EPS A;  4ZQL A;  4O7B A;  4ZW1 A;  2R0Y A;  4YY6 A;  4O78 A;  4C66 A;  5E9L A;  4QNS A;  1N72 A;  4UIX A;  5IBN A;  4CUR A;  5LUU A;  5F3A A;  4PKL A;  5JWM A;  4Z6H A;  5L99 A;  3U5O A;  5CQA A;  4TYL A;  4XUA A;  5C87 A;  3ZYU A;  5A7C A;  4QYL A;  4BHW A;  4TS8 A;  4HBW A;  3MUK A;  5DLZ A;  5FB1 A;  3JVJ A;  4O76 A;  4TZ2 A;  4E96 A;  5CUD A;  4ZC9 A;  3U5N A;  4TT6 A;  5I80 A;  3IU5 A;  4QR4 A;  3P1C A;  1ZKR A;  5LJ0 A;  3U5K A;  5C4Q A;  5FG4 A;  4QZS A;  3LQJ A;  5DBM A;  4YYG A;  5EA1 A;  5ENE A;  5A83 A;  5CPE A;  5CFW A;  1PUO A;  4WHW A;  2RO1 A;  2YEM A;  2OUO A;  5EGU A;  5KTX A;  2MJV B;  4CUP A;  5FH7 A;  5HEL A;  3UVW A;  4RVR A;  4NYW A;  4XY8 A;  4NS5 A;  4YC9 A;  4YYI A;  4HXS A;  2H60 A;  5ENF A;  2DVV A;  5FFY A;  3MB3 A;  3VKH A;  2D82 A;  5F5Z A;  5A5Q A;  4O7E A;  4TU6 A;  5E9I A;  4X2I A;  5IG6 A;  4ALH A;  5HQ5 A;  4F3I A;  3AQA A;  4NXJ A;  4QSW A;  4O71 A;  5EV9 A;  4DON A;  5LKX A;  4UIZ A;  4XUB A;  4BW3 A;  4HXR A;  5I7X A;  4AKG A;  5FE6 A;  5CQ8 A;  3RCW A;  5ENB A;  4CLB A;  5TCM A;  3HMH A;  4OGJ A;  5BT4 A;  5HJC A;  5J0D A;  3JVM A;  4HXL A;  4YH4 A;  5F60 A;  3GG3 A;  3AAD A;  4QSS A;  4GPJ A;  3D7C A;  4N3W A;  4Y03 A;  3O37 A;  2L84 A;  5LJ2 A;  5FE8 A;  5FFV A;  4A9E A;  3O36 A;  5L8U A;  5A5P A;  5IGL A;  2FSA A;  4Z6I A;  5KTW A;  5A5R A;  2RI7 A;  2RNY A;  4CUU A;  5F25 A;  4XY9 A;  5EWV A;  4J0S A;  4QB3 A;  3UVX A;  5EPR A;  5CY9 A;  2L85 A;  5DKD A;  5DW1 A;  5A85 A;  3QZT A;  4IR4 A;  5FE7 A;  1X0J A;  2KTB B;  5FH8 A;  4UYF B;  3HMF A;  3LQH A;  5BT5 A;  5A5N A;  3LJW A;  4IR3 A;  3S91 A;  4NR5 A;  4NR7 A;  5FFW A;  3DAI A;  5EWH A;  4YBM A;  4CL9 A;  5L96 A;  4N4I A;  2E7O A;  5HFQ A;  4A9H A;  4CUT A;  4IOR A;  4BW1 A;  4J3I A;  5D24 A;  5CRZ A;  5FE9 A;  3D1D A;  4O75 A;  5HRW A;  4UYH A;  5HRV A;  5D3J A;  5D3T A;  4YYH A;  3MXF A;  5BT3 A;  5CQ4 A;  5CQT A;  2RNX A;  5LKT A;  5H1T A;  4QC1 A;  4CUQ A;  3JVL A;  3O33 A;  4N4H A;  5I29 A;  4N4G A;  5FE0 A;  4QY4 A;  4BW4 A;  5EWC A;  5E9M A;  1WUM A;  5F2P A;  4MR6 A;  4NQN A;  4Z1S A;  4A9F A;  5HEM A;  4HBY A;  3UVD A;  5HRX A;  5CP5 A;  4HXN A;  5D3R A;  5ENG A;  5FE3 A;  5DX4 A;  5F62 A;  4HXP A;  4A9M A;  4QYD A;  4QEW A;  5F1H A;  2WP1 A;  4O77 A;  5HCL A;  3TLP A;  3UW9 A;  4O72 A;  4NUE A;  5D3P A;  5I40 A;  3LQI A;  3P5O A; 
#chains in the Genus database with same CATH homology
 5CUA A;  4LRG A;  4A9I A;  5A82 A;  5FE1 A;  5I88 A;  5DKH A;  4NR6 A;  4HXM A;  5FB0 A;  4C67 A;  5C7N A;  1E6I A;  5DLX A;  4CFK A;  2YEL A;  4UIW A;  2DVS A;  4AKN A;  5E9K A;  5ENI A;  5C89 A;  2E7N A;  4LYW A;  2F6N A;  4BJX A;  4OUF A;  4QEV A;  5F36 A;  4UIV A;  5I83 A;  4QSV A;  3S92 A;  4PY6 A;  2F6J A;  4IR5 A;  4MEO A;  1WUG A;  3SVF A;  5D0C A;  5EI4 A;  4KV4 A;  4UIT A;  5HEN A;  3O35 A;  5ENC A;  3UVY A;  2RFJ A;  5FBX A;  4YAB A;  4NQM A;  5FE5 A;  2YYN A;  4WIV A;  5LKZ A;  3MB4 A;  5LVR A;  4NYV A;  4LYS A;  4A9J A;  4O70 A;  5FE4 A;  5CUE A;  4YK0 A;  2DWW A;  5E3D A;  5L98 A;  5HLS A;  5EQ1 A;  3SVG A;  4QR5 A;  4PCE A;  5CQ6 A;  2G4A A;  3U5J A;  4TQN A;  4O7A A;  3IU6 A;  5K29 A;  5D3N A;  5HQ6 A;  4QSQ A;  4J1P A;  5IID A;  5II2 A;  5E9V A;  5F1L A;  4WHU A;  5D3L A;  4LZR A;  4PS5 A;  2YQD A;  5ACY A;  4LC2 A;  5I7Y A;  5CQ3 A;  5E0R A;  5COI A;  5EIS A;  4YAX A;  5ENJ A;  2I8N A;  2DAT A;  4O74 A;  4O7C A;  3U5M A;  5FG5 A;  5CU8 A;  4A9L A;  2RS9 B;  5I86 A;  4KCX A;  5CUC A;  3U5P A;  5FH6 A;  4J0R A;  4MR3 A;  3O34 A;  4NR8 A;  4TT4 A;  5AD2 A;  5IGK A;  3Q2E A;  5H85 A;  5HFR A;  4NR9 A;  4YYN A;  5F61 A;  5C85 A;  5II1 A;  5F63 A;  2N9G A;  5EVA A;  5E74 A;  2E3K A;  4LR6 A;  5EWD A;  4LZ2 A;  5G4S A;  5L8T A;  2WP2 A;  5DW2 A;  4LYI A;  4HXO A;  4Z1Q A;  3NXB A;  4YYK A;  2R0V A;  4LDF A;  2D9E A;  5ENH A;  4UIY A;  4IOQ A;  5KTU A;  5CS8 A;  4YAD A;  4QSX A;  5JI8 A;  4YH3 A;  3U5L A;  2GRC A;  4Q0N A;  5CZG A;  4YYJ A;  5DYU A;  5H1V A;  4NYX A;  4MR4 A;  1ZS5 A;  4NRA A;  4A9O A;  4YYD A;  3FKM X;  4HBV A;  4Q0O A;  3ONI A;  4YAT A;  5ETB A;  5D26 A;  3QZS A;  4CUS A;  3G0L A;  3I3J A;  5IGN A;  4TZ8 A;  5KU3 A;  4TU4 A;  5E73 A;  4PCI A;  2OSS A;  5FDZ A;  2YEK A;  5DFB A;  5EK9 A;  4UYG A;  2DVQ A;  2LSP B;  4MR5 A;  5IGM A;  5E7D A;  4YBS A;  5D3S A;  2R10 A;  4UYF A;  4IOO A;  4PTB A;  5CRM A;  4MEN A;  3UV5 A;  2DKW A;  3JVK A;  5CGP A;  5DYC A;  4QSR A;  5EPB A;  5CQ5 A;  5TB6 A;  5LVQ A;  4HXK A;  4TT2 A;  5D3H A;  5AME A;  2NXB A;  5ETD A;  5EU1 A;  3UV2 A;  4IR6 A;  5DYX A;  2YDW A;  4YY4 A;  3LXJ A;  5E3G A;  5G4R A;  3K2J A;  3MUL A;  5EIC A;  3G0J A;  5DKC A;  4TTE A;  5H1U A;  4O7F A;  4NR4 A;  4NUD A;  3QZV A;  5DFD A;  5LJ1 A;  5A5S A;  4FLP A;  4QR3 A;  5CUG A;  4YBT A;  2RNW A;  5HM0 A;  5KO4 A;  3Q2F A;  4KV1 A;  4Z93 A;  4ALG A;  2L5E A;  5I1Q A;  3DWY A;  1F68 A;  2I7K A;  4UIU A;  2DVR A;  3HME A;  1JSP B;  4UYD A;  4HBX A;  4N4F A;  5EWW A;  5HQ7 A;  4LZS A;  3P1E A;  5KHM A;  2YW5 A;  5CUB A;  5AMF A;  4BW2 A;  4QST A;  5DYA A;  5EM3 A;  4A9N A;  5FG6 A;  5LKU A;  3UV4 A;  3P1D A;  5DFC A;  5L97 A;  5D25 A;  5C8G A;  4UYE A;  5FE2 A;  4QEU A;  5D7X A;  2R0S A;  4QC3 A;  4NRB A;  4XYA A;  1JM4 B;  4MEP A;  4QSP A;  4QBM A;  5A81 A;  4OGI A;  5CQ7 A;  3P1F A;  3SVH A;  5A5O A;  4NRC A;  3MQM A;  4QUT A;  5CTL A;  5EP7 A;  5E9Y A;  4YYM A;  2OO1 A;  4CFL A;  5AD3 A;  4QSU A;  4QUU A;  5I89 A;  1EQF A;  4MEQ A;  4NUC A;  4A9K A;  5DY7 A;  5EPS A;  4ZQL A;  4O7B A;  4ZW1 A;  2R0Y A;  4YY6 A;  4O78 A;  4C66 A;  5E9L A;  4QNS A;  1N72 A;  4UIX A;  5IBN A;  4CUR A;  5LUU A;  5F3A A;  4PKL A;  5JWM A;  4Z6H A;  5L99 A;  3U5O A;  5CQA A;  4TYL A;  4XUA A;  5C87 A;  3ZYU A;  5A7C A;  4QYL A;  4BHW A;  4TS8 A;  4HBW A;  3MUK A;  5DLZ A;  5FB1 A;  3JVJ A;  4O76 A;  4TZ2 A;  4E96 A;  5CUD A;  4ZC9 A;  3U5N A;  4TT6 A;  5I80 A;  3IU5 A;  4QR4 A;  3P1C A;  5LJ0 A;  3U5K A;  5C4Q A;  5FG4 A;  4QZS A;  3LQJ A;  5DBM A;  4YYG A;  5EA1 A;  5ENE A;  5A83 A;  5CPE A;  5CFW A;  4WHW A;  2RO1 A;  2YEM A;  2OUO A;  5EGU A;  5KTX A;  2MJV B;  4CUP A;  5FH7 A;  5HEL A;  3UVW A;  4RVR A;  4NYW A;  4XY8 A;  4NS5 A;  4YC9 A;  4YYI A;  4HXS A;  2H60 A;  5ENF A;  2DVV A;  5FFY A;  3MB3 A;  2D82 A;  5F5Z A;  5A5Q A;  4O7E A;  4TU6 A;  5E9I A;  4X2I A;  5IG6 A;  4ALH A;  5HQ5 A;  4F3I A;  3AQA A;  4NXJ A;  4QSW A;  4O71 A;  5EV9 A;  4DON A;  5LKX A;  4UIZ A;  4XUB A;  4BW3 A;  4HXR A;  5I7X A;  5FE6 A;  5CQ8 A;  3RCW A;  5ENB A;  4CLB A;  5TCM A;  3HMH A;  4OGJ A;  5BT4 A;  5HJC A;  5J0D A;  3JVM A;  4HXL A;  4YH4 A;  5F60 A;  3GG3 A;  3AAD A;  4QSS A;  4GPJ A;  3D7C A;  4N3W A;  4Y03 A;  3O37 A;  2L84 A;  5LJ2 A;  5FE8 A;  5FFV A;  4A9E A;  3O36 A;  5L8U A;  5A5P A;  5IGL A;  2FSA A;  4Z6I A;  5KTW A;  5A5R A;  2RI7 A;  2RNY A;  4CUU A;  5F25 A;  4XY9 A;  5EWV A;  4J0S A;  4QB3 A;  3UVX A;  5EPR A;  5CY9 A;  2L85 A;  5DKD A;  5DW1 A;  5A85 A;  3QZT A;  4IR4 A;  5FE7 A;  1X0J A;  2KTB B;  5FH8 A;  4UYF B;  3HMF A;  3LQH A;  5BT5 A;  5A5N A;  3LJW A;  4IR3 A;  3S91 A;  4NR5 A;  4NR7 A;  5FFW A;  3DAI A;  5EWH A;  4YBM A;  4CL9 A;  5L96 A;  4N4I A;  2E7O A;  5HFQ A;  4A9H A;  4CUT A;  4IOR A;  4BW1 A;  4J3I A;  5D24 A;  5CRZ A;  5FE9 A;  5HRW A;  4O75 A;  4UYH A;  5HRV A;  5D3J A;  5D3T A;  4YYH A;  3MXF A;  5BT3 A;  5CQ4 A;  5CQT A;  2RNX A;  5LKT A;  5H1T A;  4QC1 A;  4CUQ A;  3JVL A;  3O33 A;  4N4H A;  5I29 A;  4N4G A;  5FE0 A;  4QY4 A;  4BW4 A;  5EWC A;  5E9M A;  1WUM A;  5F2P A;  4MR6 A;  4NQN A;  4Z1S A;  4A9F A;  5HEM A;  4HBY A;  3UVD A;  5HRX A;  5CP5 A;  4HXN A;  5D3R A;  5ENG A;  5FE3 A;  5DX4 A;  5F62 A;  4HXP A;  4A9M A;  4QYD A;  4QEW A;  5F1H A;  2WP1 A;  4O77 A;  5HCL A;  3TLP A;  3UW9 A;  4O72 A;  4NUE A;  5D3P A;  5I40 A;  3LQI A;  3P5O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...