5JWMA

Bivalent bet bromodomain inhibition
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
110
structure length
110
Chain Sequence
VSEQLKCCSGILKEMFAKKHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/transcription inhibitor
molecule keywords Bromodomain-containing protein 4
publication title Design and characterization of bivalent BET inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 38
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5jwmA00
5FB0A 4QB3A 5A5SA 4A9KA 4J1PA 3U5OA 3IU6A 4X2IA 5CUBA 3MULA 5I40A 2YYNA 4N4HA 4QEUA 3DAIA 4YK0A 5EA1A 4LZRA 4LYWA 5F1LA 5IG6A 5I1QA 2OUOA 5CS8A 4WHWA 3O33A 5I89A 3O34A 4NUDA 4A9IA 4CUTA 5D25A 5FFYA 5LJ1A 2DWWA 4NR5A 4UIZA 5I29A 5AMFA 5CQAA 2RS9B 5LKXA 5IGKA 4LZ2A 3FKMX 3G0LA 5DBMA 3QZTA 4J3IA 2R0YA 2I7KA 5F62A 5HFQA 5HQ6A 4TS8A 2RNWA 3SVHA 4IOOA 4PCEA 4CL9A 5CRMA 5EM3A 5L98A 3MUKA 4YYIA 4O7BA 4RVRA 5FE2A 5LKZA 2RI7A 1F68A 4QR3A 5CTLA 5EU1A 5FDZA 5JI8A 1ZS5A 4QSPA 3UVYA 5BT3A 5CRZA 5CZGA 3UV4A 5LUUA 5EPRA 4Q0NA 3GG3A 5D3RA 4QSXA 5E9YA 4OUFA 4QR5A 3S91A 4UYFB 4YYKA 5D0CA 4IORA 5ETBA 4OGIA 4CURA 4TT6A 5EQ1A 5ENBA 3U5LA 4QC1A 5D3LA 4KV1A 3G0JA 5I80A 4TZ8A 4YYJA 4O70A 5DW2A 5A5OA 5CU8A 5E74A 4HBYA 3P5OA 4PKLA 5COIA 5D3TA 2YEKA 4NXJA 5F63A 5DLZA 4QNSA 4N3WA 5ENCA 5C4QA 4QUUA 5II2A 4TT4A 5HENA 5FE0A 5A85A 4HBXA 4QSRA 4QUTA 5H85A 4TZ2A 4XUBA 3SVGA 4CUUA 3O36A 1JSPB 4O7EA 4NQMA 4UIUA 4IOQA 4O71A 5DYUA 5CQ6A 4A9JA 5CY9A 5E0RA 4HXPA 4XUAA 5A5QA 4MEPA 5HQ7A 3QZVA 5FG5A 4QZSA 4KCXA 5BT5A 2RNXA 5KU3A 2LSPB 5D3PA 5L96A 5A83A 2D9EA 4QY4A 4Z1QA 4OGJA 3HMFA 5L97A 4Z6HA 4MR3A 2DKWA 5CQ3A 4YH3A 3LXJA 1JM4B 4O7CA 5FFWA 4QC3A 4QSSA 4LC2A 4MR6A 3RCWA 4NRCA 4FLPA 4ALGA 5AMEA 4QR4A 5HCLA 5F25A 5IGMA 5BT4A 5DFCA 2WP1A 4A9EA 4Z93A 4LZSA 4NR9A 5KHMA 3LQHA 5F2PA 4O7FA 4TTEA 5TCMA 5E9LA 5LVQA 4YABA 2R0SA 5A82A 3U5PA 4UIWA 5I86A 3K2JA 5CQ5A 4NRBA 4BW4A 4YY4A 3P1DA 4XY8A 3JVKA 4O77A 5E7DA 5JWMA 2D82A 3IU5A 4PCIA 3UVWA 4TU4A 3ONIA 5EISA 5LKUA 4YBMA 5CUAA 5C85A 5CQ4A 3MB4A 5FE8A 5E3GA 5K29A 4A9LA 5F3AA 4YADA 4GPJA 4ZW1A 3ZYUA 4IR6A 5CGPA 5A81A 2FSAA 5G4SA 4DONA 4Z6IA 5FE1A 5TB6A 3P1EA 4YAXA 5A5NA 5I88A 4PTBA 5HM0A 4NYXA 4TQNA 3Q2EA 5E9KA 5AD2A 3I3JA 4J0RA 2OSSA 5CQ7A 4TU6A 5CQTA 4HXLA 5FE4A 5ENGA 4UIYA 5C8GA 4E96A 5LJ0A 5E9VA 5HRVA 4HXNA 4BHWA 2WP2A 5EI4A 2E7NA 4QEVA 5C87A 4NYWA 4F3IA 5FE7A 2E7OA 4YYGA 5DW1A 4MR5A 4YH4A 4WHUA 4QSUA 5EWDA 5I7YA 2R10A 2RNYA 4HXRA 3S92A 5FBXA 2DATA 3SVFA 4HXKA 4NYVA 3MB3A 4UYDA 5D7XA 4BW1A 4YYNA 5EGUA 3DWYA 4LRGA 4YBSA 3O35A 3LQIA 2I8NA 5E3DA 5DYCA 5KTUA 5HJCA 3UVXA 5IGNA 5ENHA 5CP5A 3HMHA 3LJWA 2YDWA 4AKNA 5D24A 4HXOA 4CLBA 5FE6A 4PY6A 5I83A 4YYDA 5LKTA 5F60A 4KV4A 5IBNA 5DFDA 4HBWA 5FG6A 4XYAA 5J0DA 4UYHA 4UIXA 4CFLA 4QEWA 4NUCA 5LJ2A 5E73A 2DVVA 3AQAA 1WUMA 2L85A 5DY7A 3UVDA 5CPEA 4QYDA 5ENJA 4QBMA 1N72A 2F6NA 4A9OA 4QSQA 4N4GA 4CUQA 2GRCA 5KTXA 5HRXA 3TLPA 4A9MA 4CFKA 2L84A 5ENIA 5IGLA 5FE3A 4NR6A 4C67A 2G4AA 5DYAA 5FB1A 5L8TA 4NR4A 2F6JA 4IR5A 3JVJA 4HXMA 4O75A 4BJXA 2L5EA 3P1CA 5EWCA 5F61A 4HXSA 5HRWA 4O7AA 2DVQA 4Q0OA 5DX4A 5DYXA 3MXFA 4O72A 4NR8A 5ENFA 2YQDA 4LDFA 3QZSA 5FE9A 4CUPA 1E6IA 3UV5A 4QSVA 3D7CA 3NXBA 5ACYA 5C7NA 4YYHA 4TYLA 5D3NA 5DLXA 4O78A 1WUGA 4O74A 5F1HA 5FFVA 4ZQLA 4YATA 5FH6A 5DFBA 4UYEA 4A9NA 4TT2A 5E9MA 4NS5A 3P1FA 4QSTA 4A9HA 5FH7A 5G4RA 4MEOA 4BW3A 5EPSA 4YY6A 5A5PA 5HQ5A 1X0JA 4ZC9A 4YC9A 5HLSA 5D3SA 4XY9A 5IIDA 5KTWA 4MENA 4HBVA 3JVMA 5F36A 5EICA 3U5JA 2OO1A 2YELA 4N4FA 5E9IA 4Z1SA 4QSWA 5H1VA 5EWHA 3U5KA 4UIVA 5A7CA 4UYGA 5D3JA 2E3KA 4YYMA 5AD3A 2R0VA 2RFJA 2NXBA 5DKCA 5KO4A 5DKDA 4N4IA 5CQ8A 5EK9A 5I7XA 4A9FA 4NRAA 4J0SA 4Y03A 5D26A 5CUDA 5A5RA 4NQNA 5II1A 2YEMA 4QYLA 3O37A 5CUEA 5HFRA 5LVRA 2YW5A 3AADA 4BW2A 5F5ZA 5L99A 5C89A 3JVLA 2RO1A 5HELA 3U5NA 4IR3A 3UV2A 4NR7A 3MQMA 4YBTA 4LR6A 5EWVA 1EQFA 4MR4A 4PS5A 2DVRA 5ETDA 5CUCA 4MEQA 5FH8A 4ALHA 3U5MA 4IR4A 4C66A 4LYIA 5L8UA 5H1UA 3HMEA 4UITA 5FE5A 4O76A 2H60A 3LQJA 4LYSA 3Q2FA 5H1TA 5FG4A 5EVAA 5EPBA 5HEMA 5EV9A 5CUGA 5EWWA 5CFWA 5EP7A 2N9GA 4WIVA 2KTBB 4CUSA 2MJVB 3UW9A 5DKHA 2DVSA 4UYFA 5D3HA 5ENEA 4NUEA
chains in the Genus database with same CATH superfamily
5FB0A 4QB3A 5A5SA 4A9KA 4J1PA 3U5OA 3IU6A 4X2IA 5CUBA 3MULA 5I40A 2YYNA 4N4HA 4QEUA 3DAIA 4YK0A 5EA1A 4LZRA 4LYWA 5F1LA 5IG6A 5I1QA 2OUOA 5CS8A 4WHWA 3O33A 5I89A 3O34A 4NUDA 4A9IA 4CUTA 5D25A 5FFYA 5LJ1A 2DWWA 4NR5A 4UIZA 5I29A 5AMFA 5CQAA 2RS9B 5LKXA 5IGKA 4LZ2A 3FKMX 3G0LA 5DBMA 3QZTA 4J3IA 2R0YA 2I7KA 5F62A 5HFQA 5HQ6A 4TS8A 2RNWA 3SVHA 4IOOA 4PCEA 4CL9A 5CRMA 5EM3A 5L98A 3MUKA 4YYIA 4O7BA 4RVRA 5FE2A 5LKZA 2RI7A 1F68A 4QR3A 5CTLA 5EU1A 5FDZA 5JI8A 1ZS5A 4QSPA 3UVYA 5BT3A 5CRZA 5CZGA 3UV4A 5LUUA 5EPRA 4Q0NA 3GG3A 5D3RA 4QSXA 5E9YA 4OUFA 4QR5A 3S91A 4UYFB 4YYKA 5D0CA 4IORA 5ETBA 4OGIA 4CURA 4TT6A 5EQ1A 5ENBA 3U5LA 4QC1A 5D3LA 4KV1A 3G0JA 5I80A 4TZ8A 4YYJA 4O70A 5DW2A 5A5OA 5CU8A 5E74A 4HBYA 3P5OA 4PKLA 5COIA 5D3TA 2YEKA 4NXJA 5F63A 5DLZA 4AKHA 4QNSA 4N3WA 5ENCA 5C4QA 4QUUA 5II2A 4TT4A 5HENA 5FE0A 5A85A 4HBXA 4QSRA 4QUTA 5H85A 4TZ2A 4XUBA 3SVGA 4CUUA 3O36A 1JSPB 4O7EA 4NQMA 4UIUA 4IOQA 4O71A 5DYUA 5CQ6A 4A9JA 5CY9A 5E0RA 4HXPA 4XUAA 5A5QA 4MEPA 5HQ7A 3QZVA 5FG5A 4QZSA 4KCXA 5BT5A 2RNXA 5KU3A 2LSPB 5D3PA 5L96A 5A83A 2D9EA 4QY4A 4Z1QA 4OGJA 3HMFA 5L97A 4Z6HA 4MR3A 2DKWA 5CQ3A 4YH3A 3LXJA 1JM4B 4O7CA 5FFWA 4QC3A 4QSSA 4LC2A 4MR6A 3RCWA 4NRCA 4FLPA 4ALGA 5AMEA 4QR4A 5HCLA 4AKIA 5F25A 5IGMA 5BT4A 5DFCA 2WP1A 4A9EA 4Z93A 4LZSA 4NR9A 5KHMA 3LQHA 5F2PA 4O7FA 4TTEA 5TCMA 5E9LA 5LVQA 4YABA 2R0SA 1ZKRA 5A82A 3U5PA 4UIWA 5I86A 3K2JA 5CQ5A 4NRBA 4BW4A 4YY4A 3P1DA 4XY8A 3JVKA 4O77A 5E7DA 5JWMA 2D82A 3IU5A 4PCIA 3UVWA 4TU4A 3ONIA 5EISA 5LKUA 4YBMA 5CUAA 5C85A 5CQ4A 3MB4A 5FE8A 5E3GA 5K29A 4A9LA 5F3AA 4YADA 4GPJA 4ZW1A 3ZYUA 4IR6A 5CGPA 5A81A 2FSAA 5G4SA 4DONA 4Z6IA 5FE1A 5TB6A 3P1EA 4YAXA 5A5NA 5I88A 4PTBA 5HM0A 4NYXA 4TQNA 3Q2EA 5E9KA 5AD2A 3I3JA 4J0RA 2OSSA 5CQ7A 4TU6A 5CQTA 4HXLA 3VKHA 5FE4A 5ENGA 4UIYA 5C8GA 4E96A 5LJ0A 1PUOA 5E9VA 4HXNA 5HRVA 2WP2A 4BHWA 5EI4A 2E7NA 4QEVA 5C87A 4NYWA 4F3IA 5FE7A 2E7OA 4YYGA 5DW1A 4MR5A 4YH4A 4WHUA 4QSUA 5EWDA 5I7YA 2R10A 2RNYA 4HXRA 3S92A 5FBXA 2DATA 3SVFA 4HXKA 4NYVA 3MB3A 4UYDA 5D7XA 4BW1A 4YYNA 5EGUA 3DWYA 4LRGA 4YBSA 3O35A 3LQIA 2I8NA 5E3DA 5DYCA 5KTUA 5HJCA 3UVXA 5IGNA 5ENHA 5CP5A 3HMHA 3LJWA 2YDWA 4AKNA 5D24A 4HXOA 4CLBA 5FE6A 4PY6A 5I83A 4YYDA 5LKTA 5F60A 4KV4A 5IBNA 5DFDA 4HBWA 5FG6A 4XYAA 5J0DA 4UYHA 4UIXA 4CFLA 4QEWA 4NUCA 5LJ2A 5E73A 2DVVA 3AQAA 1WUMA 2L85A 5DY7A 3UVDA 5CPEA 4QYDA 5ENJA 3D1DA 4QBMA 3D1BA 1N72A 2F6NA 4A9OA 4QSQA 4N4GA 4CUQA 2GRCA 5KTXA 5HRXA 3TLPA 4A9MA 4CFKA 2L84A 5ENIA 5IGLA 5FE3A 4NR6A 4C67A 2G4AA 5DYAA 5FB1A 5L8TA 4NR4A 2F6JA 4IR5A 3JVJA 4HXMA 4O75A 4BJXA 2L5EA 2EJNA 3P1CA 5EWCA 4HXSA 5F61A 5HRWA 4O7AA 2DVQA 4Q0OA 5DX4A 5DYXA 3MXFA 4O72A 4NR8A 5ENFA 2YQDA 4LDFA 3QZSA 5FE9A 4CUPA 1E6IA 3UV5A 4QSVA 3D7CA 4AKGA 3NXBA 5ACYA 5C7NA 4YYHA 4TYLA 5D3NA 5DLXA 4O78A 1WUGA 4O74A 5F1HA 5FFVA 4ZQLA 4YATA 5FH6A 5DFBA 4UYEA 4A9NA 4TT2A 5E9MA 4NS5A 3P1FA 4QSTA 4A9HA 5FH7A 5G4RA 4MEOA 4BW3A 5EPSA 4YY6A 5A5PA 5HQ5A 1X0JA 4ZC9A 4YC9A 5HLSA 5D3SA 4XY9A 5IIDA 5KTWA 4MENA 4HBVA 3JVMA 5F36A 5EICA 3U5JA 2OO1A 2YELA 4N4FA 5E9IA 4Z1SA 4QSWA 3ERRA 5H1VA 5EWHA 3U5KA 4UIVA 5A7CA 4UYGA 5D3JA 2E3KA 4YYMA 5AD3A 2R0VA 2RFJA 2NXBA 5DKCA 5KO4A 5DKDA 4N4IA 5CQ8A 5EK9A 5I7XA 4A9FA 4NRAA 4J0SA 4Y03A 5D26A 5CUDA 5A5RA 4NQNA 5II1A 2YEMA 4QYLA 3O37A 5CUEA 5HFRA 5LVRA 2YW5A 3AADA 4BW2A 5F5ZA 5L99A 5C89A 3JVLA 2RO1A 5HELA 3U5NA 4IR3A 3UV2A 4NR7A 3MQMA 4YBTA 4LR6A 5EWVA 1EQFA 4MR4A 4PS5A 2DVRA 5ETDA 5CUCA 4MEQA 5FH8A 4ALHA 3U5MA 4IR4A 4C66A 4LYIA 5L8UA 5H1UA 3HMEA 4UITA 5FE5A 4AI6A 4O76A 2H60A 3LQJA 4LYSA 3Q2FA 5H1TA 5FG4A 5EVAA 5EPBA 5HEMA 5EV9A 5CUGA 5EWWA 5CFWA 5EP7A 2N9GA 4WIVA 2KTBB 4CUSA 2MJVB 3VKGA 3UW9A 5DKHA 2DVSA 4UYFA 5D3HA 5ENEA 4NUEA
chains in the Genus database with same CATH topology
5FB0A 4QB3A 5A5SA 4A9KA 4J1PA 3U5OA 3IU6A 4X2IA 5CUBA 3MULA 5I40A 2YYNA 4N4HA 4QEUA 3DAIA 4YK0A 5EA1A 4LZRA 4LYWA 5F1LA 5IG6A 5I1QA 2OUOA 5CS8A 4WHWA 3O33A 5I89A 3O34A 4NUDA 4A9IA 4CUTA 5D25A 5FFYA 5LJ1A 2DWWA 4NR5A 4UIZA 5I29A 5AMFA 5CQAA 2RS9B 5LKXA 5IGKA 4LZ2A 3FKMX 3G0LA 5DBMA 3QZTA 4J3IA 2R0YA 2I7KA 5F62A 5HFQA 5HQ6A 4TS8A 2RNWA 3SVHA 4IOOA 4PCEA 4CL9A 5CRMA 5EM3A 5L98A 3MUKA 4YYIA 4O7BA 4RVRA 5FE2A 5LKZA 2RI7A 1F68A 4QR3A 5CTLA 5EU1A 5FDZA 5JI8A 1ZS5A 4QSPA 3UVYA 5BT3A 5CRZA 5CZGA 3UV4A 5LUUA 5EPRA 4Q0NA 3GG3A 5D3RA 4QSXA 5E9YA 4OUFA 4QR5A 3S91A 4UYFB 4YYKA 5D0CA 4IORA 5ETBA 4OGIA 4CURA 4TT6A 5EQ1A 5ENBA 3U5LA 4QC1A 5D3LA 4KV1A 3G0JA 5I80A 4TZ8A 4YYJA 4O70A 5DW2A 5A5OA 5CU8A 5E74A 4HBYA 3P5OA 4PKLA 5COIA 5D3TA 2YEKA 4NXJA 5F63A 5DLZA 4QNSA 4N3WA 5ENCA 5C4QA 4QUUA 5II2A 4TT4A 5HENA 5FE0A 5A85A 4HBXA 4QSRA 4QUTA 5H85A 4TZ2A 4XUBA 3SVGA 4CUUA 3O36A 1JSPB 4O7EA 4NQMA 4UIUA 4IOQA 4O71A 5DYUA 5CQ6A 4A9JA 5CY9A 5E0RA 4HXPA 4XUAA 5A5QA 4MEPA 5HQ7A 3QZVA 5FG5A 4QZSA 4KCXA 5BT5A 2RNXA 5KU3A 2LSPB 5D3PA 5L96A 5A83A 2D9EA 4QY4A 4Z1QA 4OGJA 3HMFA 5L97A 4Z6HA 4MR3A 2DKWA 5CQ3A 4YH3A 3LXJA 1JM4B 4O7CA 5FFWA 4QC3A 4QSSA 4LC2A 4MR6A 3RCWA 4NRCA 4FLPA 4ALGA 5AMEA 4QR4A 5HCLA 5F25A 5IGMA 5BT4A 5DFCA 2WP1A 4A9EA 4Z93A 4LZSA 4NR9A 5KHMA 3LQHA 5F2PA 4O7FA 4TTEA 5TCMA 5E9LA 5LVQA 4YABA 2R0SA 5A82A 3U5PA 4UIWA 5I86A 3K2JA 5CQ5A 4NRBA 4BW4A 4YY4A 3P1DA 4XY8A 3JVKA 4O77A 5E7DA 5JWMA 2D82A 3IU5A 4PCIA 3UVWA 4TU4A 3ONIA 5EISA 5LKUA 4YBMA 5CUAA 5C85A 5CQ4A 3MB4A 5FE8A 5E3GA 5K29A 4A9LA 5F3AA 4YADA 4GPJA 4ZW1A 3ZYUA 4IR6A 5CGPA 5A81A 2FSAA 5G4SA 4DONA 4Z6IA 5FE1A 5TB6A 3P1EA 4YAXA 5A5NA 5I88A 4PTBA 5HM0A 4NYXA 4TQNA 3Q2EA 5E9KA 5AD2A 3I3JA 4J0RA 2OSSA 5CQ7A 4TU6A 5CQTA 4HXLA 5FE4A 5ENGA 4UIYA 5C8GA 4E96A 5LJ0A 5E9VA 5HRVA 4HXNA 4BHWA 2WP2A 5EI4A 2E7NA 4QEVA 5C87A 4NYWA 4F3IA 5FE7A 2E7OA 4YYGA 5DW1A 4MR5A 4YH4A 4WHUA 4QSUA 5EWDA 5I7YA 2R10A 2RNYA 4HXRA 3S92A 5FBXA 2DATA 3SVFA 4HXKA 4NYVA 3MB3A 4UYDA 5D7XA 4BW1A 4YYNA 5EGUA 3DWYA 4LRGA 4YBSA 3O35A 3LQIA 2I8NA 5E3DA 5DYCA 5KTUA 5HJCA 3UVXA 5IGNA 5ENHA 5CP5A 3HMHA 3LJWA 2YDWA 4AKNA 5D24A 4HXOA 4CLBA 5FE6A 4PY6A 5I83A 4YYDA 5LKTA 5F60A 4KV4A 5IBNA 5DFDA 4HBWA 5FG6A 4XYAA 5J0DA 4UYHA 4UIXA 4CFLA 4QEWA 4NUCA 5LJ2A 5E73A 2DVVA 3AQAA 1WUMA 2L85A 5DY7A 3UVDA 5CPEA 4QYDA 5ENJA 4QBMA 1N72A 2F6NA 4A9OA 4QSQA 4N4GA 4CUQA 2GRCA 5KTXA 5HRXA 3TLPA 4A9MA 4CFKA 2L84A 5ENIA 5IGLA 5FE3A 4NR6A 4C67A 2G4AA 5DYAA 5FB1A 5L8TA 4NR4A 2F6JA 4IR5A 3JVJA 4HXMA 4O75A 4BJXA 2L5EA 3P1CA 5EWCA 5F61A 4HXSA 5HRWA 4O7AA 2DVQA 4Q0OA 5DX4A 5DYXA 3MXFA 4O72A 4NR8A 5ENFA 2YQDA 4LDFA 3QZSA 5FE9A 4CUPA 1E6IA 3UV5A 4QSVA 3D7CA 3NXBA 5ACYA 5C7NA 4YYHA 4TYLA 5D3NA 5DLXA 4O78A 1WUGA 4O74A 5F1HA 5FFVA 4ZQLA 4YATA 5FH6A 5DFBA 4UYEA 4A9NA 4TT2A 5E9MA 4NS5A 3P1FA 4QSTA 4A9HA 5FH7A 5G4RA 4MEOA 4BW3A 5EPSA 4YY6A 5A5PA 5HQ5A 1X0JA 4ZC9A 4YC9A 5HLSA 5D3SA 4XY9A 5IIDA 5KTWA 4MENA 4HBVA 3JVMA 5F36A 5EICA 3U5JA 2OO1A 2YELA 4N4FA 5E9IA 4Z1SA 4QSWA 5H1VA 5EWHA 3U5KA 4UIVA 5A7CA 4UYGA 5D3JA 2E3KA 4YYMA 5AD3A 2R0VA 2RFJA 2NXBA 5DKCA 5KO4A 5DKDA 4N4IA 5CQ8A 5EK9A 5I7XA 4A9FA 4NRAA 4J0SA 4Y03A 5D26A 5CUDA 5A5RA 4NQNA 5II1A 2YEMA 4QYLA 3O37A 5CUEA 5HFRA 5LVRA 2YW5A 3AADA 4BW2A 5F5ZA 5L99A 5C89A 3JVLA 2RO1A 5HELA 3U5NA 4IR3A 3UV2A 4NR7A 3MQMA 4YBTA 4LR6A 5EWVA 1EQFA 4MR4A 4PS5A 2DVRA 5ETDA 5CUCA 4MEQA 5FH8A 4ALHA 3U5MA 4IR4A 4C66A 4LYIA 5L8UA 5H1UA 3HMEA 4UITA 5FE5A 4O76A 2H60A 3LQJA 4LYSA 3Q2FA 5H1TA 5FG4A 5EVAA 5EPBA 5HEMA 5EV9A 5CUGA 5EWWA 5CFWA 5EP7A 2N9GA 4WIVA 2KTBB 4CUSA 2MJVB 3UW9A 5DKHA 2DVSA 4UYFA 5D3HA 5ENEA 4NUEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FB0 A;  4QB3 A;  5A5S A;  4A9K A;  4J1P A;  3U5O A;  3IU6 A;  4X2I A;  5CUB A;  3MUL A;  5I40 A;  2YYN A;  4N4H A;  4QEU A;  3DAI A;  4YK0 A;  5EA1 A;  4LZR A;  4LYW A;  5F1L A;  5IG6 A;  5I1Q A;  2OUO A;  5CS8 A;  4WHW A;  3O33 A;  5I89 A;  3O34 A;  4NUD A;  4A9I A;  4CUT A;  5D25 A;  5FFY A;  5LJ1 A;  2DWW A;  4NR5 A;  4UIZ A;  5I29 A;  5AMF A;  5CQA A;  2RS9 B;  5LKX A;  5IGK A;  4LZ2 A;  3FKM X;  3G0L A;  5DBM A;  3QZT A;  4J3I A;  2R0Y A;  2I7K A;  5F62 A;  5HFQ A;  5HQ6 A;  4TS8 A;  2RNW A;  3SVH A;  4IOO A;  4PCE A;  4CL9 A;  5CRM A;  5EM3 A;  5L98 A;  3MUK A;  4YYI A;  4O7B A;  4RVR A;  5FE2 A;  5LKZ A;  2RI7 A;  1F68 A;  4QR3 A;  5CTL A;  5EU1 A;  5FDZ A;  5JI8 A;  1ZS5 A;  4QSP A;  3UVY A;  5BT3 A;  5CRZ A;  5CZG A;  3UV4 A;  5LUU A;  5EPR A;  4Q0N A;  3GG3 A;  5D3R A;  4QSX A;  5E9Y A;  4OUF A;  4QR5 A;  3S91 A;  4UYF B;  4YYK A;  5D0C A;  4IOR A;  5ETB A;  4OGI A;  4CUR A;  4TT6 A;  5EQ1 A;  5ENB A;  3U5L A;  4QC1 A;  5D3L A;  4KV1 A;  3G0J A;  5I80 A;  4TZ8 A;  4YYJ A;  4O70 A;  5DW2 A;  5A5O A;  5CU8 A;  5E74 A;  4HBY A;  3P5O A;  4PKL A;  5COI A;  5D3T A;  2YEK A;  4NXJ A;  5F63 A;  5DLZ A;  4QNS A;  4N3W A;  5ENC A;  5C4Q A;  4QUU A;  5II2 A;  4TT4 A;  5HEN A;  5FE0 A;  5A85 A;  4HBX A;  4QSR A;  4QUT A;  5H85 A;  4TZ2 A;  4XUB A;  3SVG A;  4CUU A;  3O36 A;  1JSP B;  4O7E A;  4NQM A;  4UIU A;  4IOQ A;  4O71 A;  5DYU A;  5CQ6 A;  4A9J A;  5CY9 A;  5E0R A;  4HXP A;  4XUA A;  5A5Q A;  4MEP A;  5HQ7 A;  3QZV A;  5FG5 A;  4QZS A;  4KCX A;  5BT5 A;  2RNX A;  5KU3 A;  2LSP B;  5D3P A;  5L96 A;  5A83 A;  2D9E A;  4QY4 A;  4Z1Q A;  4OGJ A;  3HMF A;  5L97 A;  4Z6H A;  4MR3 A;  2DKW A;  5CQ3 A;  4YH3 A;  3LXJ A;  1JM4 B;  4O7C A;  5FFW A;  4QC3 A;  4QSS A;  4LC2 A;  4MR6 A;  3RCW A;  4NRC A;  4FLP A;  4ALG A;  5AME A;  4QR4 A;  5HCL A;  5F25 A;  5IGM A;  5BT4 A;  5DFC A;  2WP1 A;  4A9E A;  4Z93 A;  4LZS A;  4NR9 A;  5KHM A;  3LQH A;  5F2P A;  4O7F A;  4TTE A;  5TCM A;  5E9L A;  5LVQ A;  4YAB A;  2R0S A;  5A82 A;  3U5P A;  4UIW A;  5I86 A;  3K2J A;  5CQ5 A;  4NRB A;  4BW4 A;  4YY4 A;  3P1D A;  4XY8 A;  3JVK A;  4O77 A;  5E7D A;  5JWM A;  2D82 A;  3IU5 A;  4PCI A;  3UVW A;  4TU4 A;  3ONI A;  5EIS A;  5LKU A;  4YBM A;  5CUA A;  5C85 A;  5CQ4 A;  3MB4 A;  5FE8 A;  5E3G A;  5K29 A;  4A9L A;  5F3A A;  4YAD A;  4GPJ A;  4ZW1 A;  3ZYU A;  4IR6 A;  5CGP A;  5A81 A;  2FSA A;  5G4S A;  4DON A;  4Z6I A;  5FE1 A;  5TB6 A;  3P1E A;  4YAX A;  5A5N A;  5I88 A;  4PTB A;  5HM0 A;  4NYX A;  4TQN A;  3Q2E A;  5E9K A;  5AD2 A;  3I3J A;  4J0R A;  2OSS A;  5CQ7 A;  4TU6 A;  5CQT A;  4HXL A;  5FE4 A;  5ENG A;  4UIY A;  5C8G A;  4E96 A;  5LJ0 A;  5E9V A;  5HRV A;  4HXN A;  4BHW A;  2WP2 A;  5EI4 A;  2E7N A;  4QEV A;  5C87 A;  4NYW A;  4F3I A;  5FE7 A;  2E7O A;  4YYG A;  5DW1 A;  4MR5 A;  4YH4 A;  4WHU A;  4QSU A;  5EWD A;  5I7Y A;  2R10 A;  2RNY A;  4HXR A;  3S92 A;  5FBX A;  2DAT A;  3SVF A;  4HXK A;  4NYV A;  3MB3 A;  4UYD A;  5D7X A;  4BW1 A;  4YYN A;  5EGU A;  3DWY A;  4LRG A;  4YBS A;  3O35 A;  3LQI A;  2I8N A;  5E3D A;  5DYC A;  5KTU A;  5HJC A;  3UVX A;  5IGN A;  5ENH A;  5CP5 A;  3HMH A;  3LJW A;  2YDW A;  4AKN A;  5D24 A;  4HXO A;  4CLB A;  5FE6 A;  4PY6 A;  5I83 A;  4YYD A;  5LKT A;  5F60 A;  4KV4 A;  5IBN A;  5DFD A;  4HBW A;  5FG6 A;  4XYA A;  5J0D A;  4UYH A;  4UIX A;  4CFL A;  4QEW A;  4NUC A;  5LJ2 A;  5E73 A;  2DVV A;  3AQA A;  1WUM A;  2L85 A;  5DY7 A;  3UVD A;  5CPE A;  4QYD A;  5ENJ A;  4QBM A;  1N72 A;  2F6N A;  4A9O A;  4QSQ A;  4N4G A;  4CUQ A;  2GRC A;  5KTX A;  5HRX A;  3TLP A;  4A9M A;  4CFK A;  2L84 A;  5ENI A;  5IGL A;  5FE3 A;  4NR6 A;  4C67 A;  2G4A A;  5DYA A;  5FB1 A;  5L8T A;  4NR4 A;  2F6J A;  4IR5 A;  3JVJ A;  4HXM A;  4O75 A;  4BJX A;  2L5E A;  3P1C A;  5EWC A;  5F61 A;  4HXS A;  5HRW A;  4O7A A;  2DVQ A;  4Q0O A;  5DX4 A;  5DYX A;  3MXF A;  4O72 A;  4NR8 A;  5ENF A;  2YQD A;  4LDF A;  3QZS A;  5FE9 A;  4CUP A;  1E6I A;  3UV5 A;  4QSV A;  3D7C A;  3NXB A;  5ACY A;  5C7N A;  4YYH A;  4TYL A;  5D3N A;  5DLX A;  4O78 A;  1WUG A;  4O74 A;  5F1H A;  5FFV A;  4ZQL A;  4YAT A;  5FH6 A;  5DFB A;  4UYE A;  4A9N A;  4TT2 A;  5E9M A;  4NS5 A;  3P1F A;  4QST A;  4A9H A;  5FH7 A;  5G4R A;  4MEO A;  4BW3 A;  5EPS A;  4YY6 A;  5A5P A;  5HQ5 A;  1X0J A;  4ZC9 A;  4YC9 A;  5HLS A;  5D3S A;  4XY9 A;  5IID A;  5KTW A;  4MEN A;  4HBV A;  3JVM A;  5F36 A;  5EIC A;  3U5J A;  2OO1 A;  2YEL A;  4N4F A;  5E9I A;  4Z1S A;  4QSW A;  5H1V A;  5EWH A;  3U5K A;  4UIV A;  5A7C A;  4UYG A;  5D3J A;  2E3K A;  4YYM A;  5AD3 A;  2R0V A;  2RFJ A;  2NXB A;  5DKC A;  5KO4 A;  5DKD A;  4N4I A;  5CQ8 A;  5EK9 A;  5I7X A;  4A9F A;  4NRA A;  4J0S A;  4Y03 A;  5D26 A;  5CUD A;  5A5R A;  4NQN A;  5II1 A;  2YEM A;  4QYL A;  3O37 A;  5CUE A;  5HFR A;  5LVR A;  2YW5 A;  3AAD A;  4BW2 A;  5F5Z A;  5L99 A;  5C89 A;  3JVL A;  2RO1 A;  5HEL A;  3U5N A;  4IR3 A;  3UV2 A;  4NR7 A;  3MQM A;  4YBT A;  4LR6 A;  5EWV A;  1EQF A;  4MR4 A;  4PS5 A;  2DVR A;  5ETD A;  5CUC A;  4MEQ A;  5FH8 A;  4ALH A;  3U5M A;  4IR4 A;  4C66 A;  4LYI A;  5L8U A;  5H1U A;  3HME A;  4UIT A;  5FE5 A;  4O76 A;  2H60 A;  3LQJ A;  4LYS A;  3Q2F A;  5H1T A;  5FG4 A;  5EVA A;  5EPB A;  5HEM A;  5EV9 A;  5CUG A;  5EWW A;  5CFW A;  5EP7 A;  2N9G A;  4WIV A;  2KTB B;  4CUS A;  2MJV B;  3UW9 A;  5DKH A;  2DVS A;  4UYF A;  5D3H A;  5ENE A;  4NUE A; 
#chains in the Genus database with same CATH topology
 5FB0 A;  4QB3 A;  5A5S A;  4A9K A;  4J1P A;  3U5O A;  3IU6 A;  4X2I A;  5CUB A;  3MUL A;  5I40 A;  2YYN A;  4N4H A;  4QEU A;  3DAI A;  4YK0 A;  5EA1 A;  4LZR A;  4LYW A;  5F1L A;  5IG6 A;  5I1Q A;  2OUO A;  5CS8 A;  4WHW A;  3O33 A;  5I89 A;  3O34 A;  4NUD A;  4A9I A;  4CUT A;  5D25 A;  5FFY A;  5LJ1 A;  2DWW A;  4NR5 A;  4UIZ A;  5I29 A;  5AMF A;  5CQA A;  2RS9 B;  5LKX A;  5IGK A;  4LZ2 A;  3FKM X;  3G0L A;  5DBM A;  3QZT A;  4J3I A;  2R0Y A;  2I7K A;  5F62 A;  5HFQ A;  5HQ6 A;  4TS8 A;  2RNW A;  3SVH A;  4IOO A;  4PCE A;  4CL9 A;  5CRM A;  5EM3 A;  5L98 A;  3MUK A;  4YYI A;  4O7B A;  4RVR A;  5FE2 A;  5LKZ A;  2RI7 A;  1F68 A;  4QR3 A;  5CTL A;  5EU1 A;  5FDZ A;  5JI8 A;  1ZS5 A;  4QSP A;  3UVY A;  5BT3 A;  5CRZ A;  5CZG A;  3UV4 A;  5LUU A;  5EPR A;  4Q0N A;  3GG3 A;  5D3R A;  4QSX A;  5E9Y A;  4OUF A;  4QR5 A;  3S91 A;  4UYF B;  4YYK A;  5D0C A;  4IOR A;  5ETB A;  4OGI A;  4CUR A;  4TT6 A;  5EQ1 A;  5ENB A;  3U5L A;  4QC1 A;  5D3L A;  4KV1 A;  3G0J A;  5I80 A;  4TZ8 A;  4YYJ A;  4O70 A;  5DW2 A;  5A5O A;  5CU8 A;  5E74 A;  4HBY A;  3P5O A;  4PKL A;  5COI A;  5D3T A;  2YEK A;  4NXJ A;  5F63 A;  5DLZ A;  4AKH A;  4QNS A;  4N3W A;  5ENC A;  5C4Q A;  4QUU A;  5II2 A;  4TT4 A;  5HEN A;  5FE0 A;  5A85 A;  4HBX A;  4QSR A;  4QUT A;  5H85 A;  4TZ2 A;  4XUB A;  3SVG A;  4CUU A;  3O36 A;  1JSP B;  4O7E A;  4NQM A;  4UIU A;  4IOQ A;  4O71 A;  5DYU A;  5CQ6 A;  4A9J A;  5CY9 A;  5E0R A;  4HXP A;  4XUA A;  5A5Q A;  4MEP A;  5HQ7 A;  3QZV A;  5FG5 A;  4QZS A;  4KCX A;  5BT5 A;  2RNX A;  5KU3 A;  2LSP B;  5D3P A;  5L96 A;  5A83 A;  2D9E A;  4QY4 A;  4Z1Q A;  4OGJ A;  3HMF A;  5L97 A;  4Z6H A;  4MR3 A;  2DKW A;  5CQ3 A;  4YH3 A;  3LXJ A;  1JM4 B;  4O7C A;  5FFW A;  4QC3 A;  4QSS A;  4LC2 A;  4MR6 A;  3RCW A;  4NRC A;  4FLP A;  4ALG A;  5AME A;  4QR4 A;  5HCL A;  4AKI A;  5F25 A;  5IGM A;  5BT4 A;  5DFC A;  2WP1 A;  4A9E A;  4Z93 A;  4LZS A;  4NR9 A;  5KHM A;  3LQH A;  5F2P A;  4O7F A;  4TTE A;  5TCM A;  5E9L A;  5LVQ A;  4YAB A;  2R0S A;  1ZKR A;  5A82 A;  3U5P A;  4UIW A;  5I86 A;  3K2J A;  5CQ5 A;  4NRB A;  4BW4 A;  4YY4 A;  3P1D A;  4XY8 A;  3JVK A;  4O77 A;  5E7D A;  5JWM A;  2D82 A;  3IU5 A;  4PCI A;  3UVW A;  4TU4 A;  3ONI A;  5EIS A;  5LKU A;  4YBM A;  5CUA A;  5C85 A;  5CQ4 A;  3MB4 A;  5FE8 A;  5E3G A;  5K29 A;  4A9L A;  5F3A A;  4YAD A;  4GPJ A;  4ZW1 A;  3ZYU A;  4IR6 A;  5CGP A;  5A81 A;  2FSA A;  5G4S A;  4DON A;  4Z6I A;  5FE1 A;  5TB6 A;  3P1E A;  4YAX A;  5A5N A;  5I88 A;  4PTB A;  5HM0 A;  4NYX A;  4TQN A;  3Q2E A;  5E9K A;  5AD2 A;  3I3J A;  4J0R A;  2OSS A;  5CQ7 A;  4TU6 A;  5CQT A;  4HXL A;  3VKH A;  5FE4 A;  5ENG A;  4UIY A;  5C8G A;  4E96 A;  5LJ0 A;  1PUO A;  5E9V A;  4HXN A;  5HRV A;  2WP2 A;  4BHW A;  5EI4 A;  2E7N A;  4QEV A;  5C87 A;  4NYW A;  4F3I A;  5FE7 A;  2E7O A;  4YYG A;  5DW1 A;  4MR5 A;  4YH4 A;  4WHU A;  4QSU A;  5EWD A;  5I7Y A;  2R10 A;  2RNY A;  4HXR A;  3S92 A;  5FBX A;  2DAT A;  3SVF A;  4HXK A;  4NYV A;  3MB3 A;  4UYD A;  5D7X A;  4BW1 A;  4YYN A;  5EGU A;  3DWY A;  4LRG A;  4YBS A;  3O35 A;  3LQI A;  2I8N A;  5E3D A;  5DYC A;  5KTU A;  5HJC A;  3UVX A;  5IGN A;  5ENH A;  5CP5 A;  3HMH A;  3LJW A;  2YDW A;  4AKN A;  5D24 A;  4HXO A;  4CLB A;  5FE6 A;  4PY6 A;  5I83 A;  4YYD A;  5LKT A;  5F60 A;  4KV4 A;  5IBN A;  5DFD A;  4HBW A;  5FG6 A;  4XYA A;  5J0D A;  4UYH A;  4UIX A;  4CFL A;  4QEW A;  4NUC A;  5LJ2 A;  5E73 A;  2DVV A;  3AQA A;  1WUM A;  2L85 A;  5DY7 A;  3UVD A;  5CPE A;  4QYD A;  5ENJ A;  3D1D A;  4QBM A;  3D1B A;  1N72 A;  2F6N A;  4A9O A;  4QSQ A;  4N4G A;  4CUQ A;  2GRC A;  5KTX A;  5HRX A;  3TLP A;  4A9M A;  4CFK A;  2L84 A;  5ENI A;  5IGL A;  5FE3 A;  4NR6 A;  4C67 A;  2G4A A;  5DYA A;  5FB1 A;  5L8T A;  4NR4 A;  2F6J A;  4IR5 A;  3JVJ A;  4HXM A;  4O75 A;  4BJX A;  2L5E A;  2EJN A;  3P1C A;  5EWC A;  4HXS A;  5F61 A;  5HRW A;  4O7A A;  2DVQ A;  4Q0O A;  5DX4 A;  5DYX A;  3MXF A;  4O72 A;  4NR8 A;  5ENF A;  2YQD A;  4LDF A;  3QZS A;  5FE9 A;  4CUP A;  1E6I A;  3UV5 A;  4QSV A;  3D7C A;  4AKG A;  3NXB A;  5ACY A;  5C7N A;  4YYH A;  4TYL A;  5D3N A;  5DLX A;  4O78 A;  1WUG A;  4O74 A;  5F1H A;  5FFV A;  4ZQL A;  4YAT A;  5FH6 A;  5DFB A;  4UYE A;  4A9N A;  4TT2 A;  5E9M A;  4NS5 A;  3P1F A;  4QST A;  4A9H A;  5FH7 A;  5G4R A;  4MEO A;  4BW3 A;  5EPS A;  4YY6 A;  5A5P A;  5HQ5 A;  1X0J A;  4ZC9 A;  4YC9 A;  5HLS A;  5D3S A;  4XY9 A;  5IID A;  5KTW A;  4MEN A;  4HBV A;  3JVM A;  5F36 A;  5EIC A;  3U5J A;  2OO1 A;  2YEL A;  4N4F A;  5E9I A;  4Z1S A;  4QSW A;  3ERR A;  5H1V A;  5EWH A;  3U5K A;  4UIV A;  5A7C A;  4UYG A;  5D3J A;  2E3K A;  4YYM A;  5AD3 A;  2R0V A;  2RFJ A;  2NXB A;  5DKC A;  5KO4 A;  5DKD A;  4N4I A;  5CQ8 A;  5EK9 A;  5I7X A;  4A9F A;  4NRA A;  4J0S A;  4Y03 A;  5D26 A;  5CUD A;  5A5R A;  4NQN A;  5II1 A;  2YEM A;  4QYL A;  3O37 A;  5CUE A;  5HFR A;  5LVR A;  2YW5 A;  3AAD A;  4BW2 A;  5F5Z A;  5L99 A;  5C89 A;  3JVL A;  2RO1 A;  5HEL A;  3U5N A;  4IR3 A;  3UV2 A;  4NR7 A;  3MQM A;  4YBT A;  4LR6 A;  5EWV A;  1EQF A;  4MR4 A;  4PS5 A;  2DVR A;  5ETD A;  5CUC A;  4MEQ A;  5FH8 A;  4ALH A;  3U5M A;  4IR4 A;  4C66 A;  4LYI A;  5L8U A;  5H1U A;  3HME A;  4UIT A;  5FE5 A;  4AI6 A;  4O76 A;  2H60 A;  3LQJ A;  4LYS A;  3Q2F A;  5H1T A;  5FG4 A;  5EVA A;  5EPB A;  5HEM A;  5EV9 A;  5CUG A;  5EWW A;  5CFW A;  5EP7 A;  2N9G A;  4WIV A;  2KTB B;  4CUS A;  2MJV B;  3VKG A;  3UW9 A;  5DKH A;  2DVS A;  4UYF A;  5D3H A;  5ENE A;  4NUE A; 
#chains in the Genus database with same CATH homology
 5FB0 A;  4QB3 A;  5A5S A;  4A9K A;  4J1P A;  3U5O A;  3IU6 A;  4X2I A;  5CUB A;  3MUL A;  5I40 A;  2YYN A;  4N4H A;  4QEU A;  3DAI A;  4YK0 A;  5EA1 A;  4LZR A;  4LYW A;  5F1L A;  5IG6 A;  5I1Q A;  2OUO A;  5CS8 A;  4WHW A;  3O33 A;  5I89 A;  3O34 A;  4NUD A;  4A9I A;  4CUT A;  5D25 A;  5FFY A;  5LJ1 A;  2DWW A;  4NR5 A;  4UIZ A;  5I29 A;  5AMF A;  5CQA A;  2RS9 B;  5LKX A;  5IGK A;  4LZ2 A;  3FKM X;  3G0L A;  5DBM A;  3QZT A;  4J3I A;  2R0Y A;  2I7K A;  5F62 A;  5HFQ A;  5HQ6 A;  4TS8 A;  2RNW A;  3SVH A;  4IOO A;  4PCE A;  4CL9 A;  5CRM A;  5EM3 A;  5L98 A;  3MUK A;  4YYI A;  4O7B A;  4RVR A;  5FE2 A;  5LKZ A;  2RI7 A;  1F68 A;  4QR3 A;  5CTL A;  5EU1 A;  5FDZ A;  5JI8 A;  1ZS5 A;  4QSP A;  3UVY A;  5BT3 A;  5CRZ A;  5CZG A;  3UV4 A;  5LUU A;  5EPR A;  4Q0N A;  3GG3 A;  5D3R A;  4QSX A;  5E9Y A;  4OUF A;  4QR5 A;  3S91 A;  4UYF B;  4YYK A;  5D0C A;  4IOR A;  5ETB A;  4OGI A;  4CUR A;  4TT6 A;  5EQ1 A;  5ENB A;  3U5L A;  4QC1 A;  5D3L A;  4KV1 A;  3G0J A;  5I80 A;  4TZ8 A;  4YYJ A;  4O70 A;  5DW2 A;  5A5O A;  5CU8 A;  5E74 A;  4HBY A;  3P5O A;  4PKL A;  5COI A;  5D3T A;  2YEK A;  4NXJ A;  5F63 A;  5DLZ A;  4QNS A;  4N3W A;  5ENC A;  5C4Q A;  4QUU A;  5II2 A;  4TT4 A;  5HEN A;  5FE0 A;  5A85 A;  4HBX A;  4QSR A;  4QUT A;  5H85 A;  4TZ2 A;  4XUB A;  3SVG A;  4CUU A;  3O36 A;  1JSP B;  4O7E A;  4NQM A;  4UIU A;  4IOQ A;  4O71 A;  5DYU A;  5CQ6 A;  4A9J A;  5CY9 A;  5E0R A;  4HXP A;  4XUA A;  5A5Q A;  4MEP A;  5HQ7 A;  3QZV A;  5FG5 A;  4QZS A;  4KCX A;  5BT5 A;  2RNX A;  5KU3 A;  2LSP B;  5D3P A;  5L96 A;  5A83 A;  2D9E A;  4QY4 A;  4Z1Q A;  4OGJ A;  3HMF A;  5L97 A;  4Z6H A;  4MR3 A;  2DKW A;  5CQ3 A;  4YH3 A;  3LXJ A;  1JM4 B;  4O7C A;  5FFW A;  4QC3 A;  4QSS A;  4LC2 A;  4MR6 A;  3RCW A;  4NRC A;  4FLP A;  4ALG A;  5AME A;  4QR4 A;  5HCL A;  5F25 A;  5IGM A;  5BT4 A;  5DFC A;  2WP1 A;  4A9E A;  4Z93 A;  4LZS A;  4NR9 A;  5KHM A;  3LQH A;  5F2P A;  4O7F A;  4TTE A;  5TCM A;  5E9L A;  5LVQ A;  4YAB A;  2R0S A;  5A82 A;  3U5P A;  4UIW A;  5I86 A;  3K2J A;  5CQ5 A;  4NRB A;  4BW4 A;  4YY4 A;  3P1D A;  4XY8 A;  3JVK A;  4O77 A;  5E7D A;  5JWM A;  2D82 A;  3IU5 A;  4PCI A;  3UVW A;  4TU4 A;  3ONI A;  5EIS A;  5LKU A;  4YBM A;  5CUA A;  5C85 A;  5CQ4 A;  3MB4 A;  5FE8 A;  5E3G A;  5K29 A;  4A9L A;  5F3A A;  4YAD A;  4GPJ A;  4ZW1 A;  3ZYU A;  4IR6 A;  5CGP A;  5A81 A;  2FSA A;  5G4S A;  4DON A;  4Z6I A;  5FE1 A;  5TB6 A;  3P1E A;  4YAX A;  5A5N A;  5I88 A;  4PTB A;  5HM0 A;  4NYX A;  4TQN A;  3Q2E A;  5E9K A;  5AD2 A;  3I3J A;  4J0R A;  2OSS A;  5CQ7 A;  4TU6 A;  5CQT A;  4HXL A;  5FE4 A;  5ENG A;  4UIY A;  5C8G A;  4E96 A;  5LJ0 A;  5E9V A;  5HRV A;  4HXN A;  4BHW A;  2WP2 A;  5EI4 A;  2E7N A;  4QEV A;  5C87 A;  4NYW A;  4F3I A;  5FE7 A;  2E7O A;  4YYG A;  5DW1 A;  4MR5 A;  4YH4 A;  4WHU A;  4QSU A;  5EWD A;  5I7Y A;  2R10 A;  2RNY A;  4HXR A;  3S92 A;  5FBX A;  2DAT A;  3SVF A;  4HXK A;  4NYV A;  3MB3 A;  4UYD A;  5D7X A;  4BW1 A;  4YYN A;  5EGU A;  3DWY A;  4LRG A;  4YBS A;  3O35 A;  3LQI A;  2I8N A;  5E3D A;  5DYC A;  5KTU A;  5HJC A;  3UVX A;  5IGN A;  5ENH A;  5CP5 A;  3HMH A;  3LJW A;  2YDW A;  4AKN A;  5D24 A;  4HXO A;  4CLB A;  5FE6 A;  4PY6 A;  5I83 A;  4YYD A;  5LKT A;  5F60 A;  4KV4 A;  5IBN A;  5DFD A;  4HBW A;  5FG6 A;  4XYA A;  5J0D A;  4UYH A;  4UIX A;  4CFL A;  4QEW A;  4NUC A;  5LJ2 A;  5E73 A;  2DVV A;  3AQA A;  1WUM A;  2L85 A;  5DY7 A;  3UVD A;  5CPE A;  4QYD A;  5ENJ A;  4QBM A;  1N72 A;  2F6N A;  4A9O A;  4QSQ A;  4N4G A;  4CUQ A;  2GRC A;  5KTX A;  5HRX A;  3TLP A;  4A9M A;  4CFK A;  2L84 A;  5ENI A;  5IGL A;  5FE3 A;  4NR6 A;  4C67 A;  2G4A A;  5DYA A;  5FB1 A;  5L8T A;  4NR4 A;  2F6J A;  4IR5 A;  3JVJ A;  4HXM A;  4O75 A;  4BJX A;  2L5E A;  3P1C A;  5EWC A;  5F61 A;  4HXS A;  5HRW A;  4O7A A;  2DVQ A;  4Q0O A;  5DX4 A;  5DYX A;  3MXF A;  4O72 A;  4NR8 A;  5ENF A;  2YQD A;  4LDF A;  3QZS A;  5FE9 A;  4CUP A;  1E6I A;  3UV5 A;  4QSV A;  3D7C A;  3NXB A;  5ACY A;  5C7N A;  4YYH A;  4TYL A;  5D3N A;  5DLX A;  4O78 A;  1WUG A;  4O74 A;  5F1H A;  5FFV A;  4ZQL A;  4YAT A;  5FH6 A;  5DFB A;  4UYE A;  4A9N A;  4TT2 A;  5E9M A;  4NS5 A;  3P1F A;  4QST A;  4A9H A;  5FH7 A;  5G4R A;  4MEO A;  4BW3 A;  5EPS A;  4YY6 A;  5A5P A;  5HQ5 A;  1X0J A;  4ZC9 A;  4YC9 A;  5HLS A;  5D3S A;  4XY9 A;  5IID A;  5KTW A;  4MEN A;  4HBV A;  3JVM A;  5F36 A;  5EIC A;  3U5J A;  2OO1 A;  2YEL A;  4N4F A;  5E9I A;  4Z1S A;  4QSW A;  5H1V A;  5EWH A;  3U5K A;  4UIV A;  5A7C A;  4UYG A;  5D3J A;  2E3K A;  4YYM A;  5AD3 A;  2R0V A;  2RFJ A;  2NXB A;  5DKC A;  5KO4 A;  5DKD A;  4N4I A;  5CQ8 A;  5EK9 A;  5I7X A;  4A9F A;  4NRA A;  4J0S A;  4Y03 A;  5D26 A;  5CUD A;  5A5R A;  4NQN A;  5II1 A;  2YEM A;  4QYL A;  3O37 A;  5CUE A;  5HFR A;  5LVR A;  2YW5 A;  3AAD A;  4BW2 A;  5F5Z A;  5L99 A;  5C89 A;  3JVL A;  2RO1 A;  5HEL A;  3U5N A;  4IR3 A;  3UV2 A;  4NR7 A;  3MQM A;  4YBT A;  4LR6 A;  5EWV A;  1EQF A;  4MR4 A;  4PS5 A;  2DVR A;  5ETD A;  5CUC A;  4MEQ A;  5FH8 A;  4ALH A;  3U5M A;  4IR4 A;  4C66 A;  4LYI A;  5L8U A;  5H1U A;  3HME A;  4UIT A;  5FE5 A;  4O76 A;  2H60 A;  3LQJ A;  4LYS A;  3Q2F A;  5H1T A;  5FG4 A;  5EVA A;  5EPB A;  5HEM A;  5EV9 A;  5CUG A;  5EWW A;  5CFW A;  5EP7 A;  2N9G A;  4WIV A;  2KTB B;  4CUS A;  2MJV B;  3UW9 A;  5DKH A;  2DVS A;  4UYF A;  5D3H A;  5ENE A;  4NUE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...