5CZGA

Crystal structure analysis of hypothetical bromodomain tb427.10.7420 from trypanosoma brucei in complex with bromosporine
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
115
structure length
115
Chain Sequence
GMSKNERDTSFNKNGCLVFVSRLWDLDKLGMFHHPVSAEELPDYHTVIKRPVDLSSIRDGIEKGTYATDVDVQNDVARMITNALEYNAKGSTWYQEAMSFRKTYLDLARQSGLVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation
molecule keywords Hypothetical Bromodomain
publication title Crystal Structure Analysis of hypothetical bromodomain from Trypanosoma brucei
rcsb
source organism Trypanosoma brucei gambiense (strain mhom/ci/86/dal972)
total genus 38
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2015-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5czgA00
5E74A 4TS8A 5H85A 4IOOA 3HMFA 5F5ZA 1F68A 5FG5A 3SVHA 4XUBA 4QEWA 4N4FA 5DKCA 4LRGA 4NQNA 2R0VA 5EA1A 4HXPA 5A5RA 3P1DA 2RFJA 5CUDA 4HXRA 2D82A 4QC1A 5CQ5A 4ALGA 3QZSA 5CUEA 4XUAA 4YYKA 5KTXA 5EK9A 4LZSA 4XYAA 5EICA 5D3LA 2R0SA 5CUBA 2G4AA 2H60A 3UV5A 3JVJA 4N4GA 4UYFB 3TLPA 4Z1SA 5HQ7A 2RO1A 4CUTA 5JWMA 4J1PA 5CUGA 5HQ5A 4QR3A 4N4IA 5CQAA 4O7FA 4BHWA 5I89A 4NYWA 4MR6A 5L8UA 4LYWA 4PS5A 5EPBA 4PCIA 4QSUA 4YBSA 5ENHA 2OSSA 5FB1A 5IIDA 5I86A 1X0JA 3Q2FA 4XY9A 5FH6A 4PY6A 4NYXA 5LKUA 3IU5A 3O35A 5D3PA 5L99A 3HMHA 4O77A 5IG6A 4O70A 4LYSA 4YH4A 5FFVA 5KU3A 3MUKA 4N4HA 3P1EA 5HCLA 5TCMA 4NRBA 2YQDA 5D7XA 5F60A 4AKNA 4NUDA 4NS5A 2WP1A 5C85A 5A5NA 4O7AA 5F63A 3AQAA 4UYDA 4QR5A 3JVLA 4LDFA 4RVRA 5F1HA 4NR4A 2I7KA 5CUCA 4TT2A 2DVRA 2DVSA 5FE9A 2I8NA 2RNXA 4QSPA 2DATA 5HENA 5HQ6A 5DFBA 5EV9A 4Z93A 3O33A 5LKTA 5HEMA 4LR6A 4PKLA 5L97A 5F25A 5EISA 4MR3A 4TZ8A 5DYUA 5ENCA 4O7CA 4BW1A 5EP7A 4QNSA 4O76A 5A82A 5FE0A 4KV1A 4LYIA 4MEOA 4O74A 4CFLA 5C4QA 4BJXA 5AMEA 4UYGA 5ETDA 2YEMA 5FE3A 1N72A 4QSQA 4QUUA 5LVQA 4UYEA 5CZGA 4QYDA 4A9LA 4DONA 2RNYA 4NXJA 5EPSA 3UVWA 5CRMA 5L8TA 5FFYA 5ENFA 4YH3A 5EVAA 4UIYA 4TQNA 5E3DA 4OGJA 2L5EA 4IORA 5EI4A 2RI7A 2DVVA 5ETBA 5CS8A 5E3GA 4YYIA 1EQFA 4YY6A 4NRAA 5CTLA 5F2PA 4OGIA 4CUSA 5J0DA 4O75A 3MULA 4NYVA 5CRZA 4A9OA 5D3HA 5HFQA 4MENA 3JVKA 5HRVA 4UIZA 4ZW1A 3P1CA 5CQ4A 5DLXA 5FH8A 3LQJA 3MB4A 5I80A 5CU8A 5C89A 5E9VA 4HXSA 3MQMA 4UITA 4A9IA 5IGKA 4QUTA 4QSVA 4CUQA 5DKDA 3UVXA 5DFCA 2RNWA 4YATA 5H1UA 3G0JA 5IGMA 3P5OA 2MJVB 5DYAA 5CQ7A 4GPJA 5I29A 5D26A 4Z1QA 3P1FA 4UYHA 3LQHA 4J0SA 5A5PA 5D3TA 3DAIA 3D7CA 4QC3A 4IR3A 4YY4A 4FLPA 5CQTA 5KHMA 5A5OA 5C87A 5ENEA 2OO1A 4KCXA 5HRXA 4CL9A 3SVFA 4MEQA 5FH7A 4A9HA 5FG4A 4CFKA 5FE5A 5A85A 4Z6HA 3LXJA 4NUCA 4LZRA 5EM3A 5I83A 4YYNA 2KTBB 3LQIA 5EWHA 5DYCA 4QB3A 5HRWA 3HMEA 3O34A 2R0YA 2DWWA 4UIUA 2DVQA 5A81A 4Y03A 5EWWA 5C7NA 2WP2A 4HXOA 4TYLA 5E7DA 5D3NA 1E6IA 5HJCA 4LZ2A 3SVGA 4TZ2A 5CUAA 5AD2A 5CQ3A 4UIVA 4YYHA 5EU1A 5JI8A 4A9KA 3UW9A 2E7NA 4YBTA 4YK0A 4YAXA 4UIWA 5ENIA 5D0CA 5EPRA 5A5QA 4IR5A 4QSWA 4ALHA 5H1TA 5LJ2A 5I1QA 2RS9B 2DKWA 4J3IA 1WUMA 4TT4A 5F61A 4F3IA 4NR9A 4QYLA 5FE4A 2YYNA 3UV4A 5CQ8A 5I40A 3ZYUA 5F3AA 4C67A 5I7YA 5AMFA 5DW1A 5I88A 5F36A 4WIVA 3U5OA 3DWYA 4QR4A 5ENGA 5II2A 4X2IA 4HXLA 4CURA 5FE1A 4NUEA 5ENBA 4QSTA 5IGLA 3AADA 4QSSA 5DYXA 2YEKA 3QZTA 4TTEA 5CPEA 5F62A 5L98A 5C8GA 4C66A 4KV4A 2FSAA 5FE7A 4YADA 5L96A 4WHWA 5FFWA 5EGUA 4TU4A 4CUPA 3O37A 1ZS5A 2L85A 3I3JA 4HXMA 2GRCA 2F6JA 5COIA 4QEVA 3S92A 5D24A 3UV2A 5D3JA 5EWVA 4YYMA 4O72A 4BW3A 4MR4A 4XY8A 3U5MA 4HBWA 4WHUA 5E9YA 4TT6A 5CGPA 5HM0A 4YBMA 2LSPB 2OUOA 4O7EA 3NXBA 4MEPA 4NR5A 2D9EA 5DW2A 5FE8A 5LJ1A 5EWCA 1WUGA 5FE2A 2YDWA 4HBVA 5E9LA 5E9KA 5EQ1A 4IR4A 5EWDA 5BT4A 4O78A 5DY7A 5LJ0A 4YYJA 3ONIA 4MR5A 4Q0NA 4QY4A 4HBYA 4A9FA 4QBMA 4IOQA 5A5SA 5DFDA 3K2JA 5ENJA 4E96A 3U5LA 5IBNA 5D25A 5BT5A 5DKHA 5KTWA 2E3KA 3MXFA 4O71A 5G4SA 4QZSA 5D3SA 3FKMX 2L84A 3U5KA 5FG6A 5HLSA 5G4RA 5LVRA 5CP5A 3IU6A 4YYDA 4UYFA 2N9GA 4YABA 4YC9A 5K29A 5DLZA 3U5NA 3RCWA 4O7BA 5II1A 3U5PA 4OUFA 5E0RA 3LJWA 5F1LA 2YW5A 5A7CA 4A9MA 5H1VA 5I7XA 5CFWA 5CY9A 5E9IA 2NXBA 3QZVA 5BT3A 1JM4B 4BW2A 5LKZA 5FBXA 5LKXA 5DBMA 5KTUA 2F6NA 4IR6A 4QSRA 5FE6A 5A83A 4NR8A 5FB0A 5IGNA 3G0LA 3O36A 5AD3A 3GG3A 4YYGA 5E73A 4QEUA 5TB6A 4CUUA 4A9NA 3Q2EA 5E9MA 4NRCA 5D3RA 4NQMA 4Q0OA 5DX4A 4A9EA 4HXKA 5HFRA 2E7OA 3MB3A 4ZC9A 3JVMA 5CQ6A 4BW4A 4TU6A 4NR7A 1JSPB 4PTBA 4LC2A 3S91A 4Z6IA 5KO4A 4PCEA 4NR6A 2R10A 4HBXA 4ZQLA 2YELA 4QSXA 3UVYA 5LUUA 4CLBA 4A9JA 4HXNA 3U5JA 4J0RA 5FDZA 5ACYA 4UIXA 3UVDA 4N3WA 5HELA
chains in the Genus database with same CATH superfamily
5E74A 4TS8A 5H85A 4IOOA 3HMFA 5F5ZA 1F68A 5FG5A 3SVHA 4XUBA 4QEWA 4N4FA 5DKCA 4LRGA 4NQNA 2R0VA 5EA1A 4HXPA 5A5RA 3P1DA 2RFJA 5CUDA 4HXRA 2D82A 4QC1A 5CQ5A 4ALGA 3QZSA 5CUEA 4XUAA 4YYKA 5KTXA 5EK9A 4LZSA 4XYAA 5EICA 5D3LA 2R0SA 5CUBA 2G4AA 2H60A 3UV5A 3JVJA 4N4GA 4UYFB 3TLPA 4Z1SA 5HQ7A 2RO1A 4CUTA 5JWMA 4J1PA 5CUGA 5HQ5A 4QR3A 4N4IA 5CQAA 4O7FA 4BHWA 5I89A 4NYWA 4MR6A 5L8UA 4LYWA 4PS5A 5EPBA 4PCIA 4QSUA 4YBSA 5ENHA 2OSSA 5FB1A 5IIDA 5I86A 1X0JA 3Q2FA 4XY9A 5FH6A 4PY6A 4NYXA 5LKUA 3IU5A 3O35A 5D3PA 5L99A 3HMHA 4O77A 3D1DA 5IG6A 4O70A 4LYSA 4YH4A 5FFVA 5KU3A 3MUKA 4N4HA 3P1EA 5HCLA 5TCMA 4NRBA 2YQDA 5D7XA 5F60A 4AKNA 4NUDA 4NS5A 2WP1A 5C85A 5A5NA 4O7AA 5F63A 3AQAA 4UYDA 4QR5A 3JVLA 4LDFA 4RVRA 5F1HA 4NR4A 2I7KA 5CUCA 4TT2A 2DVRA 2DVSA 5FE9A 2I8NA 2RNXA 4QSPA 2DATA 5HENA 5HQ6A 5DFBA 5EV9A 4Z93A 3O33A 5LKTA 5HEMA 4LR6A 4PKLA 5L97A 5F25A 5EISA 4MR3A 4TZ8A 5DYUA 5ENCA 4O7CA 4BW1A 5EP7A 4QNSA 4O76A 5A82A 5FE0A 4KV1A 4LYIA 4MEOA 4O74A 4CFLA 5C4QA 4BJXA 5AMEA 4UYGA 5ETDA 2YEMA 5FE3A 1N72A 4QSQA 4QUUA 5LVQA 4UYEA 5CZGA 4QYDA 4A9LA 4DONA 2RNYA 4NXJA 5EPSA 3UVWA 5CRMA 5L8TA 5FFYA 5ENFA 4YH3A 5EVAA 4UIYA 4TQNA 5E3DA 4OGJA 2L5EA 4IORA 5EI4A 2RI7A 2DVVA 5ETBA 5CS8A 5E3GA 4YYIA 1EQFA 4YY6A 4NRAA 5CTLA 5F2PA 4OGIA 4CUSA 4AKIA 5J0DA 4O75A 3MULA 4NYVA 5CRZA 4A9OA 5D3HA 5HFQA 4MENA 3JVKA 5HRVA 4UIZA 4ZW1A 3P1CA 5CQ4A 5DLXA 5FH8A 3LQJA 3MB4A 5I80A 5CU8A 5C89A 5E9VA 1ZKRA 4HXSA 3MQMA 4UITA 4A9IA 5IGKA 4QUTA 4QSVA 4CUQA 5DKDA 3UVXA 5DFCA 2RNWA 4YATA 5H1UA 3G0JA 5IGMA 3P5OA 2MJVB 5DYAA 5CQ7A 4GPJA 5I29A 5D26A 4Z1QA 3P1FA 4UYHA 3LQHA 4J0SA 5A5PA 5D3TA 3DAIA 3D7CA 4QC3A 4IR3A 4YY4A 4FLPA 5CQTA 5KHMA 5A5OA 5C87A 5ENEA 2OO1A 4KCXA 5HRXA 4CL9A 3SVFA 4MEQA 5FH7A 4A9HA 5FG4A 4CFKA 5FE5A 5A85A 4Z6HA 3LXJA 4NUCA 4LZRA 5EM3A 5I83A 4YYNA 2KTBB 3LQIA 5EWHA 5DYCA 4QB3A 5HRWA 3HMEA 3O34A 2R0YA 2DWWA 4UIUA 2EJNA 2DVQA 5A81A 4Y03A 5EWWA 5C7NA 2WP2A 4HXOA 4TYLA 5E7DA 5D3NA 1E6IA 5HJCA 4LZ2A 3SVGA 4TZ2A 5CUAA 5AD2A 5CQ3A 4UIVA 4YYHA 5EU1A 5JI8A 4A9KA 3UW9A 3VKGA 2E7NA 3VKHA 4YBTA 4YK0A 4YAXA 4UIWA 5ENIA 5D0CA 5EPRA 5A5QA 4IR5A 4QSWA 4ALHA 5H1TA 5LJ2A 5I1QA 2RS9B 2DKWA 4J3IA 1WUMA 4TT4A 5F61A 4F3IA 4NR9A 4QYLA 5FE4A 2YYNA 3UV4A 5CQ8A 5I40A 3ZYUA 5F3AA 4C67A 5I7YA 5AMFA 5DW1A 5I88A 5F36A 4WIVA 3U5OA 3DWYA 4QR4A 5ENGA 5II2A 4X2IA 4HXLA 4CURA 5FE1A 4NUEA 5ENBA 4QSTA 5IGLA 3AADA 4QSSA 5DYXA 2YEKA 3QZTA 4TTEA 5CPEA 5F62A 5L98A 5C8GA 4C66A 4KV4A 2FSAA 5FE7A 4YADA 5L96A 4WHWA 5FFWA 5EGUA 4TU4A 4CUPA 3O37A 1ZS5A 3ERRA 2L85A 3I3JA 4HXMA 2GRCA 2F6JA 5COIA 4QEVA 3S92A 5D24A 3UV2A 5D3JA 4AKHA 5EWVA 4YYMA 4O72A 4BW3A 4MR4A 4XY8A 3U5MA 4HBWA 4WHUA 5E9YA 4TT6A 5CGPA 5HM0A 4YBMA 2LSPB 2OUOA 4O7EA 3NXBA 4MEPA 4NR5A 2D9EA 5DW2A 5FE8A 5LJ1A 5EWCA 1WUGA 5FE2A 2YDWA 4HBVA 5E9LA 5E9KA 5EQ1A 4IR4A 5EWDA 5BT4A 4O78A 5DY7A 5LJ0A 4AKGA 4YYJA 3ONIA 4MR5A 4Q0NA 4QY4A 4HBYA 4A9FA 4QBMA 4IOQA 5A5SA 5DFDA 3K2JA 5ENJA 4E96A 3U5LA 5IBNA 5D25A 5BT5A 5DKHA 5KTWA 2E3KA 3MXFA 4O71A 5G4SA 4QZSA 5D3SA 3FKMX 2L84A 3U5KA 5FG6A 5HLSA 5G4RA 5LVRA 5CP5A 3IU6A 4YYDA 4UYFA 2N9GA 4YABA 4YC9A 5K29A 5DLZA 3U5NA 3RCWA 4O7BA 5II1A 3U5PA 4OUFA 5E0RA 3LJWA 5F1LA 2YW5A 5A7CA 4A9MA 5H1VA 5I7XA 5CFWA 5CY9A 5E9IA 2NXBA 4AI6A 3QZVA 5BT3A 1JM4B 4BW2A 5LKZA 5FBXA 5LKXA 1PUOA 5DBMA 5KTUA 2F6NA 4IR6A 4QSRA 5FE6A 5A83A 4NR8A 5FB0A 5IGNA 3G0LA 3O36A 5AD3A 3GG3A 4YYGA 5E73A 4QEUA 5TB6A 4CUUA 4A9NA 3Q2EA 5E9MA 4NRCA 5D3RA 4NQMA 4Q0OA 5DX4A 4A9EA 4HXKA 5HFRA 2E7OA 3MB3A 4ZC9A 3JVMA 5CQ6A 4BW4A 4TU6A 4NR7A 1JSPB 4PTBA 4LC2A 3S91A 4Z6IA 5KO4A 4PCEA 3D1BA 4NR6A 2R10A 4HBXA 4ZQLA 2YELA 4QSXA 3UVYA 5LUUA 4CLBA 4A9JA 4HXNA 3U5JA 4J0RA 5FDZA 5ACYA 4UIXA 3UVDA 4N3WA 5HELA
chains in the Genus database with same CATH topology
5E74A 4TS8A 5H85A 4IOOA 3HMFA 5F5ZA 1F68A 5FG5A 3SVHA 4XUBA 4QEWA 4N4FA 5DKCA 4LRGA 4NQNA 2R0VA 5EA1A 4HXPA 5A5RA 3P1DA 2RFJA 5CUDA 4HXRA 2D82A 4QC1A 5CQ5A 4ALGA 3QZSA 5CUEA 4XUAA 4YYKA 5KTXA 5EK9A 4LZSA 4XYAA 5EICA 5D3LA 2R0SA 5CUBA 2G4AA 2H60A 3UV5A 3JVJA 4N4GA 4UYFB 3TLPA 4Z1SA 5HQ7A 2RO1A 4CUTA 5JWMA 4J1PA 5CUGA 5HQ5A 4QR3A 4N4IA 5CQAA 4O7FA 4BHWA 5I89A 4NYWA 4MR6A 5L8UA 4LYWA 4PS5A 5EPBA 4PCIA 4QSUA 4YBSA 5ENHA 2OSSA 5FB1A 5IIDA 5I86A 1X0JA 3Q2FA 4XY9A 5FH6A 4PY6A 4NYXA 5LKUA 3IU5A 3O35A 5D3PA 5L99A 3HMHA 4O77A 5IG6A 4O70A 4LYSA 4YH4A 5FFVA 5KU3A 3MUKA 4N4HA 3P1EA 5HCLA 5TCMA 4NRBA 2YQDA 5D7XA 5F60A 4AKNA 4NUDA 4NS5A 2WP1A 5C85A 5A5NA 4O7AA 5F63A 3AQAA 4UYDA 4QR5A 3JVLA 4LDFA 4RVRA 5F1HA 4NR4A 2I7KA 5CUCA 4TT2A 2DVRA 2DVSA 5FE9A 2I8NA 2RNXA 4QSPA 2DATA 5HENA 5HQ6A 5DFBA 5EV9A 4Z93A 3O33A 5LKTA 5HEMA 4LR6A 4PKLA 5L97A 5F25A 5EISA 4MR3A 4TZ8A 5DYUA 5ENCA 4O7CA 4BW1A 5EP7A 4QNSA 4O76A 5A82A 5FE0A 4KV1A 4LYIA 4MEOA 4O74A 4CFLA 5C4QA 4BJXA 5AMEA 4UYGA 5ETDA 2YEMA 5FE3A 1N72A 4QSQA 4QUUA 5LVQA 4UYEA 5CZGA 4QYDA 4A9LA 4DONA 2RNYA 4NXJA 5EPSA 3UVWA 5CRMA 5L8TA 5FFYA 5ENFA 4YH3A 5EVAA 4UIYA 4TQNA 5E3DA 4OGJA 2L5EA 4IORA 5EI4A 2RI7A 2DVVA 5ETBA 5CS8A 5E3GA 4YYIA 1EQFA 4YY6A 4NRAA 5CTLA 5F2PA 4OGIA 4CUSA 5J0DA 4O75A 3MULA 4NYVA 5CRZA 4A9OA 5D3HA 5HFQA 4MENA 3JVKA 5HRVA 4UIZA 4ZW1A 3P1CA 5CQ4A 5DLXA 5FH8A 3LQJA 3MB4A 5I80A 5CU8A 5C89A 5E9VA 4HXSA 3MQMA 4UITA 4A9IA 5IGKA 4QUTA 4QSVA 4CUQA 5DKDA 3UVXA 5DFCA 2RNWA 4YATA 5H1UA 3G0JA 5IGMA 3P5OA 2MJVB 5DYAA 5CQ7A 4GPJA 5I29A 5D26A 4Z1QA 3P1FA 4UYHA 3LQHA 4J0SA 5A5PA 5D3TA 3DAIA 3D7CA 4QC3A 4IR3A 4YY4A 4FLPA 5CQTA 5KHMA 5A5OA 5C87A 5ENEA 2OO1A 4KCXA 5HRXA 4CL9A 3SVFA 4MEQA 5FH7A 4A9HA 5FG4A 4CFKA 5FE5A 5A85A 4Z6HA 3LXJA 4NUCA 4LZRA 5EM3A 5I83A 4YYNA 2KTBB 3LQIA 5EWHA 5DYCA 4QB3A 5HRWA 3HMEA 3O34A 2R0YA 2DWWA 4UIUA 2DVQA 5A81A 4Y03A 5EWWA 5C7NA 2WP2A 4HXOA 4TYLA 5E7DA 5D3NA 1E6IA 5HJCA 4LZ2A 3SVGA 4TZ2A 5CUAA 5AD2A 5CQ3A 4UIVA 4YYHA 5EU1A 5JI8A 4A9KA 3UW9A 2E7NA 4YBTA 4YK0A 4YAXA 4UIWA 5ENIA 5D0CA 5EPRA 5A5QA 4IR5A 4QSWA 4ALHA 5H1TA 5LJ2A 5I1QA 2RS9B 2DKWA 4J3IA 1WUMA 4TT4A 5F61A 4F3IA 4NR9A 4QYLA 5FE4A 2YYNA 3UV4A 5CQ8A 5I40A 3ZYUA 5F3AA 4C67A 5I7YA 5AMFA 5DW1A 5I88A 5F36A 4WIVA 3U5OA 3DWYA 4QR4A 5ENGA 5II2A 4X2IA 4HXLA 4CURA 5FE1A 4NUEA 5ENBA 4QSTA 5IGLA 3AADA 4QSSA 5DYXA 2YEKA 3QZTA 4TTEA 5CPEA 5F62A 5L98A 5C8GA 4C66A 4KV4A 2FSAA 5FE7A 4YADA 5L96A 4WHWA 5FFWA 5EGUA 4TU4A 4CUPA 3O37A 1ZS5A 2L85A 3I3JA 4HXMA 2GRCA 2F6JA 5COIA 4QEVA 3S92A 5D24A 3UV2A 5D3JA 5EWVA 4YYMA 4O72A 4BW3A 4MR4A 4XY8A 3U5MA 4HBWA 4WHUA 5E9YA 4TT6A 5CGPA 5HM0A 4YBMA 2LSPB 2OUOA 4O7EA 3NXBA 4MEPA 4NR5A 2D9EA 5DW2A 5FE8A 5LJ1A 5EWCA 1WUGA 5FE2A 2YDWA 4HBVA 5E9LA 5E9KA 5EQ1A 4IR4A 5EWDA 5BT4A 4O78A 5DY7A 5LJ0A 4YYJA 3ONIA 4MR5A 4Q0NA 4QY4A 4HBYA 4A9FA 4QBMA 4IOQA 5A5SA 5DFDA 3K2JA 5ENJA 4E96A 3U5LA 5IBNA 5D25A 5BT5A 5DKHA 5KTWA 2E3KA 3MXFA 4O71A 5G4SA 4QZSA 5D3SA 3FKMX 2L84A 3U5KA 5FG6A 5HLSA 5G4RA 5LVRA 5CP5A 3IU6A 4YYDA 4UYFA 2N9GA 4YABA 4YC9A 5K29A 5DLZA 3U5NA 3RCWA 4O7BA 5II1A 3U5PA 4OUFA 5E0RA 3LJWA 5F1LA 2YW5A 5A7CA 4A9MA 5H1VA 5I7XA 5CFWA 5CY9A 5E9IA 2NXBA 3QZVA 5BT3A 1JM4B 4BW2A 5LKZA 5FBXA 5LKXA 5DBMA 5KTUA 2F6NA 4IR6A 4QSRA 5FE6A 5A83A 4NR8A 5FB0A 5IGNA 3G0LA 3O36A 5AD3A 3GG3A 4YYGA 5E73A 4QEUA 5TB6A 4CUUA 4A9NA 3Q2EA 5E9MA 4NRCA 5D3RA 4NQMA 4Q0OA 5DX4A 4A9EA 4HXKA 5HFRA 2E7OA 3MB3A 4ZC9A 3JVMA 5CQ6A 4BW4A 4TU6A 4NR7A 1JSPB 4PTBA 4LC2A 3S91A 4Z6IA 5KO4A 4PCEA 4NR6A 2R10A 4HBXA 4ZQLA 2YELA 4QSXA 3UVYA 5LUUA 4CLBA 4A9JA 4HXNA 3U5JA 4J0RA 5FDZA 5ACYA 4UIXA 3UVDA 4N3WA 5HELA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E74 A;  4TS8 A;  5H85 A;  4IOO A;  3HMF A;  5F5Z A;  1F68 A;  5FG5 A;  3SVH A;  4XUB A;  4QEW A;  4N4F A;  5DKC A;  4LRG A;  4NQN A;  2R0V A;  5EA1 A;  4HXP A;  5A5R A;  3P1D A;  2RFJ A;  5CUD A;  4HXR A;  2D82 A;  4QC1 A;  5CQ5 A;  4ALG A;  3QZS A;  5CUE A;  4XUA A;  4YYK A;  5KTX A;  5EK9 A;  4LZS A;  4XYA A;  5EIC A;  5D3L A;  2R0S A;  5CUB A;  2G4A A;  2H60 A;  3UV5 A;  3JVJ A;  4N4G A;  4UYF B;  3TLP A;  4Z1S A;  5HQ7 A;  2RO1 A;  4CUT A;  5JWM A;  4J1P A;  5CUG A;  5HQ5 A;  4QR3 A;  4N4I A;  5CQA A;  4O7F A;  4BHW A;  5I89 A;  4NYW A;  4MR6 A;  5L8U A;  4LYW A;  4PS5 A;  5EPB A;  4PCI A;  4QSU A;  4YBS A;  5ENH A;  2OSS A;  5FB1 A;  5IID A;  5I86 A;  1X0J A;  3Q2F A;  4XY9 A;  5FH6 A;  4PY6 A;  4NYX A;  5LKU A;  3IU5 A;  3O35 A;  5D3P A;  5L99 A;  3HMH A;  4O77 A;  5IG6 A;  4O70 A;  4LYS A;  4YH4 A;  5FFV A;  5KU3 A;  3MUK A;  4N4H A;  3P1E A;  5HCL A;  5TCM A;  4NRB A;  2YQD A;  5D7X A;  5F60 A;  4AKN A;  4NUD A;  4NS5 A;  2WP1 A;  5C85 A;  5A5N A;  4O7A A;  5F63 A;  3AQA A;  4UYD A;  4QR5 A;  3JVL A;  4LDF A;  4RVR A;  5F1H A;  4NR4 A;  2I7K A;  5CUC A;  4TT2 A;  2DVR A;  2DVS A;  5FE9 A;  2I8N A;  2RNX A;  4QSP A;  2DAT A;  5HEN A;  5HQ6 A;  5DFB A;  5EV9 A;  4Z93 A;  3O33 A;  5LKT A;  5HEM A;  4LR6 A;  4PKL A;  5L97 A;  5F25 A;  5EIS A;  4MR3 A;  4TZ8 A;  5DYU A;  5ENC A;  4O7C A;  4BW1 A;  5EP7 A;  4QNS A;  4O76 A;  5A82 A;  5FE0 A;  4KV1 A;  4LYI A;  4MEO A;  4O74 A;  4CFL A;  5C4Q A;  4BJX A;  5AME A;  4UYG A;  5ETD A;  2YEM A;  5FE3 A;  1N72 A;  4QSQ A;  4QUU A;  5LVQ A;  4UYE A;  5CZG A;  4QYD A;  4A9L A;  4DON A;  2RNY A;  4NXJ A;  5EPS A;  3UVW A;  5CRM A;  5L8T A;  5FFY A;  5ENF A;  4YH3 A;  5EVA A;  4UIY A;  4TQN A;  5E3D A;  4OGJ A;  2L5E A;  4IOR A;  5EI4 A;  2RI7 A;  2DVV A;  5ETB A;  5CS8 A;  5E3G A;  4YYI A;  1EQF A;  4YY6 A;  4NRA A;  5CTL A;  5F2P A;  4OGI A;  4CUS A;  5J0D A;  4O75 A;  3MUL A;  4NYV A;  5CRZ A;  4A9O A;  5D3H A;  5HFQ A;  4MEN A;  3JVK A;  5HRV A;  4UIZ A;  4ZW1 A;  3P1C A;  5CQ4 A;  5DLX A;  5FH8 A;  3LQJ A;  3MB4 A;  5I80 A;  5CU8 A;  5C89 A;  5E9V A;  4HXS A;  3MQM A;  4UIT A;  4A9I A;  5IGK A;  4QUT A;  4QSV A;  4CUQ A;  5DKD A;  3UVX A;  5DFC A;  2RNW A;  4YAT A;  5H1U A;  3G0J A;  5IGM A;  3P5O A;  2MJV B;  5DYA A;  5CQ7 A;  4GPJ A;  5I29 A;  5D26 A;  4Z1Q A;  3P1F A;  4UYH A;  3LQH A;  4J0S A;  5A5P A;  5D3T A;  3DAI A;  3D7C A;  4QC3 A;  4IR3 A;  4YY4 A;  4FLP A;  5CQT A;  5KHM A;  5A5O A;  5C87 A;  5ENE A;  2OO1 A;  4KCX A;  5HRX A;  4CL9 A;  3SVF A;  4MEQ A;  5FH7 A;  4A9H A;  5FG4 A;  4CFK A;  5FE5 A;  5A85 A;  4Z6H A;  3LXJ A;  4NUC A;  4LZR A;  5EM3 A;  5I83 A;  4YYN A;  2KTB B;  3LQI A;  5EWH A;  5DYC A;  4QB3 A;  5HRW A;  3HME A;  3O34 A;  2R0Y A;  2DWW A;  4UIU A;  2DVQ A;  5A81 A;  4Y03 A;  5EWW A;  5C7N A;  2WP2 A;  4HXO A;  4TYL A;  5E7D A;  5D3N A;  1E6I A;  5HJC A;  4LZ2 A;  3SVG A;  4TZ2 A;  5CUA A;  5AD2 A;  5CQ3 A;  4UIV A;  4YYH A;  5EU1 A;  5JI8 A;  4A9K A;  3UW9 A;  2E7N A;  4YBT A;  4YK0 A;  4YAX A;  4UIW A;  5ENI A;  5D0C A;  5EPR A;  5A5Q A;  4IR5 A;  4QSW A;  4ALH A;  5H1T A;  5LJ2 A;  5I1Q A;  2RS9 B;  2DKW A;  4J3I A;  1WUM A;  4TT4 A;  5F61 A;  4F3I A;  4NR9 A;  4QYL A;  5FE4 A;  2YYN A;  3UV4 A;  5CQ8 A;  5I40 A;  3ZYU A;  5F3A A;  4C67 A;  5I7Y A;  5AMF A;  5DW1 A;  5I88 A;  5F36 A;  4WIV A;  3U5O A;  3DWY A;  4QR4 A;  5ENG A;  5II2 A;  4X2I A;  4HXL A;  4CUR A;  5FE1 A;  4NUE A;  5ENB A;  4QST A;  5IGL A;  3AAD A;  4QSS A;  5DYX A;  2YEK A;  3QZT A;  4TTE A;  5CPE A;  5F62 A;  5L98 A;  5C8G A;  4C66 A;  4KV4 A;  2FSA A;  5FE7 A;  4YAD A;  5L96 A;  4WHW A;  5FFW A;  5EGU A;  4TU4 A;  4CUP A;  3O37 A;  1ZS5 A;  2L85 A;  3I3J A;  4HXM A;  2GRC A;  2F6J A;  5COI A;  4QEV A;  3S92 A;  5D24 A;  3UV2 A;  5D3J A;  5EWV A;  4YYM A;  4O72 A;  4BW3 A;  4MR4 A;  4XY8 A;  3U5M A;  4HBW A;  4WHU A;  5E9Y A;  4TT6 A;  5CGP A;  5HM0 A;  4YBM A;  2LSP B;  2OUO A;  4O7E A;  3NXB A;  4MEP A;  4NR5 A;  2D9E A;  5DW2 A;  5FE8 A;  5LJ1 A;  5EWC A;  1WUG A;  5FE2 A;  2YDW A;  4HBV A;  5E9L A;  5E9K A;  5EQ1 A;  4IR4 A;  5EWD A;  5BT4 A;  4O78 A;  5DY7 A;  5LJ0 A;  4YYJ A;  3ONI A;  4MR5 A;  4Q0N A;  4QY4 A;  4HBY A;  4A9F A;  4QBM A;  4IOQ A;  5A5S A;  5DFD A;  3K2J A;  5ENJ A;  4E96 A;  3U5L A;  5IBN A;  5D25 A;  5BT5 A;  5DKH A;  5KTW A;  2E3K A;  3MXF A;  4O71 A;  5G4S A;  4QZS A;  5D3S A;  3FKM X;  2L84 A;  3U5K A;  5FG6 A;  5HLS A;  5G4R A;  5LVR A;  5CP5 A;  3IU6 A;  4YYD A;  4UYF A;  2N9G A;  4YAB A;  4YC9 A;  5K29 A;  5DLZ A;  3U5N A;  3RCW A;  4O7B A;  5II1 A;  3U5P A;  4OUF A;  5E0R A;  3LJW A;  5F1L A;  2YW5 A;  5A7C A;  4A9M A;  5H1V A;  5I7X A;  5CFW A;  5CY9 A;  5E9I A;  2NXB A;  3QZV A;  5BT3 A;  1JM4 B;  4BW2 A;  5LKZ A;  5FBX A;  5LKX A;  5DBM A;  5KTU A;  2F6N A;  4IR6 A;  4QSR A;  5FE6 A;  5A83 A;  4NR8 A;  5FB0 A;  5IGN A;  3G0L A;  3O36 A;  5AD3 A;  3GG3 A;  4YYG A;  5E73 A;  4QEU A;  5TB6 A;  4CUU A;  4A9N A;  3Q2E A;  5E9M A;  4NRC A;  5D3R A;  4NQM A;  4Q0O A;  5DX4 A;  4A9E A;  4HXK A;  5HFR A;  2E7O A;  3MB3 A;  4ZC9 A;  3JVM A;  5CQ6 A;  4BW4 A;  4TU6 A;  4NR7 A;  1JSP B;  4PTB A;  4LC2 A;  3S91 A;  4Z6I A;  5KO4 A;  4PCE A;  4NR6 A;  2R10 A;  4HBX A;  4ZQL A;  2YEL A;  4QSX A;  3UVY A;  5LUU A;  4CLB A;  4A9J A;  4HXN A;  3U5J A;  4J0R A;  5FDZ A;  5ACY A;  4UIX A;  3UVD A;  4N3W A;  5HEL A; 
#chains in the Genus database with same CATH topology
 5E74 A;  4TS8 A;  5H85 A;  4IOO A;  3HMF A;  5F5Z A;  1F68 A;  5FG5 A;  3SVH A;  4XUB A;  4QEW A;  4N4F A;  5DKC A;  4LRG A;  4NQN A;  2R0V A;  5EA1 A;  4HXP A;  5A5R A;  3P1D A;  2RFJ A;  5CUD A;  4HXR A;  2D82 A;  4QC1 A;  5CQ5 A;  4ALG A;  3QZS A;  5CUE A;  4XUA A;  4YYK A;  5KTX A;  5EK9 A;  4LZS A;  4XYA A;  5EIC A;  5D3L A;  2R0S A;  5CUB A;  2G4A A;  2H60 A;  3UV5 A;  3JVJ A;  4N4G A;  4UYF B;  3TLP A;  4Z1S A;  5HQ7 A;  2RO1 A;  4CUT A;  5JWM A;  4J1P A;  5CUG A;  5HQ5 A;  4QR3 A;  4N4I A;  5CQA A;  4O7F A;  4BHW A;  5I89 A;  4NYW A;  4MR6 A;  5L8U A;  4LYW A;  4PS5 A;  5EPB A;  4PCI A;  4QSU A;  4YBS A;  5ENH A;  2OSS A;  5FB1 A;  5IID A;  5I86 A;  1X0J A;  3Q2F A;  4XY9 A;  5FH6 A;  4PY6 A;  4NYX A;  5LKU A;  3IU5 A;  3O35 A;  5D3P A;  5L99 A;  3HMH A;  4O77 A;  3D1D A;  5IG6 A;  4O70 A;  4LYS A;  4YH4 A;  5FFV A;  5KU3 A;  3MUK A;  4N4H A;  3P1E A;  5HCL A;  5TCM A;  4NRB A;  2YQD A;  5D7X A;  5F60 A;  4AKN A;  4NUD A;  4NS5 A;  2WP1 A;  5C85 A;  5A5N A;  4O7A A;  5F63 A;  3AQA A;  4UYD A;  4QR5 A;  3JVL A;  4LDF A;  4RVR A;  5F1H A;  4NR4 A;  2I7K A;  5CUC A;  4TT2 A;  2DVR A;  2DVS A;  5FE9 A;  2I8N A;  2RNX A;  4QSP A;  2DAT A;  5HEN A;  5HQ6 A;  5DFB A;  5EV9 A;  4Z93 A;  3O33 A;  5LKT A;  5HEM A;  4LR6 A;  4PKL A;  5L97 A;  5F25 A;  5EIS A;  4MR3 A;  4TZ8 A;  5DYU A;  5ENC A;  4O7C A;  4BW1 A;  5EP7 A;  4QNS A;  4O76 A;  5A82 A;  5FE0 A;  4KV1 A;  4LYI A;  4MEO A;  4O74 A;  4CFL A;  5C4Q A;  4BJX A;  5AME A;  4UYG A;  5ETD A;  2YEM A;  5FE3 A;  1N72 A;  4QSQ A;  4QUU A;  5LVQ A;  4UYE A;  5CZG A;  4QYD A;  4A9L A;  4DON A;  2RNY A;  4NXJ A;  5EPS A;  3UVW A;  5CRM A;  5L8T A;  5FFY A;  5ENF A;  4YH3 A;  5EVA A;  4UIY A;  4TQN A;  5E3D A;  4OGJ A;  2L5E A;  4IOR A;  5EI4 A;  2RI7 A;  2DVV A;  5ETB A;  5CS8 A;  5E3G A;  4YYI A;  1EQF A;  4YY6 A;  4NRA A;  5CTL A;  5F2P A;  4OGI A;  4CUS A;  4AKI A;  5J0D A;  4O75 A;  3MUL A;  4NYV A;  5CRZ A;  4A9O A;  5D3H A;  5HFQ A;  4MEN A;  3JVK A;  5HRV A;  4UIZ A;  4ZW1 A;  3P1C A;  5CQ4 A;  5DLX A;  5FH8 A;  3LQJ A;  3MB4 A;  5I80 A;  5CU8 A;  5C89 A;  5E9V A;  1ZKR A;  4HXS A;  3MQM A;  4UIT A;  4A9I A;  5IGK A;  4QUT A;  4QSV A;  4CUQ A;  5DKD A;  3UVX A;  5DFC A;  2RNW A;  4YAT A;  5H1U A;  3G0J A;  5IGM A;  3P5O A;  2MJV B;  5DYA A;  5CQ7 A;  4GPJ A;  5I29 A;  5D26 A;  4Z1Q A;  3P1F A;  4UYH A;  3LQH A;  4J0S A;  5A5P A;  5D3T A;  3DAI A;  3D7C A;  4QC3 A;  4IR3 A;  4YY4 A;  4FLP A;  5CQT A;  5KHM A;  5A5O A;  5C87 A;  5ENE A;  2OO1 A;  4KCX A;  5HRX A;  4CL9 A;  3SVF A;  4MEQ A;  5FH7 A;  4A9H A;  5FG4 A;  4CFK A;  5FE5 A;  5A85 A;  4Z6H A;  3LXJ A;  4NUC A;  4LZR A;  5EM3 A;  5I83 A;  4YYN A;  2KTB B;  3LQI A;  5EWH A;  5DYC A;  4QB3 A;  5HRW A;  3HME A;  3O34 A;  2R0Y A;  2DWW A;  4UIU A;  2EJN A;  2DVQ A;  5A81 A;  4Y03 A;  5EWW A;  5C7N A;  2WP2 A;  4HXO A;  4TYL A;  5E7D A;  5D3N A;  1E6I A;  5HJC A;  4LZ2 A;  3SVG A;  4TZ2 A;  5CUA A;  5AD2 A;  5CQ3 A;  4UIV A;  4YYH A;  5EU1 A;  5JI8 A;  4A9K A;  3UW9 A;  3VKG A;  2E7N A;  3VKH A;  4YBT A;  4YK0 A;  4YAX A;  4UIW A;  5ENI A;  5D0C A;  5EPR A;  5A5Q A;  4IR5 A;  4QSW A;  4ALH A;  5H1T A;  5LJ2 A;  5I1Q A;  2RS9 B;  2DKW A;  4J3I A;  1WUM A;  4TT4 A;  5F61 A;  4F3I A;  4NR9 A;  4QYL A;  5FE4 A;  2YYN A;  3UV4 A;  5CQ8 A;  5I40 A;  3ZYU A;  5F3A A;  4C67 A;  5I7Y A;  5AMF A;  5DW1 A;  5I88 A;  5F36 A;  4WIV A;  3U5O A;  3DWY A;  4QR4 A;  5ENG A;  5II2 A;  4X2I A;  4HXL A;  4CUR A;  5FE1 A;  4NUE A;  5ENB A;  4QST A;  5IGL A;  3AAD A;  4QSS A;  5DYX A;  2YEK A;  3QZT A;  4TTE A;  5CPE A;  5F62 A;  5L98 A;  5C8G A;  4C66 A;  4KV4 A;  2FSA A;  5FE7 A;  4YAD A;  5L96 A;  4WHW A;  5FFW A;  5EGU A;  4TU4 A;  4CUP A;  3O37 A;  1ZS5 A;  3ERR A;  2L85 A;  3I3J A;  4HXM A;  2GRC A;  2F6J A;  5COI A;  4QEV A;  3S92 A;  5D24 A;  3UV2 A;  5D3J A;  4AKH A;  5EWV A;  4YYM A;  4O72 A;  4BW3 A;  4MR4 A;  4XY8 A;  3U5M A;  4HBW A;  4WHU A;  5E9Y A;  4TT6 A;  5CGP A;  5HM0 A;  4YBM A;  2LSP B;  2OUO A;  4O7E A;  3NXB A;  4MEP A;  4NR5 A;  2D9E A;  5DW2 A;  5FE8 A;  5LJ1 A;  5EWC A;  1WUG A;  5FE2 A;  2YDW A;  4HBV A;  5E9L A;  5E9K A;  5EQ1 A;  4IR4 A;  5EWD A;  5BT4 A;  4O78 A;  5DY7 A;  5LJ0 A;  4AKG A;  4YYJ A;  3ONI A;  4MR5 A;  4Q0N A;  4QY4 A;  4HBY A;  4A9F A;  4QBM A;  4IOQ A;  5A5S A;  5DFD A;  3K2J A;  5ENJ A;  4E96 A;  3U5L A;  5IBN A;  5D25 A;  5BT5 A;  5DKH A;  5KTW A;  2E3K A;  3MXF A;  4O71 A;  5G4S A;  4QZS A;  5D3S A;  3FKM X;  2L84 A;  3U5K A;  5FG6 A;  5HLS A;  5G4R A;  5LVR A;  5CP5 A;  3IU6 A;  4YYD A;  4UYF A;  2N9G A;  4YAB A;  4YC9 A;  5K29 A;  5DLZ A;  3U5N A;  3RCW A;  4O7B A;  5II1 A;  3U5P A;  4OUF A;  5E0R A;  3LJW A;  5F1L A;  2YW5 A;  5A7C A;  4A9M A;  5H1V A;  5I7X A;  5CFW A;  5CY9 A;  5E9I A;  2NXB A;  4AI6 A;  3QZV A;  5BT3 A;  1JM4 B;  4BW2 A;  5LKZ A;  5FBX A;  5LKX A;  1PUO A;  5DBM A;  5KTU A;  2F6N A;  4IR6 A;  4QSR A;  5FE6 A;  5A83 A;  4NR8 A;  5FB0 A;  5IGN A;  3G0L A;  3O36 A;  5AD3 A;  3GG3 A;  4YYG A;  5E73 A;  4QEU A;  5TB6 A;  4CUU A;  4A9N A;  3Q2E A;  5E9M A;  4NRC A;  5D3R A;  4NQM A;  4Q0O A;  5DX4 A;  4A9E A;  4HXK A;  5HFR A;  2E7O A;  3MB3 A;  4ZC9 A;  3JVM A;  5CQ6 A;  4BW4 A;  4TU6 A;  4NR7 A;  1JSP B;  4PTB A;  4LC2 A;  3S91 A;  4Z6I A;  5KO4 A;  4PCE A;  3D1B A;  4NR6 A;  2R10 A;  4HBX A;  4ZQL A;  2YEL A;  4QSX A;  3UVY A;  5LUU A;  4CLB A;  4A9J A;  4HXN A;  3U5J A;  4J0R A;  5FDZ A;  5ACY A;  4UIX A;  3UVD A;  4N3W A;  5HEL A; 
#chains in the Genus database with same CATH homology
 5E74 A;  4TS8 A;  5H85 A;  4IOO A;  3HMF A;  5F5Z A;  1F68 A;  5FG5 A;  3SVH A;  4XUB A;  4QEW A;  4N4F A;  5DKC A;  4LRG A;  4NQN A;  2R0V A;  5EA1 A;  4HXP A;  5A5R A;  3P1D A;  2RFJ A;  5CUD A;  4HXR A;  2D82 A;  4QC1 A;  5CQ5 A;  4ALG A;  3QZS A;  5CUE A;  4XUA A;  4YYK A;  5KTX A;  5EK9 A;  4LZS A;  4XYA A;  5EIC A;  5D3L A;  2R0S A;  5CUB A;  2G4A A;  2H60 A;  3UV5 A;  3JVJ A;  4N4G A;  4UYF B;  3TLP A;  4Z1S A;  5HQ7 A;  2RO1 A;  4CUT A;  5JWM A;  4J1P A;  5CUG A;  5HQ5 A;  4QR3 A;  4N4I A;  5CQA A;  4O7F A;  4BHW A;  5I89 A;  4NYW A;  4MR6 A;  5L8U A;  4LYW A;  4PS5 A;  5EPB A;  4PCI A;  4QSU A;  4YBS A;  5ENH A;  2OSS A;  5FB1 A;  5IID A;  5I86 A;  1X0J A;  3Q2F A;  4XY9 A;  5FH6 A;  4PY6 A;  4NYX A;  5LKU A;  3IU5 A;  3O35 A;  5D3P A;  5L99 A;  3HMH A;  4O77 A;  5IG6 A;  4O70 A;  4LYS A;  4YH4 A;  5FFV A;  5KU3 A;  3MUK A;  4N4H A;  3P1E A;  5HCL A;  5TCM A;  4NRB A;  2YQD A;  5D7X A;  5F60 A;  4AKN A;  4NUD A;  4NS5 A;  2WP1 A;  5C85 A;  5A5N A;  4O7A A;  5F63 A;  3AQA A;  4UYD A;  4QR5 A;  3JVL A;  4LDF A;  4RVR A;  5F1H A;  4NR4 A;  2I7K A;  5CUC A;  4TT2 A;  2DVR A;  2DVS A;  5FE9 A;  2I8N A;  2RNX A;  4QSP A;  2DAT A;  5HEN A;  5HQ6 A;  5DFB A;  5EV9 A;  4Z93 A;  3O33 A;  5LKT A;  5HEM A;  4LR6 A;  4PKL A;  5L97 A;  5F25 A;  5EIS A;  4MR3 A;  4TZ8 A;  5DYU A;  5ENC A;  4O7C A;  4BW1 A;  5EP7 A;  4QNS A;  4O76 A;  5A82 A;  5FE0 A;  4KV1 A;  4LYI A;  4MEO A;  4O74 A;  4CFL A;  5C4Q A;  4BJX A;  5AME A;  4UYG A;  5ETD A;  2YEM A;  5FE3 A;  1N72 A;  4QSQ A;  4QUU A;  5LVQ A;  4UYE A;  5CZG A;  4QYD A;  4A9L A;  4DON A;  2RNY A;  4NXJ A;  5EPS A;  3UVW A;  5CRM A;  5L8T A;  5FFY A;  5ENF A;  4YH3 A;  5EVA A;  4UIY A;  4TQN A;  5E3D A;  4OGJ A;  2L5E A;  4IOR A;  5EI4 A;  2RI7 A;  2DVV A;  5ETB A;  5CS8 A;  5E3G A;  4YYI A;  1EQF A;  4YY6 A;  4NRA A;  5CTL A;  5F2P A;  4OGI A;  4CUS A;  5J0D A;  4O75 A;  3MUL A;  4NYV A;  5CRZ A;  4A9O A;  5D3H A;  5HFQ A;  4MEN A;  3JVK A;  5HRV A;  4UIZ A;  4ZW1 A;  3P1C A;  5CQ4 A;  5DLX A;  5FH8 A;  3LQJ A;  3MB4 A;  5I80 A;  5CU8 A;  5C89 A;  5E9V A;  4HXS A;  3MQM A;  4UIT A;  4A9I A;  5IGK A;  4QUT A;  4QSV A;  4CUQ A;  5DKD A;  3UVX A;  5DFC A;  2RNW A;  4YAT A;  5H1U A;  3G0J A;  5IGM A;  3P5O A;  2MJV B;  5DYA A;  5CQ7 A;  4GPJ A;  5I29 A;  5D26 A;  4Z1Q A;  3P1F A;  4UYH A;  3LQH A;  4J0S A;  5A5P A;  5D3T A;  3DAI A;  3D7C A;  4QC3 A;  4IR3 A;  4YY4 A;  4FLP A;  5CQT A;  5KHM A;  5A5O A;  5C87 A;  5ENE A;  2OO1 A;  4KCX A;  5HRX A;  4CL9 A;  3SVF A;  4MEQ A;  5FH7 A;  4A9H A;  5FG4 A;  4CFK A;  5FE5 A;  5A85 A;  4Z6H A;  3LXJ A;  4NUC A;  4LZR A;  5EM3 A;  5I83 A;  4YYN A;  2KTB B;  3LQI A;  5EWH A;  5DYC A;  4QB3 A;  5HRW A;  3HME A;  3O34 A;  2R0Y A;  2DWW A;  4UIU A;  2DVQ A;  5A81 A;  4Y03 A;  5EWW A;  5C7N A;  2WP2 A;  4HXO A;  4TYL A;  5E7D A;  5D3N A;  1E6I A;  5HJC A;  4LZ2 A;  3SVG A;  4TZ2 A;  5CUA A;  5AD2 A;  5CQ3 A;  4UIV A;  4YYH A;  5EU1 A;  5JI8 A;  4A9K A;  3UW9 A;  2E7N A;  4YBT A;  4YK0 A;  4YAX A;  4UIW A;  5ENI A;  5D0C A;  5EPR A;  5A5Q A;  4IR5 A;  4QSW A;  4ALH A;  5H1T A;  5LJ2 A;  5I1Q A;  2RS9 B;  2DKW A;  4J3I A;  1WUM A;  4TT4 A;  5F61 A;  4F3I A;  4NR9 A;  4QYL A;  5FE4 A;  2YYN A;  3UV4 A;  5CQ8 A;  5I40 A;  3ZYU A;  5F3A A;  4C67 A;  5I7Y A;  5AMF A;  5DW1 A;  5I88 A;  5F36 A;  4WIV A;  3U5O A;  3DWY A;  4QR4 A;  5ENG A;  5II2 A;  4X2I A;  4HXL A;  4CUR A;  5FE1 A;  4NUE A;  5ENB A;  4QST A;  5IGL A;  3AAD A;  4QSS A;  5DYX A;  2YEK A;  3QZT A;  4TTE A;  5CPE A;  5F62 A;  5L98 A;  5C8G A;  4C66 A;  4KV4 A;  2FSA A;  5FE7 A;  4YAD A;  5L96 A;  4WHW A;  5FFW A;  5EGU A;  4TU4 A;  4CUP A;  3O37 A;  1ZS5 A;  2L85 A;  3I3J A;  4HXM A;  2GRC A;  2F6J A;  5COI A;  4QEV A;  3S92 A;  5D24 A;  3UV2 A;  5D3J A;  5EWV A;  4YYM A;  4O72 A;  4BW3 A;  4MR4 A;  4XY8 A;  3U5M A;  4HBW A;  4WHU A;  5E9Y A;  4TT6 A;  5CGP A;  5HM0 A;  4YBM A;  2LSP B;  2OUO A;  4O7E A;  3NXB A;  4MEP A;  4NR5 A;  2D9E A;  5DW2 A;  5FE8 A;  5LJ1 A;  5EWC A;  1WUG A;  5FE2 A;  2YDW A;  4HBV A;  5E9L A;  5E9K A;  5EQ1 A;  4IR4 A;  5EWD A;  5BT4 A;  4O78 A;  5DY7 A;  5LJ0 A;  4YYJ A;  3ONI A;  4MR5 A;  4Q0N A;  4QY4 A;  4HBY A;  4A9F A;  4QBM A;  4IOQ A;  5A5S A;  5DFD A;  3K2J A;  5ENJ A;  4E96 A;  3U5L A;  5IBN A;  5D25 A;  5BT5 A;  5DKH A;  5KTW A;  2E3K A;  3MXF A;  4O71 A;  5G4S A;  4QZS A;  5D3S A;  3FKM X;  2L84 A;  3U5K A;  5FG6 A;  5HLS A;  5G4R A;  5LVR A;  5CP5 A;  3IU6 A;  4YYD A;  4UYF A;  2N9G A;  4YAB A;  4YC9 A;  5K29 A;  5DLZ A;  3U5N A;  3RCW A;  4O7B A;  5II1 A;  3U5P A;  4OUF A;  5E0R A;  3LJW A;  5F1L A;  2YW5 A;  5A7C A;  4A9M A;  5H1V A;  5I7X A;  5CFW A;  5CY9 A;  5E9I A;  2NXB A;  3QZV A;  5BT3 A;  1JM4 B;  4BW2 A;  5LKZ A;  5FBX A;  5LKX A;  5DBM A;  5KTU A;  2F6N A;  4IR6 A;  4QSR A;  5FE6 A;  5A83 A;  4NR8 A;  5FB0 A;  5IGN A;  3G0L A;  3O36 A;  5AD3 A;  3GG3 A;  4YYG A;  5E73 A;  4QEU A;  5TB6 A;  4CUU A;  4A9N A;  3Q2E A;  5E9M A;  4NRC A;  5D3R A;  4NQM A;  4Q0O A;  5DX4 A;  4A9E A;  4HXK A;  5HFR A;  2E7O A;  3MB3 A;  4ZC9 A;  3JVM A;  5CQ6 A;  4BW4 A;  4TU6 A;  4NR7 A;  1JSP B;  4PTB A;  4LC2 A;  3S91 A;  4Z6I A;  5KO4 A;  4PCE A;  4NR6 A;  2R10 A;  4HBX A;  4ZQL A;  2YEL A;  4QSX A;  3UVY A;  5LUU A;  4CLB A;  4A9J A;  4HXN A;  3U5J A;  4J0R A;  5FDZ A;  5ACY A;  4UIX A;  3UVD A;  4N3W A;  5HEL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...