5JWMA

Bivalent bet bromodomain inhibition
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
110
structure length
110
Chain Sequence
VSEQLKCCSGILKEMFAKKHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bromodomain-containing protein 4
publication title Design and characterization of bivalent BET inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/transcription inhibitor
total genus 38
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5jwmA00
5F61A 4QSPA 5EM3A 5HEMA 5CU8A 5DYUA 4UYFA 4O7AA 4LRGA 5G4SA 4A9NA 2OUOA 5CQ6A 5F3AA 1EQFA 5A83A 5E7DA 4J0SA 4UITA 3U5JA 5CUDA 4Y03A 2F6NA 2L85A 5FH8A 5BT4A 5C4QA 4O75A 4LYWA 4BW2A 2MJVB 5CTLA 5HRWA 5DKDA 5F62A 5A81A 5FE5A 5DYXA 3S92A 4QSWA 5EA1A 3QZSA 4MR4A 5FE1A 3AQAA 4Z1SA 2OSSA 5A5OA 4O70A 3P5OA 4J1PA 5E9LA 5IG6A 4YYGA 5EK9A 4QYLA 4ZW1A 5EPSA 5FB0A 5ETBA 4QR5A 4MR6A 3K2JA 3G0LA 5HM0A 3U5PA 3UW9A 2KTBB 4NR7A 5L8UA 5D26A 5E74A 4LYIA 2L84A 4C67A 5CQ8A 4TZ8A 4TT2A 3G0JA 5CRZA 2DVSA 3LQIA 4E96A 4QB3A 4QEWA 5E9IA 4YBSA 4HXMA 4A9LA 4NUDA 5FE3A 4AKNA 2D82A 4CUQA 4WIVA 5IIDA 5FE0A 5H1TA 4QR4A 2OO1A 4ZQLA 4NRBA 4O7FA 4O71A 4DONA 5HRXA 2RNXA 4XYAA 5II2A 5AMEA 4YAXA 5I1QA 3O33A 1WUMA 4YYJA 4MEQA 5DFDA 5CRMA 4QNSA 3IU6A 2RFJA 5C7NA 5IBNA 4QSSA 3JVLA 5LKTA 4TU6A 5EVAA 4CFKA 3P1DA 3IU5A 3UVXA 4YBMA 5ENCA 4PS5A 3HMFA 4UYHA 2E7OA 4HBYA 5FE2A 2DVRA 4Q0OA 4NUCA 4UYFB 4MR5A 5FH7A 4YYHA 4N3WA 4NRCA 4QBMA 5E9MA 5ENBA 4Z6HA 5KTXA 2DATA 4WHUA 3SVFA 5CFWA 2I7KA 5K29A 5A85A 5EP7A 4IOOA 4J0RA 5D24A 5JI8A 4YYNA 3O36A 4YH4A 5EICA 4PY6A 5E0RA 4KV1A 4CUSA 5CQ7A 4A9HA 4NS5A 4O76A 2YELA 5FG6A 4HBVA 2H60A 5I89A 3SVHA 2DVQA 5EWWA 5C85A 4HXSA 5LKZA 2YDWA 5EWVA 4J3IA 5HRVA 4HBXA 4NQNA 5HQ6A 5H1UA 2YEMA 4UIZA 3UVWA 2R10A 3I3JA 5DFCA 4A9OA 4XY8A 3FKMX 4NQMA 5I83A 5E3DA 5FG5A 5FFYA 4NR5A 4UYEA 2RI7A 5G4RA 2R0YA 4LYSA 5EPRA 5DKHA 5L98A 4QUUA 4IR4A 5LKUA 4HXOA 3JVJA 4TQNA 1E6IA 4NRAA 4FLPA 4YY4A 3JVKA 4RVRA 5EISA 4QUTA 3U5KA 3QZTA 4UYGA 4QEVA 4HXRA 5FH6A 2R0VA 4A9EA 4HXLA 5CQTA 5E9KA 5H1VA 4ALHA 4O7CA 4F3IA 3P1FA 5FE6A 5HELA 5CUEA 4N4FA 5AD3A 4CUTA 2YEKA 2GRCA 5J0DA 3DAIA 5CP5A 2DKWA 4BHWA 5CGPA 4NYXA 3MB3A 5BT5A 4QR3A 5E9YA 5FE9A 5II1A 4C66A 3HMEA 5HQ5A 3JVMA 3UV5A 4BW1A 5CY9A 5EWDA 4UIYA 3MULA 4UIVA 4LC2A 4LR6A 4XY9A 4YYMA 3U5LA 5A5NA 4YH3A 5TB6A 2YQDA 2YYNA 2G4AA 4UIXA 2DVVA 5I40A 5ENGA 5IGKA 4HXNA 4N4GA 5DW1A 4NXJA 4N4HA 4O72A 4TT6A 5L97A 4YYIA 3LXJA 4GPJA 4PKLA 4CURA 5CQ4A 5LVRA 5KU3A 4YYDA 5I7YA 4A9MA 5CPEA 5FDZA 5COIA 5CQ3A 5AD2A 5A5QA 4YYKA 5A82A 5DBMA 5AMFA 2E7NA 4QZSA 4LDFA 3LQHA 3UVYA 3Q2EA 5FE4A 4OGJA 4TTEA 4MENA 5DYCA 2E3KA 4QSUA 4NYWA 1ZS5A 5DX4A 5LJ2A 4IR3A 4KV4A 3U5NA 5IGNA 3UV4A 4ALGA 4BW4A 5D0CA 5I86A 4PCEA 3O35A 4NR6A 5F36A 2R0SA 1WUGA 5EWHA 5KTUA 4O74A 5H85A 4BW3A 5ENHA 5JWMA 5CUAA 2F6JA 5L99A 5LJ0A 4A9IA 2RNWA 4O7BA 5CUBA 5D3JA 2DWWA 3P1EA 4BJXA 5KHMA 4Z1QA 4MEPA 5E73A 4LZSA 1JSPB 5HLSA 5HFRA 5EU1A 2RO1A 4KCXA 3O37A 4A9JA 4IOQA 5CZGA 5CQAA 4YY6A 5CUGA 5C89A 5HCLA 2RS9B 2D9EA 5LVQA 3UVDA 5ENIA 5ACYA 2YW5A 4CFLA 5EGUA 3S91A 4NYVA 5BT3A 2WP1A 3P1CA 3LQJA 2LSPB 4NR9A 4WHWA 4ZC9A 3LJWA 5A5PA 5DY7A 4TT4A 4LZ2A 5IGMA 5F1HA 5EV9A 4QSRA 4LZRA 5KO4A 4YABA 4HXKA 1F68A 5D3SA 4HXPA 4O7EA 4TS8A 3MQMA 4Z93A 2N9GA 5FB1A 3QZVA 4O78A 5FFWA 5IGLA 4CUUA 5C87A 5HENA 4CL9A 5I7XA 3TLPA 5FG4A 3AADA 3HMHA 4IR5A 5D3TA 5HFQA 4CLBA 4QC1A 5FFVA 5ETDA 5DLZA 4TYLA 5EI4A 5CUCA 4PCIA 5LJ1A 5LKXA 3DWYA 4TZ2A 5D7XA 2I8NA 5L8TA 4Q0NA 5DW2A 2RNYA 4QSTA 3MXFA 4QEUA 4A9FA 5FE8A 5ENJA 4Z6IA 4QC3A 1JM4B 5TCMA 4A9KA 5F60A 2L5EA 3MUKA 4TU4A 4OUFA 5DFBA 3D7CA 5L96A 5D3NA 4IR6A 5F1LA 4N4IA 4YC9A 5ENFA 5A5RA 1X0JA 5FBXA 5KTWA 4QSQA 5EWCA 4CUPA 4QY4A 5DYAA 4IORA 4NR8A 4O77A 4PTBA 5I29A 5I88A 4XUBA 5F2PA 4NR4A 5DLXA 5EQ1A 5D3PA 4YADA 4XUAA 3UV2A 3NXBA 5LUUA 2FSAA 5D3HA 5D25A 3RCWA 5HQ7A 5E3GA 4YATA 3ONIA 5EPBA 4MR3A 5CS8A 5F5ZA 5I80A 4MEOA 3U5OA 4QSVA 4YK0A 3Q2FA 3O34A 5D3RA 4UIWA 4X2IA 5A7CA 3GG3A 3SVGA 3U5MA 5DKCA 4QYDA 3MB4A 5HJCA 5F63A 4OGIA 5ENEA 3ZYUA 4UYDA 4HBWA 5CQ5A 5FE7A 2NXBA 1N72A 4UIUA 4NUEA 4QSXA 5F25A 4YBTA 5A5SA 5C8GA 5E9VA 2WP2A 5D3LA
chains in the Genus database with same CATH superfamily
5F61A 4QSPA 5EM3A 5HEMA 5CU8A 5DYUA 4UYFA 4O7AA 4LRGA 5G4SA 4A9NA 2OUOA 5CQ6A 5F3AA 1EQFA 5A83A 5E7DA 4J0SA 4UITA 3U5JA 5CUDA 4Y03A 2F6NA 2L85A 5FH8A 5BT4A 5C4QA 4O75A 4LYWA 4BW2A 2MJVB 5CTLA 5HRWA 5DKDA 5F62A 5A81A 5FE5A 5DYXA 3S92A 4QSWA 5EA1A 3QZSA 4MR4A 5FE1A 3AQAA 4Z1SA 2OSSA 5A5OA 4O70A 3P5OA 4J1PA 5E9LA 5IG6A 4YYGA 5EK9A 4QYLA 4ZW1A 5EPSA 3D1BA 5FB0A 5ETBA 4QR5A 4MR6A 3K2JA 4AKGA 3G0LA 5HM0A 3U5PA 3UW9A 2KTBB 4NR7A 5L8UA 5D26A 5E74A 4LYIA 2L84A 4C67A 5CQ8A 4TZ8A 4TT2A 3G0JA 5CRZA 2DVSA 3LQIA 4E96A 4QB3A 4QEWA 5E9IA 4YBSA 4HXMA 4A9LA 4NUDA 5FE3A 4AKNA 2D82A 4CUQA 4WIVA 5IIDA 5FE0A 5H1TA 4QR4A 4AKHA 2OO1A 4ZQLA 4NRBA 4O7FA 4O71A 4DONA 5HRXA 2RNXA 4XYAA 5II2A 5AMEA 4YAXA 5I1QA 3O33A 1WUMA 4YYJA 4MEQA 5DFDA 5CRMA 4QNSA 3IU6A 2RFJA 5C7NA 5IBNA 4QSSA 3JVLA 5LKTA 4TU6A 5EVAA 4CFKA 3P1DA 3IU5A 3UVXA 4YBMA 5ENCA 4PS5A 3HMFA 4UYHA 2E7OA 4HBYA 5FE2A 2DVRA 4Q0OA 4NUCA 4UYFB 4MR5A 5FH7A 4YYHA 4N3WA 4NRCA 4QBMA 5E9MA 5ENBA 4Z6HA 5KTXA 2DATA 3VKGA 4AKIA 4WHUA 3SVFA 5CFWA 2I7KA 5K29A 5A85A 5EP7A 4IOOA 4J0RA 5D24A 5JI8A 4YYNA 3O36A 4YH4A 5EICA 4PY6A 5E0RA 4KV1A 4CUSA 5CQ7A 4A9HA 4NS5A 4O76A 2YELA 5FG6A 4HBVA 2H60A 5I89A 3SVHA 2DVQA 5EWWA 5C85A 4HXSA 5LKZA 2YDWA 5EWVA 4J3IA 5HRVA 4HBXA 4NQNA 5HQ6A 5H1UA 2YEMA 4UIZA 3UVWA 2R10A 3I3JA 5DFCA 4A9OA 4XY8A 3FKMX 4NQMA 5I83A 5E3DA 5FG5A 5FFYA 4NR5A 4AI6A 4UYEA 2RI7A 5G4RA 2R0YA 4LYSA 5EPRA 5DKHA 5L98A 4QUUA 4IR4A 5LKUA 4HXOA 3JVJA 4TQNA 1E6IA 4NRAA 4FLPA 4YY4A 3JVKA 4RVRA 5EISA 4QUTA 3U5KA 3QZTA 4UYGA 4QEVA 4HXRA 5FH6A 2R0VA 4A9EA 4HXLA 5CQTA 5E9KA 5H1VA 4ALHA 4O7CA 4F3IA 3P1FA 5FE6A 5HELA 5CUEA 4N4FA 5AD3A 4CUTA 2YEKA 2GRCA 5J0DA 3DAIA 5CP5A 2DKWA 4BHWA 5CGPA 4NYXA 3MB3A 5BT5A 4QR3A 5E9YA 5FE9A 5II1A 4C66A 3HMEA 5HQ5A 3JVMA 3UV5A 4BW1A 5CY9A 5EWDA 4UIYA 3MULA 4UIVA 4LC2A 4LR6A 4XY9A 4YYMA 3U5LA 5A5NA 4YH3A 5TB6A 2YQDA 2YYNA 2G4AA 4UIXA 2DVVA 5I40A 5ENGA 5IGKA 4HXNA 4N4GA 5DW1A 4NXJA 4N4HA 4O72A 4TT6A 5L97A 4YYIA 3LXJA 4GPJA 4PKLA 4CURA 5CQ4A 5LVRA 5KU3A 4YYDA 5I7YA 4A9MA 5CPEA 5FDZA 5COIA 5CQ3A 5AD2A 5A5QA 4YYKA 5A82A 5DBMA 5AMFA 2E7NA 4QZSA 4LDFA 3LQHA 3UVYA 3Q2EA 5FE4A 4OGJA 4TTEA 4MENA 5DYCA 2E3KA 4QSUA 4NYWA 3D1DA 1ZS5A 5DX4A 5LJ2A 4IR3A 4KV4A 3U5NA 5IGNA 3UV4A 4ALGA 4BW4A 5D0CA 5I86A 4PCEA 3O35A 4NR6A 5F36A 2R0SA 1WUGA 3ERRA 5EWHA 5KTUA 4O74A 5H85A 4BW3A 5ENHA 5JWMA 5CUAA 2F6JA 5L99A 5LJ0A 4A9IA 2RNWA 4O7BA 5CUBA 5D3JA 2DWWA 3P1EA 4BJXA 5KHMA 4Z1QA 4MEPA 5E73A 4LZSA 1JSPB 5HLSA 5HFRA 5EU1A 2RO1A 4KCXA 3O37A 4A9JA 4IOQA 5CZGA 5CQAA 4YY6A 1PUOA 5CUGA 5C89A 5HCLA 2RS9B 2D9EA 5LVQA 3UVDA 5ENIA 5ACYA 2YW5A 4CFLA 5EGUA 3S91A 4NYVA 5BT3A 2WP1A 3P1CA 3LQJA 2LSPB 4NR9A 4WHWA 4ZC9A 3LJWA 2EJNA 5A5PA 5DY7A 4TT4A 4LZ2A 5IGMA 5F1HA 5EV9A 4QSRA 3VKHA 4LZRA 5KO4A 4YABA 4HXKA 1F68A 5D3SA 4HXPA 4O7EA 4TS8A 3MQMA 4Z93A 2N9GA 5FB1A 3QZVA 4O78A 5FFWA 5IGLA 4CUUA 5C87A 5HENA 4CL9A 5I7XA 3TLPA 5FG4A 3AADA 3HMHA 4IR5A 5D3TA 5HFQA 4CLBA 4QC1A 5FFVA 5ETDA 5DLZA 4TYLA 5EI4A 5CUCA 4PCIA 5LJ1A 5LKXA 3DWYA 1ZKRA 4TZ2A 2I8NA 5D7XA 5L8TA 4Q0NA 5DW2A 2RNYA 4QSTA 3MXFA 4QEUA 4A9FA 5FE8A 5ENJA 4Z6IA 4QC3A 1JM4B 5TCMA 4A9KA 5F60A 2L5EA 3MUKA 4TU4A 4OUFA 5DFBA 3D7CA 5L96A 5D3NA 4IR6A 5F1LA 4N4IA 4YC9A 5ENFA 5A5RA 1X0JA 5FBXA 5KTWA 4QSQA 5EWCA 4CUPA 4QY4A 5DYAA 4IORA 4NR8A 4O77A 4PTBA 5I29A 5I88A 4XUBA 5F2PA 4NR4A 5DLXA 5EQ1A 5D3PA 4YADA 4XUAA 3UV2A 3NXBA 5LUUA 2FSAA 5D3HA 5D25A 3RCWA 5HQ7A 5E3GA 4YATA 3ONIA 5EPBA 4MR3A 5CS8A 5F5ZA 5I80A 4MEOA 3U5OA 4QSVA 4YK0A 3Q2FA 3O34A 5D3RA 4UIWA 4X2IA 5A7CA 3GG3A 3SVGA 3U5MA 5DKCA 4QYDA 3MB4A 5HJCA 5F63A 4OGIA 5ENEA 3ZYUA 4UYDA 4HBWA 5CQ5A 5FE7A 2NXBA 1N72A 4UIUA 4NUEA 4QSXA 5F25A 4YBTA 5A5SA 5C8GA 5E9VA 2WP2A 5D3LA
chains in the Genus database with same CATH topology
5F61A 4QSPA 5EM3A 5HEMA 5CU8A 5DYUA 4UYFA 4O7AA 4LRGA 5G4SA 4A9NA 2OUOA 5CQ6A 5F3AA 1EQFA 5A83A 5E7DA 4J0SA 4UITA 3U5JA 5CUDA 4Y03A 2F6NA 2L85A 5FH8A 5BT4A 5C4QA 4O75A 4LYWA 4BW2A 2MJVB 5CTLA 5HRWA 5DKDA 5F62A 5A81A 5FE5A 5DYXA 3S92A 4QSWA 5EA1A 3QZSA 4MR4A 5FE1A 3AQAA 4Z1SA 2OSSA 5A5OA 4O70A 3P5OA 4J1PA 5E9LA 5IG6A 4YYGA 5EK9A 4QYLA 4ZW1A 5EPSA 5FB0A 5ETBA 4QR5A 4MR6A 3K2JA 3G0LA 5HM0A 3U5PA 3UW9A 2KTBB 4NR7A 5L8UA 5D26A 5E74A 4LYIA 2L84A 4C67A 5CQ8A 4TZ8A 4TT2A 3G0JA 5CRZA 2DVSA 3LQIA 4E96A 4QB3A 4QEWA 5E9IA 4YBSA 4HXMA 4A9LA 4NUDA 5FE3A 4AKNA 2D82A 4CUQA 4WIVA 5IIDA 5FE0A 5H1TA 4QR4A 2OO1A 4ZQLA 4NRBA 4O7FA 4O71A 4DONA 5HRXA 2RNXA 4XYAA 5II2A 5AMEA 4YAXA 5I1QA 3O33A 1WUMA 4YYJA 4MEQA 5DFDA 5CRMA 4QNSA 3IU6A 2RFJA 5C7NA 5IBNA 4QSSA 3JVLA 5LKTA 4TU6A 5EVAA 4CFKA 3P1DA 3IU5A 3UVXA 4YBMA 5ENCA 4PS5A 3HMFA 4UYHA 2E7OA 4HBYA 5FE2A 2DVRA 4Q0OA 4NUCA 4UYFB 4MR5A 5FH7A 4YYHA 4N3WA 4NRCA 4QBMA 5E9MA 5ENBA 4Z6HA 5KTXA 2DATA 4WHUA 3SVFA 5CFWA 2I7KA 5K29A 5A85A 5EP7A 4IOOA 4J0RA 5D24A 5JI8A 4YYNA 3O36A 4YH4A 5EICA 4PY6A 5E0RA 4KV1A 4CUSA 5CQ7A 4A9HA 4NS5A 4O76A 2YELA 5FG6A 4HBVA 2H60A 5I89A 3SVHA 2DVQA 5EWWA 5C85A 4HXSA 5LKZA 2YDWA 5EWVA 4J3IA 5HRVA 4HBXA 4NQNA 5HQ6A 5H1UA 2YEMA 4UIZA 3UVWA 2R10A 3I3JA 5DFCA 4A9OA 4XY8A 3FKMX 4NQMA 5I83A 5E3DA 5FG5A 5FFYA 4NR5A 4UYEA 2RI7A 5G4RA 2R0YA 4LYSA 5EPRA 5DKHA 5L98A 4QUUA 4IR4A 5LKUA 4HXOA 3JVJA 4TQNA 1E6IA 4NRAA 4FLPA 4YY4A 3JVKA 4RVRA 5EISA 4QUTA 3U5KA 3QZTA 4UYGA 4QEVA 4HXRA 5FH6A 2R0VA 4A9EA 4HXLA 5CQTA 5E9KA 5H1VA 4ALHA 4O7CA 4F3IA 3P1FA 5FE6A 5HELA 5CUEA 4N4FA 5AD3A 4CUTA 2YEKA 2GRCA 5J0DA 3DAIA 5CP5A 2DKWA 4BHWA 5CGPA 4NYXA 3MB3A 5BT5A 4QR3A 5E9YA 5FE9A 5II1A 4C66A 3HMEA 5HQ5A 3JVMA 3UV5A 4BW1A 5CY9A 5EWDA 4UIYA 3MULA 4UIVA 4LC2A 4LR6A 4XY9A 4YYMA 3U5LA 5A5NA 4YH3A 5TB6A 2YQDA 2YYNA 2G4AA 4UIXA 2DVVA 5I40A 5ENGA 5IGKA 4HXNA 4N4GA 5DW1A 4NXJA 4N4HA 4O72A 4TT6A 5L97A 4YYIA 3LXJA 4GPJA 4PKLA 4CURA 5CQ4A 5LVRA 5KU3A 4YYDA 5I7YA 4A9MA 5CPEA 5FDZA 5COIA 5CQ3A 5AD2A 5A5QA 4YYKA 5A82A 5DBMA 5AMFA 2E7NA 4QZSA 4LDFA 3LQHA 3UVYA 3Q2EA 5FE4A 4OGJA 4TTEA 4MENA 5DYCA 2E3KA 4QSUA 4NYWA 1ZS5A 5DX4A 5LJ2A 4IR3A 4KV4A 3U5NA 5IGNA 3UV4A 4ALGA 4BW4A 5D0CA 5I86A 4PCEA 3O35A 4NR6A 5F36A 2R0SA 1WUGA 5EWHA 5KTUA 4O74A 5H85A 4BW3A 5ENHA 5JWMA 5CUAA 2F6JA 5L99A 5LJ0A 4A9IA 2RNWA 4O7BA 5CUBA 5D3JA 2DWWA 3P1EA 4BJXA 5KHMA 4Z1QA 4MEPA 5E73A 4LZSA 1JSPB 5HLSA 5HFRA 5EU1A 2RO1A 4KCXA 3O37A 4A9JA 4IOQA 5CZGA 5CQAA 4YY6A 5CUGA 5C89A 5HCLA 2RS9B 2D9EA 5LVQA 3UVDA 5ENIA 5ACYA 2YW5A 4CFLA 5EGUA 3S91A 4NYVA 5BT3A 2WP1A 3P1CA 3LQJA 2LSPB 4NR9A 4WHWA 4ZC9A 3LJWA 5A5PA 5DY7A 4TT4A 4LZ2A 5IGMA 5F1HA 5EV9A 4QSRA 4LZRA 5KO4A 4YABA 4HXKA 1F68A 5D3SA 4HXPA 4O7EA 4TS8A 3MQMA 4Z93A 2N9GA 5FB1A 3QZVA 4O78A 5FFWA 5IGLA 4CUUA 5C87A 5HENA 4CL9A 5I7XA 3TLPA 5FG4A 3AADA 3HMHA 4IR5A 5D3TA 5HFQA 4CLBA 4QC1A 5FFVA 5ETDA 5DLZA 4TYLA 5EI4A 5CUCA 4PCIA 5LJ1A 5LKXA 3DWYA 4TZ2A 5D7XA 2I8NA 5L8TA 4Q0NA 5DW2A 2RNYA 4QSTA 3MXFA 4QEUA 4A9FA 5FE8A 5ENJA 4Z6IA 4QC3A 1JM4B 5TCMA 4A9KA 5F60A 2L5EA 3MUKA 4TU4A 4OUFA 5DFBA 3D7CA 5L96A 5D3NA 4IR6A 5F1LA 4N4IA 4YC9A 5ENFA 5A5RA 1X0JA 5FBXA 5KTWA 4QSQA 5EWCA 4CUPA 4QY4A 5DYAA 4IORA 4NR8A 4O77A 4PTBA 5I29A 5I88A 4XUBA 5F2PA 4NR4A 5DLXA 5EQ1A 5D3PA 4YADA 4XUAA 3UV2A 3NXBA 5LUUA 2FSAA 5D3HA 5D25A 3RCWA 5HQ7A 5E3GA 4YATA 3ONIA 5EPBA 4MR3A 5CS8A 5F5ZA 5I80A 4MEOA 3U5OA 4QSVA 4YK0A 3Q2FA 3O34A 5D3RA 4UIWA 4X2IA 5A7CA 3GG3A 3SVGA 3U5MA 5DKCA 4QYDA 3MB4A 5HJCA 5F63A 4OGIA 5ENEA 3ZYUA 4UYDA 4HBWA 5CQ5A 5FE7A 2NXBA 1N72A 4UIUA 4NUEA 4QSXA 5F25A 4YBTA 5A5SA 5C8GA 5E9VA 2WP2A 5D3LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F61 A;  4QSP A;  5EM3 A;  5HEM A;  5CU8 A;  5DYU A;  4UYF A;  4O7A A;  4LRG A;  5G4S A;  4A9N A;  2OUO A;  5CQ6 A;  5F3A A;  1EQF A;  5A83 A;  5E7D A;  4J0S A;  4UIT A;  3U5J A;  5CUD A;  4Y03 A;  2F6N A;  2L85 A;  5FH8 A;  5BT4 A;  5C4Q A;  4O75 A;  4LYW A;  4BW2 A;  2MJV B;  5CTL A;  5HRW A;  5DKD A;  5F62 A;  5A81 A;  5FE5 A;  5DYX A;  3S92 A;  4QSW A;  5EA1 A;  3QZS A;  4MR4 A;  5FE1 A;  3AQA A;  4Z1S A;  2OSS A;  5A5O A;  4O70 A;  3P5O A;  4J1P A;  5E9L A;  5IG6 A;  4YYG A;  5EK9 A;  4QYL A;  4ZW1 A;  5EPS A;  5FB0 A;  5ETB A;  4QR5 A;  4MR6 A;  3K2J A;  3G0L A;  5HM0 A;  3U5P A;  3UW9 A;  2KTB B;  4NR7 A;  5L8U A;  5D26 A;  5E74 A;  4LYI A;  2L84 A;  4C67 A;  5CQ8 A;  4TZ8 A;  4TT2 A;  3G0J A;  5CRZ A;  2DVS A;  3LQI A;  4E96 A;  4QB3 A;  4QEW A;  5E9I A;  4YBS A;  4HXM A;  4A9L A;  4NUD A;  5FE3 A;  4AKN A;  2D82 A;  4CUQ A;  4WIV A;  5IID A;  5FE0 A;  5H1T A;  4QR4 A;  2OO1 A;  4ZQL A;  4NRB A;  4O7F A;  4O71 A;  4DON A;  5HRX A;  2RNX A;  4XYA A;  5II2 A;  5AME A;  4YAX A;  5I1Q A;  3O33 A;  1WUM A;  4YYJ A;  4MEQ A;  5DFD A;  5CRM A;  4QNS A;  3IU6 A;  2RFJ A;  5C7N A;  5IBN A;  4QSS A;  3JVL A;  5LKT A;  4TU6 A;  5EVA A;  4CFK A;  3P1D A;  3IU5 A;  3UVX A;  4YBM A;  5ENC A;  4PS5 A;  3HMF A;  4UYH A;  2E7O A;  4HBY A;  5FE2 A;  2DVR A;  4Q0O A;  4NUC A;  4UYF B;  4MR5 A;  5FH7 A;  4YYH A;  4N3W A;  4NRC A;  4QBM A;  5E9M A;  5ENB A;  4Z6H A;  5KTX A;  2DAT A;  4WHU A;  3SVF A;  5CFW A;  2I7K A;  5K29 A;  5A85 A;  5EP7 A;  4IOO A;  4J0R A;  5D24 A;  5JI8 A;  4YYN A;  3O36 A;  4YH4 A;  5EIC A;  4PY6 A;  5E0R A;  4KV1 A;  4CUS A;  5CQ7 A;  4A9H A;  4NS5 A;  4O76 A;  2YEL A;  5FG6 A;  4HBV A;  2H60 A;  5I89 A;  3SVH A;  2DVQ A;  5EWW A;  5C85 A;  4HXS A;  5LKZ A;  2YDW A;  5EWV A;  4J3I A;  5HRV A;  4HBX A;  4NQN A;  5HQ6 A;  5H1U A;  2YEM A;  4UIZ A;  3UVW A;  2R10 A;  3I3J A;  5DFC A;  4A9O A;  4XY8 A;  3FKM X;  4NQM A;  5I83 A;  5E3D A;  5FG5 A;  5FFY A;  4NR5 A;  4UYE A;  2RI7 A;  5G4R A;  2R0Y A;  4LYS A;  5EPR A;  5DKH A;  5L98 A;  4QUU A;  4IR4 A;  5LKU A;  4HXO A;  3JVJ A;  4TQN A;  1E6I A;  4NRA A;  4FLP A;  4YY4 A;  3JVK A;  4RVR A;  5EIS A;  4QUT A;  3U5K A;  3QZT A;  4UYG A;  4QEV A;  4HXR A;  5FH6 A;  2R0V A;  4A9E A;  4HXL A;  5CQT A;  5E9K A;  5H1V A;  4ALH A;  4O7C A;  4F3I A;  3P1F A;  5FE6 A;  5HEL A;  5CUE A;  4N4F A;  5AD3 A;  4CUT A;  2YEK A;  2GRC A;  5J0D A;  3DAI A;  5CP5 A;  2DKW A;  4BHW A;  5CGP A;  4NYX A;  3MB3 A;  5BT5 A;  4QR3 A;  5E9Y A;  5FE9 A;  5II1 A;  4C66 A;  3HME A;  5HQ5 A;  3JVM A;  3UV5 A;  4BW1 A;  5CY9 A;  5EWD A;  4UIY A;  3MUL A;  4UIV A;  4LC2 A;  4LR6 A;  4XY9 A;  4YYM A;  3U5L A;  5A5N A;  4YH3 A;  5TB6 A;  2YQD A;  2YYN A;  2G4A A;  4UIX A;  2DVV A;  5I40 A;  5ENG A;  5IGK A;  4HXN A;  4N4G A;  5DW1 A;  4NXJ A;  4N4H A;  4O72 A;  4TT6 A;  5L97 A;  4YYI A;  3LXJ A;  4GPJ A;  4PKL A;  4CUR A;  5CQ4 A;  5LVR A;  5KU3 A;  4YYD A;  5I7Y A;  4A9M A;  5CPE A;  5FDZ A;  5COI A;  5CQ3 A;  5AD2 A;  5A5Q A;  4YYK A;  5A82 A;  5DBM A;  5AMF A;  2E7N A;  4QZS A;  4LDF A;  3LQH A;  3UVY A;  3Q2E A;  5FE4 A;  4OGJ A;  4TTE A;  4MEN A;  5DYC A;  2E3K A;  4QSU A;  4NYW A;  1ZS5 A;  5DX4 A;  5LJ2 A;  4IR3 A;  4KV4 A;  3U5N A;  5IGN A;  3UV4 A;  4ALG A;  4BW4 A;  5D0C A;  5I86 A;  4PCE A;  3O35 A;  4NR6 A;  5F36 A;  2R0S A;  1WUG A;  5EWH A;  5KTU A;  4O74 A;  5H85 A;  4BW3 A;  5ENH A;  5JWM A;  5CUA A;  2F6J A;  5L99 A;  5LJ0 A;  4A9I A;  2RNW A;  4O7B A;  5CUB A;  5D3J A;  2DWW A;  3P1E A;  4BJX A;  5KHM A;  4Z1Q A;  4MEP A;  5E73 A;  4LZS A;  1JSP B;  5HLS A;  5HFR A;  5EU1 A;  2RO1 A;  4KCX A;  3O37 A;  4A9J A;  4IOQ A;  5CZG A;  5CQA A;  4YY6 A;  5CUG A;  5C89 A;  5HCL A;  2RS9 B;  2D9E A;  5LVQ A;  3UVD A;  5ENI A;  5ACY A;  2YW5 A;  4CFL A;  5EGU A;  3S91 A;  4NYV A;  5BT3 A;  2WP1 A;  3P1C A;  3LQJ A;  2LSP B;  4NR9 A;  4WHW A;  4ZC9 A;  3LJW A;  5A5P A;  5DY7 A;  4TT4 A;  4LZ2 A;  5IGM A;  5F1H A;  5EV9 A;  4QSR A;  4LZR A;  5KO4 A;  4YAB A;  4HXK A;  1F68 A;  5D3S A;  4HXP A;  4O7E A;  4TS8 A;  3MQM A;  4Z93 A;  2N9G A;  5FB1 A;  3QZV A;  4O78 A;  5FFW A;  5IGL A;  4CUU A;  5C87 A;  5HEN A;  4CL9 A;  5I7X A;  3TLP A;  5FG4 A;  3AAD A;  3HMH A;  4IR5 A;  5D3T A;  5HFQ A;  4CLB A;  4QC1 A;  5FFV A;  5ETD A;  5DLZ A;  4TYL A;  5EI4 A;  5CUC A;  4PCI A;  5LJ1 A;  5LKX A;  3DWY A;  4TZ2 A;  5D7X A;  2I8N A;  5L8T A;  4Q0N A;  5DW2 A;  2RNY A;  4QST A;  3MXF A;  4QEU A;  4A9F A;  5FE8 A;  5ENJ A;  4Z6I A;  4QC3 A;  1JM4 B;  5TCM A;  4A9K A;  5F60 A;  2L5E A;  3MUK A;  4TU4 A;  4OUF A;  5DFB A;  3D7C A;  5L96 A;  5D3N A;  4IR6 A;  5F1L A;  4N4I A;  4YC9 A;  5ENF A;  5A5R A;  1X0J A;  5FBX A;  5KTW A;  4QSQ A;  5EWC A;  4CUP A;  4QY4 A;  5DYA A;  4IOR A;  4NR8 A;  4O77 A;  4PTB A;  5I29 A;  5I88 A;  4XUB A;  5F2P A;  4NR4 A;  5DLX A;  5EQ1 A;  5D3P A;  4YAD A;  4XUA A;  3UV2 A;  3NXB A;  5LUU A;  2FSA A;  5D3H A;  5D25 A;  3RCW A;  5HQ7 A;  5E3G A;  4YAT A;  3ONI A;  5EPB A;  4MR3 A;  5CS8 A;  5F5Z A;  5I80 A;  4MEO A;  3U5O A;  4QSV A;  4YK0 A;  3Q2F A;  3O34 A;  5D3R A;  4UIW A;  4X2I A;  5A7C A;  3GG3 A;  3SVG A;  3U5M A;  5DKC A;  4QYD A;  3MB4 A;  5HJC A;  5F63 A;  4OGI A;  5ENE A;  3ZYU A;  4UYD A;  4HBW A;  5CQ5 A;  5FE7 A;  2NXB A;  1N72 A;  4UIU A;  4NUE A;  4QSX A;  5F25 A;  4YBT A;  5A5S A;  5C8G A;  5E9V A;  2WP2 A;  5D3L A; 
#chains in the Genus database with same CATH topology
 5F61 A;  4QSP A;  5EM3 A;  5HEM A;  5CU8 A;  5DYU A;  4UYF A;  4O7A A;  4LRG A;  5G4S A;  4A9N A;  2OUO A;  5CQ6 A;  5F3A A;  1EQF A;  5A83 A;  5E7D A;  4J0S A;  4UIT A;  3U5J A;  5CUD A;  4Y03 A;  2F6N A;  2L85 A;  5FH8 A;  5BT4 A;  5C4Q A;  4O75 A;  4LYW A;  4BW2 A;  2MJV B;  5CTL A;  5HRW A;  5DKD A;  5F62 A;  5A81 A;  5FE5 A;  5DYX A;  3S92 A;  4QSW A;  5EA1 A;  3QZS A;  4MR4 A;  5FE1 A;  3AQA A;  4Z1S A;  2OSS A;  5A5O A;  4O70 A;  3P5O A;  4J1P A;  5E9L A;  5IG6 A;  4YYG A;  5EK9 A;  4QYL A;  4ZW1 A;  5EPS A;  3D1B A;  5FB0 A;  5ETB A;  4QR5 A;  4MR6 A;  3K2J A;  4AKG A;  3G0L A;  5HM0 A;  3U5P A;  3UW9 A;  2KTB B;  4NR7 A;  5L8U A;  5D26 A;  5E74 A;  4LYI A;  2L84 A;  4C67 A;  5CQ8 A;  4TZ8 A;  4TT2 A;  3G0J A;  5CRZ A;  2DVS A;  3LQI A;  4E96 A;  4QB3 A;  4QEW A;  5E9I A;  4YBS A;  4HXM A;  4A9L A;  4NUD A;  5FE3 A;  4AKN A;  2D82 A;  4CUQ A;  4WIV A;  5IID A;  5FE0 A;  5H1T A;  4QR4 A;  4AKH A;  2OO1 A;  4ZQL A;  4NRB A;  4O7F A;  4O71 A;  4DON A;  5HRX A;  2RNX A;  4XYA A;  5II2 A;  5AME A;  4YAX A;  5I1Q A;  3O33 A;  1WUM A;  4YYJ A;  4MEQ A;  5DFD A;  5CRM A;  4QNS A;  3IU6 A;  2RFJ A;  5C7N A;  5IBN A;  4QSS A;  3JVL A;  5LKT A;  4TU6 A;  5EVA A;  4CFK A;  3P1D A;  3IU5 A;  3UVX A;  4YBM A;  5ENC A;  4PS5 A;  3HMF A;  4UYH A;  2E7O A;  4HBY A;  5FE2 A;  2DVR A;  4Q0O A;  4NUC A;  4UYF B;  4MR5 A;  5FH7 A;  4YYH A;  4N3W A;  4NRC A;  4QBM A;  5E9M A;  5ENB A;  4Z6H A;  5KTX A;  2DAT A;  3VKG A;  4AKI A;  4WHU A;  3SVF A;  5CFW A;  2I7K A;  5K29 A;  5A85 A;  5EP7 A;  4IOO A;  4J0R A;  5D24 A;  5JI8 A;  4YYN A;  3O36 A;  4YH4 A;  5EIC A;  4PY6 A;  5E0R A;  4KV1 A;  4CUS A;  5CQ7 A;  4A9H A;  4NS5 A;  4O76 A;  2YEL A;  5FG6 A;  4HBV A;  2H60 A;  5I89 A;  3SVH A;  2DVQ A;  5EWW A;  5C85 A;  4HXS A;  5LKZ A;  2YDW A;  5EWV A;  4J3I A;  5HRV A;  4HBX A;  4NQN A;  5HQ6 A;  5H1U A;  2YEM A;  4UIZ A;  3UVW A;  2R10 A;  3I3J A;  5DFC A;  4A9O A;  4XY8 A;  3FKM X;  4NQM A;  5I83 A;  5E3D A;  5FG5 A;  5FFY A;  4NR5 A;  4AI6 A;  4UYE A;  2RI7 A;  5G4R A;  2R0Y A;  4LYS A;  5EPR A;  5DKH A;  5L98 A;  4QUU A;  4IR4 A;  5LKU A;  4HXO A;  3JVJ A;  4TQN A;  1E6I A;  4NRA A;  4FLP A;  4YY4 A;  3JVK A;  4RVR A;  5EIS A;  4QUT A;  3U5K A;  3QZT A;  4UYG A;  4QEV A;  4HXR A;  5FH6 A;  2R0V A;  4A9E A;  4HXL A;  5CQT A;  5E9K A;  5H1V A;  4ALH A;  4O7C A;  4F3I A;  3P1F A;  5FE6 A;  5HEL A;  5CUE A;  4N4F A;  5AD3 A;  4CUT A;  2YEK A;  2GRC A;  5J0D A;  3DAI A;  5CP5 A;  2DKW A;  4BHW A;  5CGP A;  4NYX A;  3MB3 A;  5BT5 A;  4QR3 A;  5E9Y A;  5FE9 A;  5II1 A;  4C66 A;  3HME A;  5HQ5 A;  3JVM A;  3UV5 A;  4BW1 A;  5CY9 A;  5EWD A;  4UIY A;  3MUL A;  4UIV A;  4LC2 A;  4LR6 A;  4XY9 A;  4YYM A;  3U5L A;  5A5N A;  4YH3 A;  5TB6 A;  2YQD A;  2YYN A;  2G4A A;  4UIX A;  2DVV A;  5I40 A;  5ENG A;  5IGK A;  4HXN A;  4N4G A;  5DW1 A;  4NXJ A;  4N4H A;  4O72 A;  4TT6 A;  5L97 A;  4YYI A;  3LXJ A;  4GPJ A;  4PKL A;  4CUR A;  5CQ4 A;  5LVR A;  5KU3 A;  4YYD A;  5I7Y A;  4A9M A;  5CPE A;  5FDZ A;  5COI A;  5CQ3 A;  5AD2 A;  5A5Q A;  4YYK A;  5A82 A;  5DBM A;  5AMF A;  2E7N A;  4QZS A;  4LDF A;  3LQH A;  3UVY A;  3Q2E A;  5FE4 A;  4OGJ A;  4TTE A;  4MEN A;  5DYC A;  2E3K A;  4QSU A;  4NYW A;  3D1D A;  1ZS5 A;  5DX4 A;  5LJ2 A;  4IR3 A;  4KV4 A;  3U5N A;  5IGN A;  3UV4 A;  4ALG A;  4BW4 A;  5D0C A;  5I86 A;  4PCE A;  3O35 A;  4NR6 A;  5F36 A;  2R0S A;  1WUG A;  3ERR A;  5EWH A;  5KTU A;  4O74 A;  5H85 A;  4BW3 A;  5ENH A;  5JWM A;  5CUA A;  2F6J A;  5L99 A;  5LJ0 A;  4A9I A;  2RNW A;  4O7B A;  5CUB A;  5D3J A;  2DWW A;  3P1E A;  4BJX A;  5KHM A;  4Z1Q A;  4MEP A;  5E73 A;  4LZS A;  1JSP B;  5HLS A;  5HFR A;  5EU1 A;  2RO1 A;  4KCX A;  3O37 A;  4A9J A;  4IOQ A;  5CZG A;  5CQA A;  4YY6 A;  1PUO A;  5CUG A;  5C89 A;  5HCL A;  2RS9 B;  2D9E A;  5LVQ A;  3UVD A;  5ENI A;  5ACY A;  2YW5 A;  4CFL A;  5EGU A;  3S91 A;  4NYV A;  5BT3 A;  2WP1 A;  3P1C A;  3LQJ A;  2LSP B;  4NR9 A;  4WHW A;  4ZC9 A;  3LJW A;  2EJN A;  5A5P A;  5DY7 A;  4TT4 A;  4LZ2 A;  5IGM A;  5F1H A;  5EV9 A;  4QSR A;  3VKH A;  4LZR A;  5KO4 A;  4YAB A;  4HXK A;  1F68 A;  5D3S A;  4HXP A;  4O7E A;  4TS8 A;  3MQM A;  4Z93 A;  2N9G A;  5FB1 A;  3QZV A;  4O78 A;  5FFW A;  5IGL A;  4CUU A;  5C87 A;  5HEN A;  4CL9 A;  5I7X A;  3TLP A;  5FG4 A;  3AAD A;  3HMH A;  4IR5 A;  5D3T A;  5HFQ A;  4CLB A;  4QC1 A;  5FFV A;  5ETD A;  5DLZ A;  4TYL A;  5EI4 A;  5CUC A;  4PCI A;  5LJ1 A;  5LKX A;  3DWY A;  1ZKR A;  4TZ2 A;  2I8N A;  5D7X A;  5L8T A;  4Q0N A;  5DW2 A;  2RNY A;  4QST A;  3MXF A;  4QEU A;  4A9F A;  5FE8 A;  5ENJ A;  4Z6I A;  4QC3 A;  1JM4 B;  5TCM A;  4A9K A;  5F60 A;  2L5E A;  3MUK A;  4TU4 A;  4OUF A;  5DFB A;  3D7C A;  5L96 A;  5D3N A;  4IR6 A;  5F1L A;  4N4I A;  4YC9 A;  5ENF A;  5A5R A;  1X0J A;  5FBX A;  5KTW A;  4QSQ A;  5EWC A;  4CUP A;  4QY4 A;  5DYA A;  4IOR A;  4NR8 A;  4O77 A;  4PTB A;  5I29 A;  5I88 A;  4XUB A;  5F2P A;  4NR4 A;  5DLX A;  5EQ1 A;  5D3P A;  4YAD A;  4XUA A;  3UV2 A;  3NXB A;  5LUU A;  2FSA A;  5D3H A;  5D25 A;  3RCW A;  5HQ7 A;  5E3G A;  4YAT A;  3ONI A;  5EPB A;  4MR3 A;  5CS8 A;  5F5Z A;  5I80 A;  4MEO A;  3U5O A;  4QSV A;  4YK0 A;  3Q2F A;  3O34 A;  5D3R A;  4UIW A;  4X2I A;  5A7C A;  3GG3 A;  3SVG A;  3U5M A;  5DKC A;  4QYD A;  3MB4 A;  5HJC A;  5F63 A;  4OGI A;  5ENE A;  3ZYU A;  4UYD A;  4HBW A;  5CQ5 A;  5FE7 A;  2NXB A;  1N72 A;  4UIU A;  4NUE A;  4QSX A;  5F25 A;  4YBT A;  5A5S A;  5C8G A;  5E9V A;  2WP2 A;  5D3L A; 
#chains in the Genus database with same CATH homology
 5F61 A;  4QSP A;  5EM3 A;  5HEM A;  5CU8 A;  5DYU A;  4UYF A;  4O7A A;  4LRG A;  5G4S A;  4A9N A;  2OUO A;  5CQ6 A;  5F3A A;  1EQF A;  5A83 A;  5E7D A;  4J0S A;  4UIT A;  3U5J A;  5CUD A;  4Y03 A;  2F6N A;  2L85 A;  5FH8 A;  5BT4 A;  5C4Q A;  4O75 A;  4LYW A;  4BW2 A;  2MJV B;  5CTL A;  5HRW A;  5DKD A;  5F62 A;  5A81 A;  5FE5 A;  5DYX A;  3S92 A;  4QSW A;  5EA1 A;  3QZS A;  4MR4 A;  5FE1 A;  3AQA A;  4Z1S A;  2OSS A;  5A5O A;  4O70 A;  3P5O A;  4J1P A;  5E9L A;  5IG6 A;  4YYG A;  5EK9 A;  4QYL A;  4ZW1 A;  5EPS A;  5FB0 A;  5ETB A;  4QR5 A;  4MR6 A;  3K2J A;  3G0L A;  5HM0 A;  3U5P A;  3UW9 A;  2KTB B;  4NR7 A;  5L8U A;  5D26 A;  5E74 A;  4LYI A;  2L84 A;  4C67 A;  5CQ8 A;  4TZ8 A;  4TT2 A;  3G0J A;  5CRZ A;  2DVS A;  3LQI A;  4E96 A;  4QB3 A;  4QEW A;  5E9I A;  4YBS A;  4HXM A;  4A9L A;  4NUD A;  5FE3 A;  4AKN A;  2D82 A;  4CUQ A;  4WIV A;  5IID A;  5FE0 A;  5H1T A;  4QR4 A;  2OO1 A;  4ZQL A;  4NRB A;  4O7F A;  4O71 A;  4DON A;  5HRX A;  2RNX A;  4XYA A;  5II2 A;  5AME A;  4YAX A;  5I1Q A;  3O33 A;  1WUM A;  4YYJ A;  4MEQ A;  5DFD A;  5CRM A;  4QNS A;  3IU6 A;  2RFJ A;  5C7N A;  5IBN A;  4QSS A;  3JVL A;  5LKT A;  4TU6 A;  5EVA A;  4CFK A;  3P1D A;  3IU5 A;  3UVX A;  4YBM A;  5ENC A;  4PS5 A;  3HMF A;  4UYH A;  2E7O A;  4HBY A;  5FE2 A;  2DVR A;  4Q0O A;  4NUC A;  4UYF B;  4MR5 A;  5FH7 A;  4YYH A;  4N3W A;  4NRC A;  4QBM A;  5E9M A;  5ENB A;  4Z6H A;  5KTX A;  2DAT A;  4WHU A;  3SVF A;  5CFW A;  2I7K A;  5K29 A;  5A85 A;  5EP7 A;  4IOO A;  4J0R A;  5D24 A;  5JI8 A;  4YYN A;  3O36 A;  4YH4 A;  5EIC A;  4PY6 A;  5E0R A;  4KV1 A;  4CUS A;  5CQ7 A;  4A9H A;  4NS5 A;  4O76 A;  2YEL A;  5FG6 A;  4HBV A;  2H60 A;  5I89 A;  3SVH A;  2DVQ A;  5EWW A;  5C85 A;  4HXS A;  5LKZ A;  2YDW A;  5EWV A;  4J3I A;  5HRV A;  4HBX A;  4NQN A;  5HQ6 A;  5H1U A;  2YEM A;  4UIZ A;  3UVW A;  2R10 A;  3I3J A;  5DFC A;  4A9O A;  4XY8 A;  3FKM X;  4NQM A;  5I83 A;  5E3D A;  5FG5 A;  5FFY A;  4NR5 A;  4UYE A;  2RI7 A;  5G4R A;  2R0Y A;  4LYS A;  5EPR A;  5DKH A;  5L98 A;  4QUU A;  4IR4 A;  5LKU A;  4HXO A;  3JVJ A;  4TQN A;  1E6I A;  4NRA A;  4FLP A;  4YY4 A;  3JVK A;  4RVR A;  5EIS A;  4QUT A;  3U5K A;  3QZT A;  4UYG A;  4QEV A;  4HXR A;  5FH6 A;  2R0V A;  4A9E A;  4HXL A;  5CQT A;  5E9K A;  5H1V A;  4ALH A;  4O7C A;  4F3I A;  3P1F A;  5FE6 A;  5HEL A;  5CUE A;  4N4F A;  5AD3 A;  4CUT A;  2YEK A;  2GRC A;  5J0D A;  3DAI A;  5CP5 A;  2DKW A;  4BHW A;  5CGP A;  4NYX A;  3MB3 A;  5BT5 A;  4QR3 A;  5E9Y A;  5FE9 A;  5II1 A;  4C66 A;  3HME A;  5HQ5 A;  3JVM A;  3UV5 A;  4BW1 A;  5CY9 A;  5EWD A;  4UIY A;  3MUL A;  4UIV A;  4LC2 A;  4LR6 A;  4XY9 A;  4YYM A;  3U5L A;  5A5N A;  4YH3 A;  5TB6 A;  2YQD A;  2YYN A;  2G4A A;  4UIX A;  2DVV A;  5I40 A;  5ENG A;  5IGK A;  4HXN A;  4N4G A;  5DW1 A;  4NXJ A;  4N4H A;  4O72 A;  4TT6 A;  5L97 A;  4YYI A;  3LXJ A;  4GPJ A;  4PKL A;  4CUR A;  5CQ4 A;  5LVR A;  5KU3 A;  4YYD A;  5I7Y A;  4A9M A;  5CPE A;  5FDZ A;  5COI A;  5CQ3 A;  5AD2 A;  5A5Q A;  4YYK A;  5A82 A;  5DBM A;  5AMF A;  2E7N A;  4QZS A;  4LDF A;  3LQH A;  3UVY A;  3Q2E A;  5FE4 A;  4OGJ A;  4TTE A;  4MEN A;  5DYC A;  2E3K A;  4QSU A;  4NYW A;  1ZS5 A;  5DX4 A;  5LJ2 A;  4IR3 A;  4KV4 A;  3U5N A;  5IGN A;  3UV4 A;  4ALG A;  4BW4 A;  5D0C A;  5I86 A;  4PCE A;  3O35 A;  4NR6 A;  5F36 A;  2R0S A;  1WUG A;  5EWH A;  5KTU A;  4O74 A;  5H85 A;  4BW3 A;  5ENH A;  5JWM A;  5CUA A;  2F6J A;  5L99 A;  5LJ0 A;  4A9I A;  2RNW A;  4O7B A;  5CUB A;  5D3J A;  2DWW A;  3P1E A;  4BJX A;  5KHM A;  4Z1Q A;  4MEP A;  5E73 A;  4LZS A;  1JSP B;  5HLS A;  5HFR A;  5EU1 A;  2RO1 A;  4KCX A;  3O37 A;  4A9J A;  4IOQ A;  5CZG A;  5CQA A;  4YY6 A;  5CUG A;  5C89 A;  5HCL A;  2RS9 B;  2D9E A;  5LVQ A;  3UVD A;  5ENI A;  5ACY A;  2YW5 A;  4CFL A;  5EGU A;  3S91 A;  4NYV A;  5BT3 A;  2WP1 A;  3P1C A;  3LQJ A;  2LSP B;  4NR9 A;  4WHW A;  4ZC9 A;  3LJW A;  5A5P A;  5DY7 A;  4TT4 A;  4LZ2 A;  5IGM A;  5F1H A;  5EV9 A;  4QSR A;  4LZR A;  5KO4 A;  4YAB A;  4HXK A;  1F68 A;  5D3S A;  4HXP A;  4O7E A;  4TS8 A;  3MQM A;  4Z93 A;  2N9G A;  5FB1 A;  3QZV A;  4O78 A;  5FFW A;  5IGL A;  4CUU A;  5C87 A;  5HEN A;  4CL9 A;  5I7X A;  3TLP A;  5FG4 A;  3AAD A;  3HMH A;  4IR5 A;  5D3T A;  5HFQ A;  4CLB A;  4QC1 A;  5FFV A;  5ETD A;  5DLZ A;  4TYL A;  5EI4 A;  5CUC A;  4PCI A;  5LJ1 A;  5LKX A;  3DWY A;  4TZ2 A;  5D7X A;  2I8N A;  5L8T A;  4Q0N A;  5DW2 A;  2RNY A;  4QST A;  3MXF A;  4QEU A;  4A9F A;  5FE8 A;  5ENJ A;  4Z6I A;  4QC3 A;  1JM4 B;  5TCM A;  4A9K A;  5F60 A;  2L5E A;  3MUK A;  4TU4 A;  4OUF A;  5DFB A;  3D7C A;  5L96 A;  5D3N A;  4IR6 A;  5F1L A;  4N4I A;  4YC9 A;  5ENF A;  5A5R A;  1X0J A;  5FBX A;  5KTW A;  4QSQ A;  5EWC A;  4CUP A;  4QY4 A;  5DYA A;  4IOR A;  4NR8 A;  4O77 A;  4PTB A;  5I29 A;  5I88 A;  4XUB A;  5F2P A;  4NR4 A;  5DLX A;  5EQ1 A;  5D3P A;  4YAD A;  4XUA A;  3UV2 A;  3NXB A;  5LUU A;  2FSA A;  5D3H A;  5D25 A;  3RCW A;  5HQ7 A;  5E3G A;  4YAT A;  3ONI A;  5EPB A;  4MR3 A;  5CS8 A;  5F5Z A;  5I80 A;  4MEO A;  3U5O A;  4QSV A;  4YK0 A;  3Q2F A;  3O34 A;  5D3R A;  4UIW A;  4X2I A;  5A7C A;  3GG3 A;  3SVG A;  3U5M A;  5DKC A;  4QYD A;  3MB4 A;  5HJC A;  5F63 A;  4OGI A;  5ENE A;  3ZYU A;  4UYD A;  4HBW A;  5CQ5 A;  5FE7 A;  2NXB A;  1N72 A;  4UIU A;  4NUE A;  4QSX A;  5F25 A;  4YBT A;  5A5S A;  5C8G A;  5E9V A;  2WP2 A;  5D3L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...