2I8NA

Solution structure of the second bromodomain of brd4
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
108
structure length
108
Chain Sequence
EQLKCCSGILKEMFAKKHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Replication, transcription regulator
molecule keywords Bromodomain-containing protein 4
publication title Solution structure of the second bromodomain of Brd4
rcsb
source organism Homo sapiens
total genus 29
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2006-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2i8nA00
5IGKA 4A9MA 1WUMA 3UV5A 4J0RA 2L85A 4O78A 4IR4A 5CQ5A 4YY4A 5I29A 4MEQA 2WP2A 5CQ8A 5FFYA 4OGJA 2FSAA 4QSUA 5A5RA 5DBMA 5I1QA 5KTWA 2D9EA 4A9LA 4TQNA 4TYLA 5DW1A 5LVRA 3AADA 5I7XA 3UVWA 4QYDA 2N9GA 4CURA 5IGNA 5I7YA 4HXMA 4C66A 3D7CA 3IU6A 5ENHA 4QR3A 4HXRA 4J3IA 5EWVA 4HBXA 4QSQA 4YBSA 5E9MA 2YYNA 5CUEA 4Y03A 5KO4A 4WIVA 4A9KA 5CUGA 5I86A 3Q2FA 3O33A 3UVDA 5J0DA 4J1PA 4O7CA 4QEVA 5E7DA 5EPSA 2YDWA 4QSVA 2RFJA 5FE1A 3RCWA 5HM0A 4YBTA 5F63A 5LKTA 1N72A 5A5SA 5F60A 5EM3A 5L96A 4A9NA 4NR8A 4O7AA 5I89A 2YEKA 5L97A 5CQTA 4NYWA 5DLZA 5BT3A 4QUTA 4CUPA 4NYVA 4N4IA 3JVJA 4TU4A 3UV4A 5EWDA 5FE5A 5IGLA 4MEOA 2E7OA 4X2IA 4LC2A 4O70A 4YYHA 4KCXA 1F68A 3NXBA 4TS8A 5HQ5A 5FG5A 4O75A 4C67A 3LJWA 2YELA 2E3KA 5C89A 3P1DA 4QSWA 4N4FA 4Q0NA 4QEUA 4MR6A 2DVVA 5DFCA 2RNXA 5F62A 4A9JA 4NXJA 4NRCA 3U5LA 3QZSA 3U5PA 5HCLA 4BJXA 4YYJA 3SVHA 3UVYA 5FH7A 4TT6A 5D3LA 4NQMA 3LQHA 5EQ1A 4QSRA 4AKNA 4XUBA 4ZC9A 5D3HA 4NR7A 2MJVB 5HRVA 4XY8A 4ALGA 4NR9A 5G4RA 5HRXA 5A5PA 2L5EA 2YEMA 5EGUA 5CTLA 4WHUA 5CQ7A 3P1EA 5LVQA 4BW2A 5FG4A 3MXFA 4UYEA 5FE2A 4QUUA 2I8NA 4TT4A 3UV2A 5FDZA 4TZ8A 3LQIA 4UIXA 5FH6A 4BHWA 5L8UA 5LKUA 5ENJA 5E74A 5JWMA 3MQMA 4YATA 3ONIA 4KV1A 4PCEA 4XY9A 4UYFB 5CY9A 2NXBA 3DAIA 4A9IA 5FB1A 4O77A 5D3SA 2WP1A 4QBMA 5FFVA 5CRMA 5CQ3A 3MULA 4IR5A 4WHWA 4YYDA 5ETBA 5F1HA 5D0CA 5AMFA 3DWYA 3UW9A 4BW1A 2DVRA 5KTUA 4TTEA 2E7NA 5EVAA 5EPBA 5ENFA 5EU1A 5E3GA 5CUBA 5E9YA 4TU6A 4LR6A 4NRBA 5IBNA 5LJ1A 4CL9A 4NYXA 5HRWA 2YW5A 4N3WA 4NRAA 2R0SA 4CUQA 5ENEA 4N4HA 4QSXA 5D3TA 4PKLA 4LZ2A 5E3DA 3JVKA 2KTBB 2F6NA 4CUSA 5LKZA 3O35A 4YABA 3P1CA 5EWHA 5F1LA 3U5JA 3JVLA 4A9OA 5HQ6A 4HXOA 4OGIA 4YYNA 5DY7A 2RNYA 4YAXA 5HQ7A 5BT4A 4QB3A 4O72A 4UYDA 5EA1A 5CQAA 4O7BA 5CQ6A 4YC9A 2R0YA 4XUAA 4QSSA 4QR4A 5A83A 4BW3A 3S91A 3G0LA 4QC3A 5C4QA 2DKWA 5FE8A 5HEMA 4N4GA 1X0JA 4NUEA 4UYGA 5AD2A 4J0SA 5D25A 1JSPB 5EI4A 2R0VA 4ALHA 4QZSA 4YBMA 5EWWA 4NUDA 4O7EA 4UIWA 5I83A 1EQFA 5CUAA 5LJ2A 4CFLA 5CQ4A 4CFKA 3LXJA 5E9KA 4MR5A 5C8GA 4UIVA 4IOOA 4IR3A 5IGMA 5HLSA 5FE0A 2DATA 4LYIA 4O74A 5HENA 4CLBA 4LRGA 5EISA 4BW4A 4QC1A 4ZW1A 4HBYA 1E6IA 3SVGA 4RVRA 5E73A 3LQJA 4MR4A 4UYFA 2RS9B 3G0JA 4QYLA 5F2PA 5DX4A 4E96A 5AD3A 5L8TA 5CU8A 5E9IA 4UITA 4YYMA 4LYWA 4UIUA 4O71A 4YADA 4HXKA 5I88A 5D3RA 5EPRA 2OUOA 4NR6A 5A85A 5FE6A 4Z1QA 2R10A 4QSTA 4UYHA 5DKCA 2OO1A 5D26A 5EK9A 2LSPB 5H85A 5H1TA 4YK0A 3I3JA 4YYGA 2F6JA 4MR3A 5TB6A 4Z93A 3O37A 3Q2EA 5F3AA 5A5NA 4YYKA 5DKDA 5E9LA 5I40A 5F25A 2H60A 5ETDA 5ENGA 4GPJA 5LJ0A 3SVFA 4NR4A 3GG3A 4UIZA 5COIA 4LDFA 2I7KA 4TT2A 4TZ2A 5LUUA 5DW2A 5EP7A 5DFBA 5ENBA 3O36A 4NQNA 5KHMA 5DKHA 4O7FA 5DYXA 3S92A 4HXPA 5D3JA 5HJCA 4QNSA 5CRZA 5KTXA 4IORA 5EV9A 2OSSA 4Q0OA 5D24A 5HFRA 1ZS5A 2DWWA 4HXSA 5HELA 2RNWA 2D82A 5FH8A 3P1FA 5CUCA 5FE7A 4ZQLA 5A5OA 5FFWA 5FE4A 5FE9A 5FBXA 5II1A 3HMFA 5ACYA 4QR5A 4PCIA 4PS5A 4A9HA 5TCMA 3IU5A 4HBWA 5C87A 2L84A 3HMEA 3FKMX 4IOQA 5C85A 4PY6A 1JM4B 4YYIA 4LZSA 4QEWA 4CUUA 5HFQA 4A9FA 5A5QA 1WUGA 4O76A 5K29A 5JI8A 2DVSA 4DONA 4YH3A 5L98A 4PTBA 5DFDA 4Z1SA 4YY6A 5FG6A 5CUDA 5FB0A 4IR6A 4QY4A 4UIYA 5II2A 5F5ZA 4HBVA 2GRCA 5CGPA 5FE3A 5I80A 5IIDA 3TLPA 4HXNA 3U5OA 5G4SA 4Z6IA 5ENIA 5IG6A 4OUFA 3O34A 5H1VA 4Z6HA 3AQAA 5EICA 5A81A 3U5MA 5F61A 5DYUA 4CUTA 4A9EA 4FLPA 5ENCA 5CPEA 3MB3A 5D3PA 4MEPA 3UVXA 5DYAA 3QZVA 5EWCA 3JVMA 2RI7A 5E9VA 4HXLA 4LYSA 5D3NA 4F3IA 3U5KA 5CS8A 4QSPA 4KV4A 5BT5A 5C7NA 3HMHA 5AMEA 3ZYUA 5A82A 4XYAA 4NS5A 5F36A 2G4AA 5D7XA 2YQDA 4MENA 4LZRA 4NR5A 5H1UA 3MB4A 2RO1A 4NUCA 3MUKA 5A7CA 5LKXA 5KU3A 5CP5A 3P5OA 5DYCA 4YH4A 3K2JA 5L99A 2DVQA 3U5NA 5DLXA 5CFWA 5E0RA 5CZGA 3QZTA
chains in the Genus database with same CATH superfamily
5IGKA 4A9MA 1WUMA 3UV5A 4J0RA 2L85A 4O78A 4IR4A 5CQ5A 4YY4A 5I29A 4MEQA 2WP2A 5CQ8A 5FFYA 4OGJA 2FSAA 4QSUA 5A5RA 5DBMA 5I1QA 5KTWA 2D9EA 4A9LA 4TQNA 4TYLA 5DW1A 5LVRA 3AADA 5I7XA 3UVWA 4QYDA 2N9GA 4CURA 5IGNA 5I7YA 4HXMA 3D1DA 4C66A 3D7CA 3IU6A 5ENHA 4QR3A 4HXRA 4J3IA 5EWVA 4HBXA 4QSQA 4YBSA 5E9MA 2YYNA 5CUEA 4Y03A 5KO4A 4WIVA 4A9KA 5CUGA 5I86A 3Q2FA 3O33A 3UVDA 5J0DA 4J1PA 4O7CA 4QEVA 5E7DA 5EPSA 2YDWA 4QSVA 2RFJA 5FE1A 3RCWA 5HM0A 4YBTA 5F63A 5LKTA 1N72A 5A5SA 5F60A 5EM3A 5L96A 4A9NA 4NR8A 4O7AA 5I89A 2YEKA 5L97A 5CQTA 4NYWA 5DLZA 5BT3A 4QUTA 4CUPA 4NYVA 4N4IA 3JVJA 4TU4A 3UV4A 5EWDA 5FE5A 5IGLA 4MEOA 2E7OA 4X2IA 4LC2A 4O70A 4YYHA 4KCXA 1F68A 3NXBA 4TS8A 5HQ5A 5FG5A 4O75A 4C67A 3LJWA 2YELA 2E3KA 5C89A 3P1DA 4QSWA 4N4FA 4Q0NA 4QEUA 4MR6A 2DVVA 5DFCA 2RNXA 5F62A 4A9JA 4NXJA 4NRCA 3U5LA 3QZSA 3U5PA 5HCLA 4BJXA 4YYJA 3SVHA 3UVYA 5FH7A 4TT6A 5D3LA 4NQMA 3LQHA 4AKGA 5EQ1A 4QSRA 4AKNA 4XUBA 4ZC9A 5D3HA 4NR7A 2MJVB 5HRVA 3ERRA 4XY8A 4ALGA 4NR9A 5G4RA 4AKIA 5HRXA 5A5PA 2L5EA 2YEMA 5EGUA 3VKGA 5CTLA 4WHUA 5CQ7A 3P1EA 5LVQA 4BW2A 5FG4A 3MXFA 4UYEA 5FE2A 4QUUA 2I8NA 4TT4A 3UV2A 5FDZA 4TZ8A 3LQIA 4UIXA 5FH6A 4BHWA 5L8UA 5LKUA 5ENJA 5E74A 5JWMA 3MQMA 4YATA 3ONIA 4KV1A 4PCEA 4XY9A 4UYFB 5CY9A 2NXBA 3DAIA 4A9IA 5FB1A 4O77A 5D3SA 2WP1A 4QBMA 5FFVA 5CRMA 5CQ3A 3MULA 4IR5A 4WHWA 4YYDA 5ETBA 5F1HA 5D0CA 5AMFA 3DWYA 3UW9A 4BW1A 2DVRA 5KTUA 4TTEA 2E7NA 5EVAA 1ZKRA 5EPBA 5ENFA 5EU1A 5E3GA 5CUBA 5E9YA 4TU6A 4LR6A 4NRBA 5IBNA 5LJ1A 4CL9A 4NYXA 5HRWA 2YW5A 4N3WA 4NRAA 2R0SA 4CUQA 5ENEA 4N4HA 4QSXA 5D3TA 4PKLA 4LZ2A 5E3DA 3JVKA 2KTBB 2F6NA 4CUSA 5LKZA 3O35A 4YABA 3P1CA 5EWHA 5F1LA 3U5JA 3JVLA 4A9OA 5HQ6A 4HXOA 4OGIA 4YYNA 5DY7A 2RNYA 4YAXA 5HQ7A 5BT4A 4QB3A 4O72A 4UYDA 5EA1A 5CQAA 4O7BA 5CQ6A 4YC9A 2R0YA 4XUAA 4QSSA 4QR4A 5A83A 4BW3A 3S91A 3G0LA 4QC3A 5C4QA 2DKWA 5FE8A 5HEMA 4N4GA 1X0JA 4NUEA 4UYGA 5AD2A 4J0SA 5D25A 1JSPB 5EI4A 2R0VA 4ALHA 4QZSA 4YBMA 5EWWA 4NUDA 4O7EA 4UIWA 5I83A 1EQFA 5CUAA 5LJ2A 4CFLA 5CQ4A 4CFKA 3LXJA 5E9KA 4MR5A 5C8GA 4UIVA 4IOOA 4IR3A 5IGMA 5HLSA 5FE0A 2DATA 4LYIA 4O74A 5HENA 4CLBA 4LRGA 5EISA 4BW4A 4QC1A 4ZW1A 4HBYA 1E6IA 3SVGA 4RVRA 5E73A 3LQJA 4MR4A 4UYFA 2RS9B 3VKHA 3G0JA 4QYLA 5F2PA 5DX4A 4E96A 5AD3A 5L8TA 5CU8A 5E9IA 4UITA 4YYMA 4LYWA 4UIUA 4O71A 4YADA 4HXKA 5I88A 5D3RA 5EPRA 2OUOA 4NR6A 5A85A 5FE6A 4Z1QA 2R10A 4QSTA 4UYHA 5DKCA 2OO1A 5D26A 5EK9A 2LSPB 5H85A 5H1TA 4YK0A 3I3JA 4YYGA 2F6JA 4MR3A 5TB6A 4Z93A 3O37A 3Q2EA 5F3AA 5A5NA 4YYKA 5DKDA 5E9LA 5I40A 5F25A 2H60A 5ETDA 5ENGA 4GPJA 5LJ0A 3SVFA 4NR4A 3GG3A 4UIZA 5COIA 4LDFA 2I7KA 4TT2A 4TZ2A 5LUUA 5DW2A 5EP7A 5DFBA 5ENBA 4AI6A 3O36A 4NQNA 5KHMA 5DKHA 4O7FA 5DYXA 3S92A 2EJNA 4HXPA 5D3JA 5HJCA 4QNSA 3D1BA 4AKHA 5CRZA 5KTXA 4IORA 5EV9A 2OSSA 4Q0OA 5D24A 5HFRA 1ZS5A 2DWWA 4HXSA 5HELA 2RNWA 2D82A 5FH8A 3P1FA 5CUCA 5FE7A 4ZQLA 5A5OA 5FFWA 5FE4A 5FE9A 5FBXA 5II1A 3HMFA 5ACYA 4QR5A 4PCIA 4PS5A 4A9HA 5TCMA 3IU5A 4HBWA 5C87A 2L84A 3HMEA 3FKMX 4IOQA 5C85A 4PY6A 1JM4B 4YYIA 4LZSA 4QEWA 4CUUA 5HFQA 4A9FA 5A5QA 1WUGA 4O76A 5K29A 5JI8A 2DVSA 4DONA 4YH3A 5L98A 4PTBA 5DFDA 4Z1SA 4YY6A 5FG6A 5CUDA 5FB0A 4IR6A 4QY4A 4UIYA 5II2A 5F5ZA 4HBVA 2GRCA 5CGPA 5FE3A 5I80A 5IIDA 3TLPA 4HXNA 1PUOA 3U5OA 5G4SA 4Z6IA 5ENIA 5IG6A 4OUFA 3O34A 5H1VA 4Z6HA 3AQAA 5EICA 5A81A 3U5MA 5F61A 5DYUA 4CUTA 4A9EA 4FLPA 5ENCA 5CPEA 3MB3A 5D3PA 4MEPA 3UVXA 5DYAA 3QZVA 5EWCA 3JVMA 2RI7A 5E9VA 4HXLA 4LYSA 5D3NA 4F3IA 3U5KA 5CS8A 4QSPA 4KV4A 5BT5A 5C7NA 3HMHA 5AMEA 3ZYUA 5A82A 4XYAA 4NS5A 5F36A 2G4AA 4MENA 2YQDA 5D7XA 4LZRA 4NR5A 5H1UA 3MB4A 2RO1A 4NUCA 3MUKA 5A7CA 5LKXA 5KU3A 5CP5A 3P5OA 5DYCA 4YH4A 3K2JA 5L99A 2DVQA 3U5NA 5DLXA 5CFWA 5E0RA 5CZGA 3QZTA
chains in the Genus database with same CATH topology
5IGKA 4A9MA 1WUMA 3UV5A 4J0RA 2L85A 4O78A 4IR4A 5CQ5A 4YY4A 5I29A 4MEQA 2WP2A 5CQ8A 5FFYA 4OGJA 2FSAA 4QSUA 5A5RA 5DBMA 5I1QA 5KTWA 2D9EA 4A9LA 4TQNA 4TYLA 5DW1A 5LVRA 3AADA 5I7XA 3UVWA 4QYDA 2N9GA 4CURA 5IGNA 5I7YA 4HXMA 4C66A 3D7CA 3IU6A 5ENHA 4QR3A 4HXRA 4J3IA 5EWVA 4HBXA 4QSQA 4YBSA 5E9MA 2YYNA 5CUEA 4Y03A 5KO4A 4WIVA 4A9KA 5CUGA 5I86A 3Q2FA 3O33A 3UVDA 5J0DA 4J1PA 4O7CA 4QEVA 5E7DA 5EPSA 2YDWA 4QSVA 2RFJA 5FE1A 3RCWA 5HM0A 4YBTA 5F63A 5LKTA 1N72A 5A5SA 5F60A 5EM3A 5L96A 4A9NA 4NR8A 4O7AA 5I89A 2YEKA 5L97A 5CQTA 4NYWA 5DLZA 5BT3A 4QUTA 4CUPA 4NYVA 4N4IA 3JVJA 4TU4A 3UV4A 5EWDA 5FE5A 5IGLA 4MEOA 2E7OA 4X2IA 4LC2A 4O70A 4YYHA 4KCXA 1F68A 3NXBA 4TS8A 5HQ5A 5FG5A 4O75A 4C67A 3LJWA 2YELA 2E3KA 5C89A 3P1DA 4QSWA 4N4FA 4Q0NA 4QEUA 4MR6A 2DVVA 5DFCA 2RNXA 5F62A 4A9JA 4NXJA 4NRCA 3U5LA 3QZSA 3U5PA 5HCLA 4BJXA 4YYJA 3SVHA 3UVYA 5FH7A 4TT6A 5D3LA 4NQMA 3LQHA 5EQ1A 4QSRA 4AKNA 4XUBA 4ZC9A 5D3HA 4NR7A 2MJVB 5HRVA 4XY8A 4ALGA 4NR9A 5G4RA 5HRXA 5A5PA 2L5EA 2YEMA 5EGUA 5CTLA 4WHUA 5CQ7A 3P1EA 5LVQA 4BW2A 5FG4A 3MXFA 4UYEA 5FE2A 4QUUA 2I8NA 4TT4A 3UV2A 5FDZA 4TZ8A 3LQIA 4UIXA 5FH6A 4BHWA 5L8UA 5LKUA 5ENJA 5E74A 5JWMA 3MQMA 4YATA 3ONIA 4KV1A 4PCEA 4XY9A 4UYFB 5CY9A 2NXBA 3DAIA 4A9IA 5FB1A 4O77A 5D3SA 2WP1A 4QBMA 5FFVA 5CRMA 5CQ3A 3MULA 4IR5A 4WHWA 4YYDA 5ETBA 5F1HA 5D0CA 5AMFA 3DWYA 3UW9A 4BW1A 2DVRA 5KTUA 4TTEA 2E7NA 5EVAA 5EPBA 5ENFA 5EU1A 5E3GA 5CUBA 5E9YA 4TU6A 4LR6A 4NRBA 5IBNA 5LJ1A 4CL9A 4NYXA 5HRWA 2YW5A 4N3WA 4NRAA 2R0SA 4CUQA 5ENEA 4N4HA 4QSXA 5D3TA 4PKLA 4LZ2A 5E3DA 3JVKA 2KTBB 2F6NA 4CUSA 5LKZA 3O35A 4YABA 3P1CA 5EWHA 5F1LA 3U5JA 3JVLA 4A9OA 5HQ6A 4HXOA 4OGIA 4YYNA 5DY7A 2RNYA 4YAXA 5HQ7A 5BT4A 4QB3A 4O72A 4UYDA 5EA1A 5CQAA 4O7BA 5CQ6A 4YC9A 2R0YA 4XUAA 4QSSA 4QR4A 5A83A 4BW3A 3S91A 3G0LA 4QC3A 5C4QA 2DKWA 5FE8A 5HEMA 4N4GA 1X0JA 4NUEA 4UYGA 5AD2A 4J0SA 5D25A 1JSPB 5EI4A 2R0VA 4ALHA 4QZSA 4YBMA 5EWWA 4NUDA 4O7EA 4UIWA 5I83A 1EQFA 5CUAA 5LJ2A 4CFLA 5CQ4A 4CFKA 3LXJA 5E9KA 4MR5A 5C8GA 4UIVA 4IOOA 4IR3A 5IGMA 5HLSA 5FE0A 2DATA 4LYIA 4O74A 5HENA 4CLBA 4LRGA 5EISA 4BW4A 4QC1A 4ZW1A 4HBYA 1E6IA 3SVGA 4RVRA 5E73A 3LQJA 4MR4A 4UYFA 2RS9B 3G0JA 4QYLA 5F2PA 5DX4A 4E96A 5AD3A 5L8TA 5CU8A 5E9IA 4UITA 4YYMA 4LYWA 4UIUA 4O71A 4YADA 4HXKA 5I88A 5D3RA 5EPRA 2OUOA 4NR6A 5A85A 5FE6A 4Z1QA 2R10A 4QSTA 4UYHA 5DKCA 2OO1A 5D26A 5EK9A 2LSPB 5H85A 5H1TA 4YK0A 3I3JA 4YYGA 2F6JA 4MR3A 5TB6A 4Z93A 3O37A 3Q2EA 5F3AA 5A5NA 4YYKA 5DKDA 5E9LA 5I40A 5F25A 2H60A 5ETDA 5ENGA 4GPJA 5LJ0A 3SVFA 4NR4A 3GG3A 4UIZA 5COIA 4LDFA 2I7KA 4TT2A 4TZ2A 5LUUA 5DW2A 5EP7A 5DFBA 5ENBA 3O36A 4NQNA 5KHMA 5DKHA 4O7FA 5DYXA 3S92A 4HXPA 5D3JA 5HJCA 4QNSA 5CRZA 5KTXA 4IORA 5EV9A 2OSSA 4Q0OA 5D24A 5HFRA 1ZS5A 2DWWA 4HXSA 5HELA 2RNWA 2D82A 5FH8A 3P1FA 5CUCA 5FE7A 4ZQLA 5A5OA 5FFWA 5FE4A 5FE9A 5FBXA 5II1A 3HMFA 5ACYA 4QR5A 4PCIA 4PS5A 4A9HA 5TCMA 3IU5A 4HBWA 5C87A 2L84A 3HMEA 3FKMX 4IOQA 5C85A 4PY6A 1JM4B 4YYIA 4LZSA 4QEWA 4CUUA 5HFQA 4A9FA 5A5QA 1WUGA 4O76A 5K29A 5JI8A 2DVSA 4DONA 4YH3A 5L98A 4PTBA 5DFDA 4Z1SA 4YY6A 5FG6A 5CUDA 5FB0A 4IR6A 4QY4A 4UIYA 5II2A 5F5ZA 4HBVA 2GRCA 5CGPA 5FE3A 5I80A 5IIDA 3TLPA 4HXNA 3U5OA 5G4SA 4Z6IA 5ENIA 5IG6A 4OUFA 3O34A 5H1VA 4Z6HA 3AQAA 5EICA 5A81A 3U5MA 5F61A 5DYUA 4CUTA 4A9EA 4FLPA 5ENCA 5CPEA 3MB3A 5D3PA 4MEPA 3UVXA 5DYAA 3QZVA 5EWCA 3JVMA 2RI7A 5E9VA 4HXLA 4LYSA 5D3NA 4F3IA 3U5KA 5CS8A 4QSPA 4KV4A 5BT5A 5C7NA 3HMHA 5AMEA 3ZYUA 5A82A 4XYAA 4NS5A 5F36A 2G4AA 5D7XA 2YQDA 4MENA 4LZRA 4NR5A 5H1UA 3MB4A 2RO1A 4NUCA 3MUKA 5A7CA 5LKXA 5KU3A 5CP5A 3P5OA 5DYCA 4YH4A 3K2JA 5L99A 2DVQA 3U5NA 5DLXA 5CFWA 5E0RA 5CZGA 3QZTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IGK A;  4A9M A;  1WUM A;  3UV5 A;  4J0R A;  2L85 A;  4O78 A;  4IR4 A;  5CQ5 A;  4YY4 A;  5I29 A;  4MEQ A;  2WP2 A;  5CQ8 A;  5FFY A;  4OGJ A;  2FSA A;  4QSU A;  5A5R A;  5DBM A;  5I1Q A;  5KTW A;  2D9E A;  4A9L A;  4TQN A;  4TYL A;  5DW1 A;  5LVR A;  3AAD A;  5I7X A;  3UVW A;  4QYD A;  2N9G A;  4CUR A;  5IGN A;  5I7Y A;  4HXM A;  4C66 A;  3D7C A;  3IU6 A;  5ENH A;  4QR3 A;  4HXR A;  4J3I A;  5EWV A;  4HBX A;  4QSQ A;  4YBS A;  5E9M A;  2YYN A;  5CUE A;  4Y03 A;  5KO4 A;  4WIV A;  4A9K A;  5CUG A;  5I86 A;  3Q2F A;  3O33 A;  3UVD A;  5J0D A;  4J1P A;  4O7C A;  4QEV A;  5E7D A;  5EPS A;  2YDW A;  4QSV A;  2RFJ A;  5FE1 A;  3RCW A;  5HM0 A;  4YBT A;  5F63 A;  5LKT A;  1N72 A;  5A5S A;  5F60 A;  5EM3 A;  5L96 A;  4A9N A;  4NR8 A;  4O7A A;  5I89 A;  2YEK A;  5L97 A;  5CQT A;  4NYW A;  5DLZ A;  5BT3 A;  4QUT A;  4CUP A;  4NYV A;  4N4I A;  3JVJ A;  4TU4 A;  3UV4 A;  5EWD A;  5FE5 A;  5IGL A;  4MEO A;  2E7O A;  4X2I A;  4LC2 A;  4O70 A;  4YYH A;  4KCX A;  1F68 A;  3NXB A;  4TS8 A;  5HQ5 A;  5FG5 A;  4O75 A;  4C67 A;  3LJW A;  2YEL A;  2E3K A;  5C89 A;  3P1D A;  4QSW A;  4N4F A;  4Q0N A;  4QEU A;  4MR6 A;  2DVV A;  5DFC A;  2RNX A;  5F62 A;  4A9J A;  4NXJ A;  4NRC A;  3U5L A;  3QZS A;  3U5P A;  5HCL A;  4BJX A;  4YYJ A;  3SVH A;  3UVY A;  5FH7 A;  4TT6 A;  5D3L A;  4NQM A;  3LQH A;  5EQ1 A;  4QSR A;  4AKN A;  4XUB A;  4ZC9 A;  5D3H A;  4NR7 A;  2MJV B;  5HRV A;  4XY8 A;  4ALG A;  4NR9 A;  5G4R A;  5HRX A;  5A5P A;  2L5E A;  2YEM A;  5EGU A;  5CTL A;  4WHU A;  5CQ7 A;  3P1E A;  5LVQ A;  4BW2 A;  5FG4 A;  3MXF A;  4UYE A;  5FE2 A;  4QUU A;  2I8N A;  4TT4 A;  3UV2 A;  5FDZ A;  4TZ8 A;  3LQI A;  4UIX A;  5FH6 A;  4BHW A;  5L8U A;  5LKU A;  5ENJ A;  5E74 A;  5JWM A;  3MQM A;  4YAT A;  3ONI A;  4KV1 A;  4PCE A;  4XY9 A;  4UYF B;  5CY9 A;  2NXB A;  3DAI A;  4A9I A;  5FB1 A;  4O77 A;  5D3S A;  2WP1 A;  4QBM A;  5FFV A;  5CRM A;  5CQ3 A;  3MUL A;  4IR5 A;  4WHW A;  4YYD A;  5ETB A;  5F1H A;  5D0C A;  5AMF A;  3DWY A;  3UW9 A;  4BW1 A;  2DVR A;  5KTU A;  4TTE A;  2E7N A;  5EVA A;  5EPB A;  5ENF A;  5EU1 A;  5E3G A;  5CUB A;  5E9Y A;  4TU6 A;  4LR6 A;  4NRB A;  5IBN A;  5LJ1 A;  4CL9 A;  4NYX A;  5HRW A;  2YW5 A;  4N3W A;  4NRA A;  2R0S A;  4CUQ A;  5ENE A;  4N4H A;  4QSX A;  5D3T A;  4PKL A;  4LZ2 A;  5E3D A;  3JVK A;  2KTB B;  2F6N A;  4CUS A;  5LKZ A;  3O35 A;  4YAB A;  3P1C A;  5EWH A;  5F1L A;  3U5J A;  3JVL A;  4A9O A;  5HQ6 A;  4HXO A;  4OGI A;  4YYN A;  5DY7 A;  2RNY A;  4YAX A;  5HQ7 A;  5BT4 A;  4QB3 A;  4O72 A;  4UYD A;  5EA1 A;  5CQA A;  4O7B A;  5CQ6 A;  4YC9 A;  2R0Y A;  4XUA A;  4QSS A;  4QR4 A;  5A83 A;  4BW3 A;  3S91 A;  3G0L A;  4QC3 A;  5C4Q A;  2DKW A;  5FE8 A;  5HEM A;  4N4G A;  1X0J A;  4NUE A;  4UYG A;  5AD2 A;  4J0S A;  5D25 A;  1JSP B;  5EI4 A;  2R0V A;  4ALH A;  4QZS A;  4YBM A;  5EWW A;  4NUD A;  4O7E A;  4UIW A;  5I83 A;  1EQF A;  5CUA A;  5LJ2 A;  4CFL A;  5CQ4 A;  4CFK A;  3LXJ A;  5E9K A;  4MR5 A;  5C8G A;  4UIV A;  4IOO A;  4IR3 A;  5IGM A;  5HLS A;  5FE0 A;  2DAT A;  4LYI A;  4O74 A;  5HEN A;  4CLB A;  4LRG A;  5EIS A;  4BW4 A;  4QC1 A;  4ZW1 A;  4HBY A;  1E6I A;  3SVG A;  4RVR A;  5E73 A;  3LQJ A;  4MR4 A;  4UYF A;  2RS9 B;  3G0J A;  4QYL A;  5F2P A;  5DX4 A;  4E96 A;  5AD3 A;  5L8T A;  5CU8 A;  5E9I A;  4UIT A;  4YYM A;  4LYW A;  4UIU A;  4O71 A;  4YAD A;  4HXK A;  5I88 A;  5D3R A;  5EPR A;  2OUO A;  4NR6 A;  5A85 A;  5FE6 A;  4Z1Q A;  2R10 A;  4QST A;  4UYH A;  5DKC A;  2OO1 A;  5D26 A;  5EK9 A;  2LSP B;  5H85 A;  5H1T A;  4YK0 A;  3I3J A;  4YYG A;  2F6J A;  4MR3 A;  5TB6 A;  4Z93 A;  3O37 A;  3Q2E A;  5F3A A;  5A5N A;  4YYK A;  5DKD A;  5E9L A;  5I40 A;  5F25 A;  2H60 A;  5ETD A;  5ENG A;  4GPJ A;  5LJ0 A;  3SVF A;  4NR4 A;  3GG3 A;  4UIZ A;  5COI A;  4LDF A;  2I7K A;  4TT2 A;  4TZ2 A;  5LUU A;  5DW2 A;  5EP7 A;  5DFB A;  5ENB A;  3O36 A;  4NQN A;  5KHM A;  5DKH A;  4O7F A;  5DYX A;  3S92 A;  4HXP A;  5D3J A;  5HJC A;  4QNS A;  5CRZ A;  5KTX A;  4IOR A;  5EV9 A;  2OSS A;  4Q0O A;  5D24 A;  5HFR A;  1ZS5 A;  2DWW A;  4HXS A;  5HEL A;  2RNW A;  2D82 A;  5FH8 A;  3P1F A;  5CUC A;  5FE7 A;  4ZQL A;  5A5O A;  5FFW A;  5FE4 A;  5FE9 A;  5FBX A;  5II1 A;  3HMF A;  5ACY A;  4QR5 A;  4PCI A;  4PS5 A;  4A9H A;  5TCM A;  3IU5 A;  4HBW A;  5C87 A;  2L84 A;  3HME A;  3FKM X;  4IOQ A;  5C85 A;  4PY6 A;  1JM4 B;  4YYI A;  4LZS A;  4QEW A;  4CUU A;  5HFQ A;  4A9F A;  5A5Q A;  1WUG A;  4O76 A;  5K29 A;  5JI8 A;  2DVS A;  4DON A;  4YH3 A;  5L98 A;  4PTB A;  5DFD A;  4Z1S A;  4YY6 A;  5FG6 A;  5CUD A;  5FB0 A;  4IR6 A;  4QY4 A;  4UIY A;  5II2 A;  5F5Z A;  4HBV A;  2GRC A;  5CGP A;  5FE3 A;  5I80 A;  5IID A;  3TLP A;  4HXN A;  3U5O A;  5G4S A;  4Z6I A;  5ENI A;  5IG6 A;  4OUF A;  3O34 A;  5H1V A;  4Z6H A;  3AQA A;  5EIC A;  5A81 A;  3U5M A;  5F61 A;  5DYU A;  4CUT A;  4A9E A;  4FLP A;  5ENC A;  5CPE A;  3MB3 A;  5D3P A;  4MEP A;  3UVX A;  5DYA A;  3QZV A;  5EWC A;  3JVM A;  2RI7 A;  5E9V A;  4HXL A;  4LYS A;  5D3N A;  4F3I A;  3U5K A;  5CS8 A;  4QSP A;  4KV4 A;  5BT5 A;  5C7N A;  3HMH A;  5AME A;  3ZYU A;  5A82 A;  4XYA A;  4NS5 A;  5F36 A;  2G4A A;  5D7X A;  2YQD A;  4MEN A;  4LZR A;  4NR5 A;  5H1U A;  3MB4 A;  2RO1 A;  4NUC A;  3MUK A;  5A7C A;  5LKX A;  5KU3 A;  5CP5 A;  3P5O A;  5DYC A;  4YH4 A;  3K2J A;  5L99 A;  2DVQ A;  3U5N A;  5DLX A;  5CFW A;  5E0R A;  5CZG A;  3QZT A; 
#chains in the Genus database with same CATH topology
 5IGK A;  4A9M A;  1WUM A;  3UV5 A;  4J0R A;  2L85 A;  4O78 A;  4IR4 A;  5CQ5 A;  4YY4 A;  5I29 A;  4MEQ A;  2WP2 A;  5CQ8 A;  5FFY A;  4OGJ A;  2FSA A;  4QSU A;  5A5R A;  5DBM A;  5I1Q A;  5KTW A;  2D9E A;  4A9L A;  4TQN A;  4TYL A;  5DW1 A;  5LVR A;  3AAD A;  5I7X A;  3UVW A;  4QYD A;  2N9G A;  4CUR A;  5IGN A;  5I7Y A;  4HXM A;  3D1D A;  4C66 A;  3D7C A;  3IU6 A;  5ENH A;  4QR3 A;  4HXR A;  4J3I A;  5EWV A;  4HBX A;  4QSQ A;  4YBS A;  5E9M A;  2YYN A;  5CUE A;  4Y03 A;  5KO4 A;  4WIV A;  4A9K A;  5CUG A;  5I86 A;  3Q2F A;  3O33 A;  3UVD A;  5J0D A;  4J1P A;  4O7C A;  4QEV A;  5E7D A;  5EPS A;  2YDW A;  4QSV A;  2RFJ A;  5FE1 A;  3RCW A;  5HM0 A;  4YBT A;  5F63 A;  5LKT A;  1N72 A;  5A5S A;  5F60 A;  5EM3 A;  5L96 A;  4A9N A;  4NR8 A;  4O7A A;  5I89 A;  2YEK A;  5L97 A;  5CQT A;  4NYW A;  5DLZ A;  5BT3 A;  4QUT A;  4CUP A;  4NYV A;  4N4I A;  3JVJ A;  4TU4 A;  3UV4 A;  5EWD A;  5FE5 A;  5IGL A;  4MEO A;  2E7O A;  4X2I A;  4LC2 A;  4O70 A;  4YYH A;  4KCX A;  1F68 A;  3NXB A;  4TS8 A;  5HQ5 A;  5FG5 A;  4O75 A;  4C67 A;  3LJW A;  2YEL A;  2E3K A;  5C89 A;  3P1D A;  4QSW A;  4N4F A;  4Q0N A;  4QEU A;  4MR6 A;  2DVV A;  5DFC A;  2RNX A;  5F62 A;  4A9J A;  4NXJ A;  4NRC A;  3U5L A;  3QZS A;  3U5P A;  5HCL A;  4BJX A;  4YYJ A;  3SVH A;  3UVY A;  5FH7 A;  4TT6 A;  5D3L A;  4NQM A;  3LQH A;  4AKG A;  5EQ1 A;  4QSR A;  4AKN A;  4XUB A;  4ZC9 A;  5D3H A;  4NR7 A;  2MJV B;  5HRV A;  3ERR A;  4XY8 A;  4ALG A;  4NR9 A;  5G4R A;  4AKI A;  5HRX A;  5A5P A;  2L5E A;  2YEM A;  5EGU A;  3VKG A;  5CTL A;  4WHU A;  5CQ7 A;  3P1E A;  5LVQ A;  4BW2 A;  5FG4 A;  3MXF A;  4UYE A;  5FE2 A;  4QUU A;  2I8N A;  4TT4 A;  3UV2 A;  5FDZ A;  4TZ8 A;  3LQI A;  4UIX A;  5FH6 A;  4BHW A;  5L8U A;  5LKU A;  5ENJ A;  5E74 A;  5JWM A;  3MQM A;  4YAT A;  3ONI A;  4KV1 A;  4PCE A;  4XY9 A;  4UYF B;  5CY9 A;  2NXB A;  3DAI A;  4A9I A;  5FB1 A;  4O77 A;  5D3S A;  2WP1 A;  4QBM A;  5FFV A;  5CRM A;  5CQ3 A;  3MUL A;  4IR5 A;  4WHW A;  4YYD A;  5ETB A;  5F1H A;  5D0C A;  5AMF A;  3DWY A;  3UW9 A;  4BW1 A;  2DVR A;  5KTU A;  4TTE A;  2E7N A;  5EVA A;  1ZKR A;  5EPB A;  5ENF A;  5EU1 A;  5E3G A;  5CUB A;  5E9Y A;  4TU6 A;  4LR6 A;  4NRB A;  5IBN A;  5LJ1 A;  4CL9 A;  4NYX A;  5HRW A;  2YW5 A;  4N3W A;  4NRA A;  2R0S A;  4CUQ A;  5ENE A;  4N4H A;  4QSX A;  5D3T A;  4PKL A;  4LZ2 A;  5E3D A;  3JVK A;  2KTB B;  2F6N A;  4CUS A;  5LKZ A;  3O35 A;  4YAB A;  3P1C A;  5EWH A;  5F1L A;  3U5J A;  3JVL A;  4A9O A;  5HQ6 A;  4HXO A;  4OGI A;  4YYN A;  5DY7 A;  2RNY A;  4YAX A;  5HQ7 A;  5BT4 A;  4QB3 A;  4O72 A;  4UYD A;  5EA1 A;  5CQA A;  4O7B A;  5CQ6 A;  4YC9 A;  2R0Y A;  4XUA A;  4QSS A;  4QR4 A;  5A83 A;  4BW3 A;  3S91 A;  3G0L A;  4QC3 A;  5C4Q A;  2DKW A;  5FE8 A;  5HEM A;  4N4G A;  1X0J A;  4NUE A;  4UYG A;  5AD2 A;  4J0S A;  5D25 A;  1JSP B;  5EI4 A;  2R0V A;  4ALH A;  4QZS A;  4YBM A;  5EWW A;  4NUD A;  4O7E A;  4UIW A;  5I83 A;  1EQF A;  5CUA A;  5LJ2 A;  4CFL A;  5CQ4 A;  4CFK A;  3LXJ A;  5E9K A;  4MR5 A;  5C8G A;  4UIV A;  4IOO A;  4IR3 A;  5IGM A;  5HLS A;  5FE0 A;  2DAT A;  4LYI A;  4O74 A;  5HEN A;  4CLB A;  4LRG A;  5EIS A;  4BW4 A;  4QC1 A;  4ZW1 A;  4HBY A;  1E6I A;  3SVG A;  4RVR A;  5E73 A;  3LQJ A;  4MR4 A;  4UYF A;  2RS9 B;  3VKH A;  3G0J A;  4QYL A;  5F2P A;  5DX4 A;  4E96 A;  5AD3 A;  5L8T A;  5CU8 A;  5E9I A;  4UIT A;  4YYM A;  4LYW A;  4UIU A;  4O71 A;  4YAD A;  4HXK A;  5I88 A;  5D3R A;  5EPR A;  2OUO A;  4NR6 A;  5A85 A;  5FE6 A;  4Z1Q A;  2R10 A;  4QST A;  4UYH A;  5DKC A;  2OO1 A;  5D26 A;  5EK9 A;  2LSP B;  5H85 A;  5H1T A;  4YK0 A;  3I3J A;  4YYG A;  2F6J A;  4MR3 A;  5TB6 A;  4Z93 A;  3O37 A;  3Q2E A;  5F3A A;  5A5N A;  4YYK A;  5DKD A;  5E9L A;  5I40 A;  5F25 A;  2H60 A;  5ETD A;  5ENG A;  4GPJ A;  5LJ0 A;  3SVF A;  4NR4 A;  3GG3 A;  4UIZ A;  5COI A;  4LDF A;  2I7K A;  4TT2 A;  4TZ2 A;  5LUU A;  5DW2 A;  5EP7 A;  5DFB A;  5ENB A;  4AI6 A;  3O36 A;  4NQN A;  5KHM A;  5DKH A;  4O7F A;  5DYX A;  3S92 A;  2EJN A;  4HXP A;  5D3J A;  5HJC A;  4QNS A;  3D1B A;  4AKH A;  5CRZ A;  5KTX A;  4IOR A;  5EV9 A;  2OSS A;  4Q0O A;  5D24 A;  5HFR A;  1ZS5 A;  2DWW A;  4HXS A;  5HEL A;  2RNW A;  2D82 A;  5FH8 A;  3P1F A;  5CUC A;  5FE7 A;  4ZQL A;  5A5O A;  5FFW A;  5FE4 A;  5FE9 A;  5FBX A;  5II1 A;  3HMF A;  5ACY A;  4QR5 A;  4PCI A;  4PS5 A;  4A9H A;  5TCM A;  3IU5 A;  4HBW A;  5C87 A;  2L84 A;  3HME A;  3FKM X;  4IOQ A;  5C85 A;  4PY6 A;  1JM4 B;  4YYI A;  4LZS A;  4QEW A;  4CUU A;  5HFQ A;  4A9F A;  5A5Q A;  1WUG A;  4O76 A;  5K29 A;  5JI8 A;  2DVS A;  4DON A;  4YH3 A;  5L98 A;  4PTB A;  5DFD A;  4Z1S A;  4YY6 A;  5FG6 A;  5CUD A;  5FB0 A;  4IR6 A;  4QY4 A;  4UIY A;  5II2 A;  5F5Z A;  4HBV A;  2GRC A;  5CGP A;  5FE3 A;  5I80 A;  5IID A;  3TLP A;  4HXN A;  1PUO A;  3U5O A;  5G4S A;  4Z6I A;  5ENI A;  5IG6 A;  4OUF A;  3O34 A;  5H1V A;  4Z6H A;  3AQA A;  5EIC A;  5A81 A;  3U5M A;  5F61 A;  5DYU A;  4CUT A;  4A9E A;  4FLP A;  5ENC A;  5CPE A;  3MB3 A;  5D3P A;  4MEP A;  3UVX A;  5DYA A;  3QZV A;  5EWC A;  3JVM A;  2RI7 A;  5E9V A;  4HXL A;  4LYS A;  5D3N A;  4F3I A;  3U5K A;  5CS8 A;  4QSP A;  4KV4 A;  5BT5 A;  5C7N A;  3HMH A;  5AME A;  3ZYU A;  5A82 A;  4XYA A;  4NS5 A;  5F36 A;  2G4A A;  4MEN A;  2YQD A;  5D7X A;  4LZR A;  4NR5 A;  5H1U A;  3MB4 A;  2RO1 A;  4NUC A;  3MUK A;  5A7C A;  5LKX A;  5KU3 A;  5CP5 A;  3P5O A;  5DYC A;  4YH4 A;  3K2J A;  5L99 A;  2DVQ A;  3U5N A;  5DLX A;  5CFW A;  5E0R A;  5CZG A;  3QZT A; 
#chains in the Genus database with same CATH homology
 5IGK A;  4A9M A;  1WUM A;  3UV5 A;  4J0R A;  2L85 A;  4O78 A;  4IR4 A;  5CQ5 A;  4YY4 A;  5I29 A;  4MEQ A;  2WP2 A;  5CQ8 A;  5FFY A;  4OGJ A;  2FSA A;  4QSU A;  5A5R A;  5DBM A;  5I1Q A;  5KTW A;  2D9E A;  4A9L A;  4TQN A;  4TYL A;  5DW1 A;  5LVR A;  3AAD A;  5I7X A;  3UVW A;  4QYD A;  2N9G A;  4CUR A;  5IGN A;  5I7Y A;  4HXM A;  4C66 A;  3D7C A;  3IU6 A;  5ENH A;  4QR3 A;  4HXR A;  4J3I A;  5EWV A;  4HBX A;  4QSQ A;  4YBS A;  5E9M A;  2YYN A;  5CUE A;  4Y03 A;  5KO4 A;  4WIV A;  4A9K A;  5CUG A;  5I86 A;  3Q2F A;  3O33 A;  3UVD A;  5J0D A;  4J1P A;  4O7C A;  4QEV A;  5E7D A;  5EPS A;  2YDW A;  4QSV A;  2RFJ A;  5FE1 A;  3RCW A;  5HM0 A;  4YBT A;  5F63 A;  5LKT A;  1N72 A;  5A5S A;  5F60 A;  5EM3 A;  5L96 A;  4A9N A;  4NR8 A;  4O7A A;  5I89 A;  2YEK A;  5L97 A;  5CQT A;  4NYW A;  5DLZ A;  5BT3 A;  4QUT A;  4CUP A;  4NYV A;  4N4I A;  3JVJ A;  4TU4 A;  3UV4 A;  5EWD A;  5FE5 A;  5IGL A;  4MEO A;  2E7O A;  4X2I A;  4LC2 A;  4O70 A;  4YYH A;  4KCX A;  1F68 A;  3NXB A;  4TS8 A;  5HQ5 A;  5FG5 A;  4O75 A;  4C67 A;  3LJW A;  2YEL A;  2E3K A;  5C89 A;  3P1D A;  4QSW A;  4N4F A;  4Q0N A;  4QEU A;  4MR6 A;  2DVV A;  5DFC A;  2RNX A;  5F62 A;  4A9J A;  4NXJ A;  4NRC A;  3U5L A;  3QZS A;  3U5P A;  5HCL A;  4BJX A;  4YYJ A;  3SVH A;  3UVY A;  5FH7 A;  4TT6 A;  5D3L A;  4NQM A;  3LQH A;  5EQ1 A;  4QSR A;  4AKN A;  4XUB A;  4ZC9 A;  5D3H A;  4NR7 A;  2MJV B;  5HRV A;  4XY8 A;  4ALG A;  4NR9 A;  5G4R A;  5HRX A;  5A5P A;  2L5E A;  2YEM A;  5EGU A;  5CTL A;  4WHU A;  5CQ7 A;  3P1E A;  5LVQ A;  4BW2 A;  5FG4 A;  3MXF A;  4UYE A;  5FE2 A;  4QUU A;  2I8N A;  4TT4 A;  3UV2 A;  5FDZ A;  4TZ8 A;  3LQI A;  4UIX A;  5FH6 A;  4BHW A;  5L8U A;  5LKU A;  5ENJ A;  5E74 A;  5JWM A;  3MQM A;  4YAT A;  3ONI A;  4KV1 A;  4PCE A;  4XY9 A;  4UYF B;  5CY9 A;  2NXB A;  3DAI A;  4A9I A;  5FB1 A;  4O77 A;  5D3S A;  2WP1 A;  4QBM A;  5FFV A;  5CRM A;  5CQ3 A;  3MUL A;  4IR5 A;  4WHW A;  4YYD A;  5ETB A;  5F1H A;  5D0C A;  5AMF A;  3DWY A;  3UW9 A;  4BW1 A;  2DVR A;  5KTU A;  4TTE A;  2E7N A;  5EVA A;  5EPB A;  5ENF A;  5EU1 A;  5E3G A;  5CUB A;  5E9Y A;  4TU6 A;  4LR6 A;  4NRB A;  5IBN A;  5LJ1 A;  4CL9 A;  4NYX A;  5HRW A;  2YW5 A;  4N3W A;  4NRA A;  2R0S A;  4CUQ A;  5ENE A;  4N4H A;  4QSX A;  5D3T A;  4PKL A;  4LZ2 A;  5E3D A;  3JVK A;  2KTB B;  2F6N A;  4CUS A;  5LKZ A;  3O35 A;  4YAB A;  3P1C A;  5EWH A;  5F1L A;  3U5J A;  3JVL A;  4A9O A;  5HQ6 A;  4HXO A;  4OGI A;  4YYN A;  5DY7 A;  2RNY A;  4YAX A;  5HQ7 A;  5BT4 A;  4QB3 A;  4O72 A;  4UYD A;  5EA1 A;  5CQA A;  4O7B A;  5CQ6 A;  4YC9 A;  2R0Y A;  4XUA A;  4QSS A;  4QR4 A;  5A83 A;  4BW3 A;  3S91 A;  3G0L A;  4QC3 A;  5C4Q A;  2DKW A;  5FE8 A;  5HEM A;  4N4G A;  1X0J A;  4NUE A;  4UYG A;  5AD2 A;  4J0S A;  5D25 A;  1JSP B;  5EI4 A;  2R0V A;  4ALH A;  4QZS A;  4YBM A;  5EWW A;  4NUD A;  4O7E A;  4UIW A;  5I83 A;  1EQF A;  5CUA A;  5LJ2 A;  4CFL A;  5CQ4 A;  4CFK A;  3LXJ A;  5E9K A;  4MR5 A;  5C8G A;  4UIV A;  4IOO A;  4IR3 A;  5IGM A;  5HLS A;  5FE0 A;  2DAT A;  4LYI A;  4O74 A;  5HEN A;  4CLB A;  4LRG A;  5EIS A;  4BW4 A;  4QC1 A;  4ZW1 A;  4HBY A;  1E6I A;  3SVG A;  4RVR A;  5E73 A;  3LQJ A;  4MR4 A;  4UYF A;  2RS9 B;  3G0J A;  4QYL A;  5F2P A;  5DX4 A;  4E96 A;  5AD3 A;  5L8T A;  5CU8 A;  5E9I A;  4UIT A;  4YYM A;  4LYW A;  4UIU A;  4O71 A;  4YAD A;  4HXK A;  5I88 A;  5D3R A;  5EPR A;  2OUO A;  4NR6 A;  5A85 A;  5FE6 A;  4Z1Q A;  2R10 A;  4QST A;  4UYH A;  5DKC A;  2OO1 A;  5D26 A;  5EK9 A;  2LSP B;  5H85 A;  5H1T A;  4YK0 A;  3I3J A;  4YYG A;  2F6J A;  4MR3 A;  5TB6 A;  4Z93 A;  3O37 A;  3Q2E A;  5F3A A;  5A5N A;  4YYK A;  5DKD A;  5E9L A;  5I40 A;  5F25 A;  2H60 A;  5ETD A;  5ENG A;  4GPJ A;  5LJ0 A;  3SVF A;  4NR4 A;  3GG3 A;  4UIZ A;  5COI A;  4LDF A;  2I7K A;  4TT2 A;  4TZ2 A;  5LUU A;  5DW2 A;  5EP7 A;  5DFB A;  5ENB A;  3O36 A;  4NQN A;  5KHM A;  5DKH A;  4O7F A;  5DYX A;  3S92 A;  4HXP A;  5D3J A;  5HJC A;  4QNS A;  5CRZ A;  5KTX A;  4IOR A;  5EV9 A;  2OSS A;  4Q0O A;  5D24 A;  5HFR A;  1ZS5 A;  2DWW A;  4HXS A;  5HEL A;  2RNW A;  2D82 A;  5FH8 A;  3P1F A;  5CUC A;  5FE7 A;  4ZQL A;  5A5O A;  5FFW A;  5FE4 A;  5FE9 A;  5FBX A;  5II1 A;  3HMF A;  5ACY A;  4QR5 A;  4PCI A;  4PS5 A;  4A9H A;  5TCM A;  3IU5 A;  4HBW A;  5C87 A;  2L84 A;  3HME A;  3FKM X;  4IOQ A;  5C85 A;  4PY6 A;  1JM4 B;  4YYI A;  4LZS A;  4QEW A;  4CUU A;  5HFQ A;  4A9F A;  5A5Q A;  1WUG A;  4O76 A;  5K29 A;  5JI8 A;  2DVS A;  4DON A;  4YH3 A;  5L98 A;  4PTB A;  5DFD A;  4Z1S A;  4YY6 A;  5FG6 A;  5CUD A;  5FB0 A;  4IR6 A;  4QY4 A;  4UIY A;  5II2 A;  5F5Z A;  4HBV A;  2GRC A;  5CGP A;  5FE3 A;  5I80 A;  5IID A;  3TLP A;  4HXN A;  3U5O A;  5G4S A;  4Z6I A;  5ENI A;  5IG6 A;  4OUF A;  3O34 A;  5H1V A;  4Z6H A;  3AQA A;  5EIC A;  5A81 A;  3U5M A;  5F61 A;  5DYU A;  4CUT A;  4A9E A;  4FLP A;  5ENC A;  5CPE A;  3MB3 A;  5D3P A;  4MEP A;  3UVX A;  5DYA A;  3QZV A;  5EWC A;  3JVM A;  2RI7 A;  5E9V A;  4HXL A;  4LYS A;  5D3N A;  4F3I A;  3U5K A;  5CS8 A;  4QSP A;  4KV4 A;  5BT5 A;  5C7N A;  3HMH A;  5AME A;  3ZYU A;  5A82 A;  4XYA A;  4NS5 A;  5F36 A;  2G4A A;  5D7X A;  2YQD A;  4MEN A;  4LZR A;  4NR5 A;  5H1U A;  3MB4 A;  2RO1 A;  4NUC A;  3MUK A;  5A7C A;  5LKX A;  5KU3 A;  5CP5 A;  3P5O A;  5DYC A;  4YH4 A;  3K2J A;  5L99 A;  2DVQ A;  3U5N A;  5DLX A;  5CFW A;  5E0R A;  5CZG A;  3QZT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...