1N72A

Structure and ligand of a histone acetyltransferase bromodomain
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
115
structure length
115
Chain Sequence
MSKEPRDPDQLYSTLKSILQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLKNRYYVSKKLFMADLQRVFTNCKEYNPPESEYYKCANILEKFFFSKIKEAGLIDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords HISTONE ACETYLTRANSFERASE
publication title Structure and Ligand of a Histone Acetyltransferase Bromodomain
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 115
sequence length 115
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2002-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 1n72A00
4CUPA 5FB0A 4Z93A 3ZYUA 5DYXA 4A9HA 4NR4A 4TU4A 4UIVA 4ZQLA 4NUDA 2DVQA 4TS8A 2R0VA 5AD2A 5ETDA 4WHUA 4N4HA 5CGPA 4IR3A 4YK0A 4LDFA 5E9MA 5HRVA 5EWDA 5D3HA 4N4FA 5EK9A 5FFWA 4CUSA 4QC3A 5F1HA 5H85A 5L99A 3K2JA 5I40A 4LYIA 5EWHA 5L8TA 4QSPA 2GRCA 3AQAA 5CS8A 4XY9A 2L84A 5C87A 4LYWA 4YY4A 4QZSA 5CQ4A 4LC2A 4LZSA 5CRMA 5EPBA 4HXOA 3O34A 4IORA 4MR6A 5G4SA 5FG6A 4ZC9A 4QYDA 4C66A 3ONIA 3P1FA 5A81A 3P1EA 4CLBA 4J0SA 4Z1SA 5C8GA 3UW9A 4QSXA 3SVFA 4UIZA 5DKHA 2L5EA 2YEMA 5A83A 4CUUA 4YYKA 3Q2EA 4YYDA 5HEMA 4UIWA 5BT4A 5EI4A 3G0JA 3UV2A 2R0YA 4O7CA 5A5OA 3HMHA 5IGMA 4UYDA 3U5NA 5DX4A 4O72A 2I8NA 5ENGA 5KHMA 3G0LA 4TQNA 5EPRA 4ZW1A 2YELA 4QR3A 5CY9A 5C89A 3O36A 5DBMA 4X2IA 4YBTA 4UIUA 2F6JA 3HMFA 3MB4A 5DYAA 5CUCA 5EICA 5K29A 5FDZA 5I89A 5FE9A 4TT4A 4XUBA 5FE0A 5KO4A 5E9VA 3U5OA 5CQTA 5ENIA 2YQDA 1WUGA 5AMFA 4NR8A 4CFKA 5G4RA 2R0SA 5FE4A 5E0RA 1WUMA 3MQMA 5EM3A 3UV4A 4MEPA 4O78A 5A7CA 4BHWA 5HFQA 4DONA 5D3LA 4RVRA 5EU1A 4A9IA 5LUUA 3QZSA 4UITA 5CUAA 5II1A 5CUEA 5E9LA 3UV5A 5E9IA 2OSSA 4XYAA 4HXKA 5L97A 3MB3A 4HXNA 5C85A 2RO1A 3U5MA 5F62A 3AADA 5HQ5A 3LQHA 3S91A 5EQ1A 5LJ1A 4TYLA 3QZVA 4MENA 4PKLA 4BW3A 4MEQA 4NRBA 4QSTA 4QEWA 5H1VA 5EWWA 4GPJA 4YYMA 5TB6A 4FLPA 4Y03A 4HXSA 5A5RA 4KCXA 5IGLA 4WHWA 4NR6A 4YYHA 5EPSA 3SVHA 1JM4B 4O71A 4LRGA 4Z6HA 1JSPB 4KV1A 5L96A 3S92A 5EISA 4QR5A 5I86A 4NYWA 2G4AA 4IR5A 5DFBA 3HMEA 5IGKA 4QSWA 5EP7A 4KV4A 4IR4A 4NQMA 3LJWA 3P5OA 4YAXA 5DFCA 5HLSA 4QBMA 5FE8A 5A85A 3UVYA 5JWMA 4NRAA 5EV9A 5IIDA 5E73A 4IR6A 3GG3A 4A9OA 4MR3A 5E7DA 5HQ7A 4QC1A 5FFVA 4YYNA 4QSVA 3DWYA 5E3DA 5ENFA 4N3WA 5FE1A 5E3GA 5ENJA 4HBXA 4QSUA 5HENA 2RS9B 5D3PA 4OGIA 5CQAA 2WP1A 5I80A 4MR4A 5L98A 5LJ0A 4TZ8A 2E7NA 3U5JA 5FE6A 5FE3A 5F61A 4UIYA 3MXFA 5KTWA 4LZRA 4QSSA 5JI8A 4TTEA 4QEUA 4UYGA 4WIVA 4NUEA 2D9EA 3IU6A 5EGUA 5DW1A 4PS5A 5ENCA 3JVJA 5H1UA 2RNXA 5LVQA 1ZS5A 2I7KA 4HBVA 5FH7A 5FG4A 4NR9A 5D7XA 4A9MA 4O7AA 4O7FA 5DYUA 5EVAA 5II2A 4YBMA 4J1PA 5CP5A 1N72A 5CRZA 4TZ2A 4MR5A 2R10A 5FFYA 5E9YA 5I7XA 5ETBA 5A5NA 4IOOA 5ENBA 4CURA 3U5KA 5HRXA 5F36A 2DWWA 4XUAA 5H1TA 5DW2A 5ACYA 2DVSA 4J0RA 3I3JA 4HXPA 4OUFA 5CQ5A 3LQIA 2F6NA 4UYFA 3UVDA 3LXJA 4E96A 3O35A 3JVKA 5C4QA 2E7OA 5HCLA 4A9LA 1F68A 5D26A 5ENHA 3QZTA 5HM0A 5LKZA 5CUDA 3P1DA 5E9KA 2L85A 4ALGA 2E3KA 5A5SA 5HRWA 5IG6A 5LJ2A 2DATA 5D3NA 4J3IA 3MUKA 4QR4A 4O77A 5DYCA 5AD3A 3IU5A 4YH4A 5LVRA 5FB1A 5D3SA 4A9EA 2DVRA 4HBYA 5ENEA 3Q2FA 5F1LA 5KTUA 5HQ6A 5F2PA 3U5PA 4O7EA 5A5QA 3P1CA 3SVGA 5EA1A 5KTXA 4QNSA 4C67A 4NR5A 5LKUA 2YEKA 4YYJA 4YC9A 3LQJA 5FE5A 4NS5A 4YABA 5L8UA 5D3JA 4PY6A 4O70A 5J0DA 4NYXA 4YBSA 4NRCA 5A5PA 4LYSA 5EWCA 2RNYA 4UYEA 3RCWA 4YY6A 4NR7A 4QUTA 4TU6A 4PTBA 5A82A 1E6IA 4N4GA 4IOQA 1X0JA 2LSPB 3UVXA 4ALHA 2OO1A 4BW1A 4PCEA 4QY4A 5F5ZA 2YDWA 4AKNA 5FE7A 5E74A 2WP2A 2MJVB 3JVLA 5I1QA 4NQNA 1EQFA 5CTLA 2N9GA 4QSQA 5TCMA 5AMEA 5CFWA 4O76A 4HXRA 2YW5A 2KTBB 4O74A 5D3RA 4UYHA 2RFJA 5F25A 3TLPA 5I83A 4LZ2A 5BT5A 4O7BA 5HFRA 4Q0OA 4HXLA 4A9JA 5FE2A 3D7CA 3JVMA 5DY7A 5F60A 5CUBA 4PCIA 5CU8A 5HELA 4CL9A 4TT6A 5DKDA 4OGJA 4Q0NA 2FSAA 3O37A 2D82A 4QYLA 2OUOA 2RI7A 4A9KA 4BW2A 5FH8A 4CUTA 5I29A 5I7YA 4O75A 4TT2A 5CQ6A 5CQ3A 5CQ7A 5C7NA 4CUQA 3UVWA 5F63A 4BJXA 5EWVA 3DAIA 4BW4A 5CZGA 4CFLA 4YH3A 4XY8A 5DFDA 4QB3A 5I88A 5KU3A 5CPEA 5D3TA 2YYNA 4NUCA 5FG5A 3O33A 5BT3A 5LKXA 4NXJA 4QEVA 4UIXA 2DVVA 5F3AA 5HJCA 4UYFB 3FKMX 4MEOA 2NXBA 5LKTA 3U5LA 4YATA 5CUGA 5IBNA 4QSRA 4NYVA 4YYGA 4A9NA 4HBWA 5COIA 4YYIA 5IGNA 5CQ8A 4HXMA 5DLZA 3NXBA 5D24A 4QUUA 5FH6A 5DLXA 3MULA 4A9FA 4F3IA 4YADA 4Z1QA 5FBXA 2H60A 4N4IA 4LR6A 4Z6IA 5D0CA 2RNWA 5D25A 2DKWA 5DKCA
chains in the Genus database with same CATH superfamily
4CUPA 5FB0A 4Z93A 3ZYUA 5DYXA 4A9HA 4NR4A 4TU4A 4UIVA 4ZQLA 4NUDA 2DVQA 4TS8A 2R0VA 5AD2A 5ETDA 4WHUA 4N4HA 5CGPA 4IR3A 4YK0A 4LDFA 5E9MA 5HRVA 5EWDA 5D3HA 4N4FA 5EK9A 5FFWA 4CUSA 4QC3A 5F1HA 5H85A 5L99A 3K2JA 5I40A 4LYIA 5EWHA 5L8TA 4QSPA 2GRCA 3AQAA 5CS8A 4XY9A 2L84A 5C87A 4LYWA 4YY4A 4QZSA 5CQ4A 4LC2A 4LZSA 5CRMA 5EPBA 4AKIA 4HXOA 3O34A 4IORA 4MR6A 5G4SA 5FG6A 4ZC9A 4QYDA 4C66A 3ONIA 3P1FA 5A81A 3P1EA 4CLBA 4J0SA 4Z1SA 5C8GA 3UW9A 4QSXA 3SVFA 4UIZA 5DKHA 2L5EA 2YEMA 5A83A 4CUUA 4YYKA 3Q2EA 4YYDA 5HEMA 4UIWA 5BT4A 5EI4A 3G0JA 3UV2A 2R0YA 4O7CA 5A5OA 3HMHA 5IGMA 4UYDA 3U5NA 5DX4A 4O72A 2I8NA 5ENGA 4AI6A 5KHMA 3G0LA 4TQNA 5EPRA 2EJNA 4ZW1A 2YELA 4QR3A 5CY9A 5C89A 3O36A 5DBMA 4X2IA 4YBTA 4UIUA 2F6JA 3HMFA 3MB4A 5DYAA 5CUCA 5EICA 5K29A 5FDZA 5I89A 5FE9A 4TT4A 4XUBA 5FE0A 5KO4A 5E9VA 3U5OA 5CQTA 5ENIA 2YQDA 1WUGA 5AMFA 4NR8A 4CFKA 5G4RA 2R0SA 5FE4A 5E0RA 1WUMA 3MQMA 5EM3A 3UV4A 4MEPA 4O78A 5A7CA 4BHWA 5HFQA 4DONA 5D3LA 4RVRA 5EU1A 4A9IA 5LUUA 3QZSA 4UITA 5CUAA 5II1A 5CUEA 5E9LA 3UV5A 5E9IA 2OSSA 4XYAA 4HXKA 5L97A 3MB3A 4HXNA 5C85A 3D1DA 4AKGA 2RO1A 3U5MA 5F62A 3AADA 5HQ5A 3LQHA 3S91A 5EQ1A 5LJ1A 4TYLA 3QZVA 4MENA 4PKLA 4BW3A 4MEQA 4NRBA 4QSTA 4QEWA 5H1VA 5EWWA 4GPJA 4YYMA 5TB6A 4FLPA 4Y03A 4HXSA 5A5RA 4KCXA 5IGLA 4WHWA 4NR6A 4YYHA 5EPSA 3SVHA 1JM4B 4O71A 4LRGA 4Z6HA 1JSPB 4KV1A 5L96A 3S92A 5EISA 3VKHA 4QR5A 5I86A 4NYWA 2G4AA 4IR5A 5DFBA 3HMEA 5IGKA 4QSWA 5EP7A 4KV4A 4IR4A 4NQMA 3LJWA 3P5OA 4YAXA 5DFCA 5HLSA 4QBMA 5FE8A 5A85A 3UVYA 5JWMA 4NRAA 5EV9A 5IIDA 5E73A 4IR6A 3GG3A 4A9OA 4MR3A 5E7DA 5HQ7A 4QC1A 5FFVA 4YYNA 4QSVA 3DWYA 5E3DA 5ENFA 4N3WA 5FE1A 5E3GA 5ENJA 4HBXA 4QSUA 5HENA 2RS9B 5D3PA 4OGIA 5CQAA 2WP1A 5I80A 4MR4A 5L98A 5LJ0A 4TZ8A 2E7NA 3U5JA 5FE6A 5FE3A 5F61A 4UIYA 3MXFA 5KTWA 4LZRA 4QSSA 5JI8A 4TTEA 4QEUA 4UYGA 4WIVA 4NUEA 2D9EA 3IU6A 5EGUA 5DW1A 4PS5A 5ENCA 3JVJA 5H1UA 2RNXA 5LVQA 1ZS5A 2I7KA 4HBVA 5FH7A 5FG4A 4NR9A 5D7XA 4A9MA 4O7AA 4O7FA 5DYUA 5EVAA 5II2A 3ERRA 4YBMA 4J1PA 5CP5A 1N72A 5CRZA 4TZ2A 4MR5A 2R10A 5FFYA 5E9YA 5I7XA 5ETBA 5A5NA 4IOOA 5ENBA 4CURA 3U5KA 5HRXA 5F36A 2DWWA 4XUAA 5H1TA 5DW2A 5ACYA 2DVSA 4J0RA 3I3JA 4HXPA 4OUFA 5CQ5A 3LQIA 2F6NA 4UYFA 3UVDA 3LXJA 4E96A 3O35A 3JVKA 4AKHA 5C4QA 2E7OA 5HCLA 4A9LA 1F68A 5D26A 5ENHA 3QZTA 5HM0A 5LKZA 5CUDA 3P1DA 5E9KA 2L85A 4ALGA 2E3KA 5A5SA 5HRWA 5IG6A 5LJ2A 2DATA 5D3NA 4J3IA 3MUKA 4QR4A 4O77A 5DYCA 5AD3A 3IU5A 4YH4A 5LVRA 5FB1A 5D3SA 4A9EA 2DVRA 3D1BA 4HBYA 5ENEA 3Q2FA 5F1LA 5KTUA 3VKGA 5HQ6A 5F2PA 3U5PA 4O7EA 5A5QA 3P1CA 3SVGA 5EA1A 5KTXA 4QNSA 4C67A 4NR5A 5LKUA 2YEKA 4YYJA 4YC9A 3LQJA 5FE5A 4NS5A 4YABA 5L8UA 5D3JA 4PY6A 4O70A 5J0DA 4NYXA 4YBSA 4NRCA 5A5PA 4LYSA 5EWCA 2RNYA 4UYEA 3RCWA 4YY6A 4NR7A 4QUTA 4TU6A 4PTBA 5A82A 1E6IA 4N4GA 4IOQA 1X0JA 2LSPB 3UVXA 4ALHA 2OO1A 4BW1A 4PCEA 4QY4A 5F5ZA 2YDWA 4AKNA 5FE7A 5E74A 2WP2A 2MJVB 3JVLA 5I1QA 4NQNA 1EQFA 5CTLA 2N9GA 4QSQA 5TCMA 5AMEA 5CFWA 4O76A 4HXRA 2YW5A 2KTBB 4O74A 5D3RA 4UYHA 2RFJA 5F25A 3TLPA 5I83A 4LZ2A 5BT5A 4O7BA 5HFRA 4Q0OA 4HXLA 1ZKRA 4A9JA 5FE2A 3D7CA 3JVMA 5DY7A 5F60A 5CUBA 4PCIA 5CU8A 5HELA 4CL9A 4TT6A 5DKDA 4OGJA 4Q0NA 2FSAA 3O37A 2D82A 4QYLA 2OUOA 2RI7A 4A9KA 4BW2A 5FH8A 1PUOA 4CUTA 5I29A 5I7YA 4O75A 4TT2A 5CQ6A 5CQ3A 5CQ7A 5C7NA 4CUQA 3UVWA 5F63A 4BJXA 5EWVA 3DAIA 4BW4A 5CZGA 4CFLA 4YH3A 4XY8A 5DFDA 4QB3A 5I88A 5KU3A 5CPEA 5D3TA 2YYNA 4NUCA 5FG5A 3O33A 5BT3A 5LKXA 4NXJA 4QEVA 4UIXA 2DVVA 5F3AA 5HJCA 4UYFB 3FKMX 4MEOA 2NXBA 5LKTA 3U5LA 4YATA 5CUGA 5IBNA 4QSRA 4NYVA 4YYGA 4A9NA 4HBWA 5COIA 4YYIA 5IGNA 5CQ8A 4HXMA 5DLZA 3NXBA 5D24A 4QUUA 5FH6A 5DLXA 3MULA 4A9FA 4F3IA 4YADA 4Z1QA 5FBXA 2H60A 4N4IA 4LR6A 4Z6IA 5D0CA 2RNWA 5D25A 2DKWA 5DKCA
chains in the Genus database with same CATH topology
4CUPA 5FB0A 4Z93A 3ZYUA 5DYXA 4A9HA 4NR4A 4TU4A 4UIVA 4ZQLA 4NUDA 2DVQA 4TS8A 2R0VA 5AD2A 5ETDA 4WHUA 4N4HA 5CGPA 4IR3A 4YK0A 4LDFA 5E9MA 5HRVA 5EWDA 5D3HA 4N4FA 5EK9A 5FFWA 4CUSA 4QC3A 5F1HA 5H85A 5L99A 3K2JA 5I40A 4LYIA 5EWHA 5L8TA 4QSPA 2GRCA 3AQAA 5CS8A 4XY9A 2L84A 5C87A 4LYWA 4YY4A 4QZSA 5CQ4A 4LC2A 4LZSA 5CRMA 5EPBA 4HXOA 3O34A 4IORA 4MR6A 5G4SA 5FG6A 4ZC9A 4QYDA 4C66A 3ONIA 3P1FA 5A81A 3P1EA 4CLBA 4J0SA 4Z1SA 5C8GA 3UW9A 4QSXA 3SVFA 4UIZA 5DKHA 2L5EA 2YEMA 5A83A 4CUUA 4YYKA 3Q2EA 4YYDA 5HEMA 4UIWA 5BT4A 5EI4A 3G0JA 3UV2A 2R0YA 4O7CA 5A5OA 3HMHA 5IGMA 4UYDA 3U5NA 5DX4A 4O72A 2I8NA 5ENGA 5KHMA 3G0LA 4TQNA 5EPRA 4ZW1A 2YELA 4QR3A 5CY9A 5C89A 3O36A 5DBMA 4X2IA 4YBTA 4UIUA 2F6JA 3HMFA 3MB4A 5DYAA 5CUCA 5EICA 5K29A 5FDZA 5I89A 5FE9A 4TT4A 4XUBA 5FE0A 5KO4A 5E9VA 3U5OA 5CQTA 5ENIA 2YQDA 1WUGA 5AMFA 4NR8A 4CFKA 5G4RA 2R0SA 5FE4A 5E0RA 1WUMA 3MQMA 5EM3A 3UV4A 4MEPA 4O78A 5A7CA 4BHWA 5HFQA 4DONA 5D3LA 4RVRA 5EU1A 4A9IA 5LUUA 3QZSA 4UITA 5CUAA 5II1A 5CUEA 5E9LA 3UV5A 5E9IA 2OSSA 4XYAA 4HXKA 5L97A 3MB3A 4HXNA 5C85A 2RO1A 3U5MA 5F62A 3AADA 5HQ5A 3LQHA 3S91A 5EQ1A 5LJ1A 4TYLA 3QZVA 4MENA 4PKLA 4BW3A 4MEQA 4NRBA 4QSTA 4QEWA 5H1VA 5EWWA 4GPJA 4YYMA 5TB6A 4FLPA 4Y03A 4HXSA 5A5RA 4KCXA 5IGLA 4WHWA 4NR6A 4YYHA 5EPSA 3SVHA 1JM4B 4O71A 4LRGA 4Z6HA 1JSPB 4KV1A 5L96A 3S92A 5EISA 4QR5A 5I86A 4NYWA 2G4AA 4IR5A 5DFBA 3HMEA 5IGKA 4QSWA 5EP7A 4KV4A 4IR4A 4NQMA 3LJWA 3P5OA 4YAXA 5DFCA 5HLSA 4QBMA 5FE8A 5A85A 3UVYA 5JWMA 4NRAA 5EV9A 5IIDA 5E73A 4IR6A 3GG3A 4A9OA 4MR3A 5E7DA 5HQ7A 4QC1A 5FFVA 4YYNA 4QSVA 3DWYA 5E3DA 5ENFA 4N3WA 5FE1A 5E3GA 5ENJA 4HBXA 4QSUA 5HENA 2RS9B 5D3PA 4OGIA 5CQAA 2WP1A 5I80A 4MR4A 5L98A 5LJ0A 4TZ8A 2E7NA 3U5JA 5FE6A 5FE3A 5F61A 4UIYA 3MXFA 5KTWA 4LZRA 4QSSA 5JI8A 4TTEA 4QEUA 4UYGA 4WIVA 4NUEA 2D9EA 3IU6A 5EGUA 5DW1A 4PS5A 5ENCA 3JVJA 5H1UA 2RNXA 5LVQA 1ZS5A 2I7KA 4HBVA 5FH7A 5FG4A 4NR9A 5D7XA 4A9MA 4O7AA 4O7FA 5DYUA 5EVAA 5II2A 4YBMA 4J1PA 5CP5A 1N72A 5CRZA 4TZ2A 4MR5A 2R10A 5FFYA 5E9YA 5I7XA 5ETBA 5A5NA 4IOOA 5ENBA 4CURA 3U5KA 5HRXA 5F36A 2DWWA 4XUAA 5H1TA 5DW2A 5ACYA 2DVSA 4J0RA 3I3JA 4HXPA 4OUFA 5CQ5A 3LQIA 2F6NA 4UYFA 3UVDA 3LXJA 4E96A 3O35A 3JVKA 5C4QA 2E7OA 5HCLA 4A9LA 1F68A 5D26A 5ENHA 3QZTA 5HM0A 5LKZA 5CUDA 3P1DA 5E9KA 2L85A 4ALGA 2E3KA 5A5SA 5HRWA 5IG6A 5LJ2A 2DATA 5D3NA 4J3IA 3MUKA 4QR4A 4O77A 5DYCA 5AD3A 3IU5A 4YH4A 5LVRA 5FB1A 5D3SA 4A9EA 2DVRA 4HBYA 5ENEA 3Q2FA 5F1LA 5KTUA 5HQ6A 5F2PA 3U5PA 4O7EA 5A5QA 3P1CA 3SVGA 5EA1A 5KTXA 4QNSA 4C67A 4NR5A 5LKUA 2YEKA 4YYJA 4YC9A 3LQJA 5FE5A 4NS5A 4YABA 5L8UA 5D3JA 4PY6A 4O70A 5J0DA 4NYXA 4YBSA 4NRCA 5A5PA 4LYSA 5EWCA 2RNYA 4UYEA 3RCWA 4YY6A 4NR7A 4QUTA 4TU6A 4PTBA 5A82A 1E6IA 4N4GA 4IOQA 1X0JA 2LSPB 3UVXA 4ALHA 2OO1A 4BW1A 4PCEA 4QY4A 5F5ZA 2YDWA 4AKNA 5FE7A 5E74A 2WP2A 2MJVB 3JVLA 5I1QA 4NQNA 1EQFA 5CTLA 2N9GA 4QSQA 5TCMA 5AMEA 5CFWA 4O76A 4HXRA 2YW5A 2KTBB 4O74A 5D3RA 4UYHA 2RFJA 5F25A 3TLPA 5I83A 4LZ2A 5BT5A 4O7BA 5HFRA 4Q0OA 4HXLA 4A9JA 5FE2A 3D7CA 3JVMA 5DY7A 5F60A 5CUBA 4PCIA 5CU8A 5HELA 4CL9A 4TT6A 5DKDA 4OGJA 4Q0NA 2FSAA 3O37A 2D82A 4QYLA 2OUOA 2RI7A 4A9KA 4BW2A 5FH8A 4CUTA 5I29A 5I7YA 4O75A 4TT2A 5CQ6A 5CQ3A 5CQ7A 5C7NA 4CUQA 3UVWA 5F63A 4BJXA 5EWVA 3DAIA 4BW4A 5CZGA 4CFLA 4YH3A 4XY8A 5DFDA 4QB3A 5I88A 5KU3A 5CPEA 5D3TA 2YYNA 4NUCA 5FG5A 3O33A 5BT3A 5LKXA 4NXJA 4QEVA 4UIXA 2DVVA 5F3AA 5HJCA 4UYFB 3FKMX 4MEOA 2NXBA 5LKTA 3U5LA 4YATA 5CUGA 5IBNA 4QSRA 4NYVA 4YYGA 4A9NA 4HBWA 5COIA 4YYIA 5IGNA 5CQ8A 4HXMA 5DLZA 3NXBA 5D24A 4QUUA 5FH6A 5DLXA 3MULA 4A9FA 4F3IA 4YADA 4Z1QA 5FBXA 2H60A 4N4IA 4LR6A 4Z6IA 5D0CA 2RNWA 5D25A 2DKWA 5DKCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CUP A;  5FB0 A;  4Z93 A;  3ZYU A;  5DYX A;  4A9H A;  4NR4 A;  4TU4 A;  4UIV A;  4ZQL A;  4NUD A;  2DVQ A;  4TS8 A;  2R0V A;  5AD2 A;  5ETD A;  4WHU A;  4N4H A;  5CGP A;  4IR3 A;  4YK0 A;  4LDF A;  5E9M A;  5HRV A;  5EWD A;  5D3H A;  4N4F A;  5EK9 A;  5FFW A;  4CUS A;  4QC3 A;  5F1H A;  5H85 A;  5L99 A;  3K2J A;  5I40 A;  4LYI A;  5EWH A;  5L8T A;  4QSP A;  2GRC A;  3AQA A;  5CS8 A;  4XY9 A;  2L84 A;  5C87 A;  4LYW A;  4YY4 A;  4QZS A;  5CQ4 A;  4LC2 A;  4LZS A;  5CRM A;  5EPB A;  4HXO A;  3O34 A;  4IOR A;  4MR6 A;  5G4S A;  5FG6 A;  4ZC9 A;  4QYD A;  4C66 A;  3ONI A;  3P1F A;  5A81 A;  3P1E A;  4CLB A;  4J0S A;  4Z1S A;  5C8G A;  3UW9 A;  4QSX A;  3SVF A;  4UIZ A;  5DKH A;  2L5E A;  2YEM A;  5A83 A;  4CUU A;  4YYK A;  3Q2E A;  4YYD A;  5HEM A;  4UIW A;  5BT4 A;  5EI4 A;  3G0J A;  3UV2 A;  2R0Y A;  4O7C A;  5A5O A;  3HMH A;  5IGM A;  4UYD A;  3U5N A;  5DX4 A;  4O72 A;  2I8N A;  5ENG A;  5KHM A;  3G0L A;  4TQN A;  5EPR A;  4ZW1 A;  2YEL A;  4QR3 A;  5CY9 A;  5C89 A;  3O36 A;  5DBM A;  4X2I A;  4YBT A;  4UIU A;  2F6J A;  3HMF A;  3MB4 A;  5DYA A;  5CUC A;  5EIC A;  5K29 A;  5FDZ A;  5I89 A;  5FE9 A;  4TT4 A;  4XUB A;  5FE0 A;  5KO4 A;  5E9V A;  3U5O A;  5CQT A;  5ENI A;  2YQD A;  1WUG A;  5AMF A;  4NR8 A;  4CFK A;  5G4R A;  2R0S A;  5FE4 A;  5E0R A;  1WUM A;  3MQM A;  5EM3 A;  3UV4 A;  4MEP A;  4O78 A;  5A7C A;  4BHW A;  5HFQ A;  4DON A;  5D3L A;  4RVR A;  5EU1 A;  4A9I A;  5LUU A;  3QZS A;  4UIT A;  5CUA A;  5II1 A;  5CUE A;  5E9L A;  3UV5 A;  5E9I A;  2OSS A;  4XYA A;  4HXK A;  5L97 A;  3MB3 A;  4HXN A;  5C85 A;  2RO1 A;  3U5M A;  5F62 A;  3AAD A;  5HQ5 A;  3LQH A;  3S91 A;  5EQ1 A;  5LJ1 A;  4TYL A;  3QZV A;  4MEN A;  4PKL A;  4BW3 A;  4MEQ A;  4NRB A;  4QST A;  4QEW A;  5H1V A;  5EWW A;  4GPJ A;  4YYM A;  5TB6 A;  4FLP A;  4Y03 A;  4HXS A;  5A5R A;  4KCX A;  5IGL A;  4WHW A;  4NR6 A;  4YYH A;  5EPS A;  3SVH A;  1JM4 B;  4O71 A;  4LRG A;  4Z6H A;  1JSP B;  4KV1 A;  5L96 A;  3S92 A;  5EIS A;  4QR5 A;  5I86 A;  4NYW A;  2G4A A;  4IR5 A;  5DFB A;  3HME A;  5IGK A;  4QSW A;  5EP7 A;  4KV4 A;  4IR4 A;  4NQM A;  3LJW A;  3P5O A;  4YAX A;  5DFC A;  5HLS A;  4QBM A;  5FE8 A;  5A85 A;  3UVY A;  5JWM A;  4NRA A;  5EV9 A;  5IID A;  5E73 A;  4IR6 A;  3GG3 A;  4A9O A;  4MR3 A;  5E7D A;  5HQ7 A;  4QC1 A;  5FFV A;  4YYN A;  4QSV A;  3DWY A;  5E3D A;  5ENF A;  4N3W A;  5FE1 A;  5E3G A;  5ENJ A;  4HBX A;  4QSU A;  5HEN A;  2RS9 B;  5D3P A;  4OGI A;  5CQA A;  2WP1 A;  5I80 A;  4MR4 A;  5L98 A;  5LJ0 A;  4TZ8 A;  2E7N A;  3U5J A;  5FE6 A;  5FE3 A;  5F61 A;  4UIY A;  3MXF A;  5KTW A;  4LZR A;  4QSS A;  5JI8 A;  4TTE A;  4QEU A;  4UYG A;  4WIV A;  4NUE A;  2D9E A;  3IU6 A;  5EGU A;  5DW1 A;  4PS5 A;  5ENC A;  3JVJ A;  5H1U A;  2RNX A;  5LVQ A;  1ZS5 A;  2I7K A;  4HBV A;  5FH7 A;  5FG4 A;  4NR9 A;  5D7X A;  4A9M A;  4O7A A;  4O7F A;  5DYU A;  5EVA A;  5II2 A;  4YBM A;  4J1P A;  5CP5 A;  1N72 A;  5CRZ A;  4TZ2 A;  4MR5 A;  2R10 A;  5FFY A;  5E9Y A;  5I7X A;  5ETB A;  5A5N A;  4IOO A;  5ENB A;  4CUR A;  3U5K A;  5HRX A;  5F36 A;  2DWW A;  4XUA A;  5H1T A;  5DW2 A;  5ACY A;  2DVS A;  4J0R A;  3I3J A;  4HXP A;  4OUF A;  5CQ5 A;  3LQI A;  2F6N A;  4UYF A;  3UVD A;  3LXJ A;  4E96 A;  3O35 A;  3JVK A;  5C4Q A;  2E7O A;  5HCL A;  4A9L A;  1F68 A;  5D26 A;  5ENH A;  3QZT A;  5HM0 A;  5LKZ A;  5CUD A;  3P1D A;  5E9K A;  2L85 A;  4ALG A;  2E3K A;  5A5S A;  5HRW A;  5IG6 A;  5LJ2 A;  2DAT A;  5D3N A;  4J3I A;  3MUK A;  4QR4 A;  4O77 A;  5DYC A;  5AD3 A;  3IU5 A;  4YH4 A;  5LVR A;  5FB1 A;  5D3S A;  4A9E A;  2DVR A;  4HBY A;  5ENE A;  3Q2F A;  5F1L A;  5KTU A;  5HQ6 A;  5F2P A;  3U5P A;  4O7E A;  5A5Q A;  3P1C A;  3SVG A;  5EA1 A;  5KTX A;  4QNS A;  4C67 A;  4NR5 A;  5LKU A;  2YEK A;  4YYJ A;  4YC9 A;  3LQJ A;  5FE5 A;  4NS5 A;  4YAB A;  5L8U A;  5D3J A;  4PY6 A;  4O70 A;  5J0D A;  4NYX A;  4YBS A;  4NRC A;  5A5P A;  4LYS A;  5EWC A;  2RNY A;  4UYE A;  3RCW A;  4YY6 A;  4NR7 A;  4QUT A;  4TU6 A;  4PTB A;  5A82 A;  1E6I A;  4N4G A;  4IOQ A;  1X0J A;  2LSP B;  3UVX A;  4ALH A;  2OO1 A;  4BW1 A;  4PCE A;  4QY4 A;  5F5Z A;  2YDW A;  4AKN A;  5FE7 A;  5E74 A;  2WP2 A;  2MJV B;  3JVL A;  5I1Q A;  4NQN A;  1EQF A;  5CTL A;  2N9G A;  4QSQ A;  5TCM A;  5AME A;  5CFW A;  4O76 A;  4HXR A;  2YW5 A;  2KTB B;  4O74 A;  5D3R A;  4UYH A;  2RFJ A;  5F25 A;  3TLP A;  5I83 A;  4LZ2 A;  5BT5 A;  4O7B A;  5HFR A;  4Q0O A;  4HXL A;  4A9J A;  5FE2 A;  3D7C A;  3JVM A;  5DY7 A;  5F60 A;  5CUB A;  4PCI A;  5CU8 A;  5HEL A;  4CL9 A;  4TT6 A;  5DKD A;  4OGJ A;  4Q0N A;  2FSA A;  3O37 A;  2D82 A;  4QYL A;  2OUO A;  2RI7 A;  4A9K A;  4BW2 A;  5FH8 A;  4CUT A;  5I29 A;  5I7Y A;  4O75 A;  4TT2 A;  5CQ6 A;  5CQ3 A;  5CQ7 A;  5C7N A;  4CUQ A;  3UVW A;  5F63 A;  4BJX A;  5EWV A;  3DAI A;  4BW4 A;  5CZG A;  4CFL A;  4YH3 A;  4XY8 A;  5DFD A;  4QB3 A;  5I88 A;  5KU3 A;  5CPE A;  5D3T A;  2YYN A;  4NUC A;  5FG5 A;  3O33 A;  5BT3 A;  5LKX A;  4NXJ A;  4QEV A;  4UIX A;  2DVV A;  5F3A A;  5HJC A;  4UYF B;  3FKM X;  4MEO A;  2NXB A;  5LKT A;  3U5L A;  4YAT A;  5CUG A;  5IBN A;  4QSR A;  4NYV A;  4YYG A;  4A9N A;  4HBW A;  5COI A;  4YYI A;  5IGN A;  5CQ8 A;  4HXM A;  5DLZ A;  3NXB A;  5D24 A;  4QUU A;  5FH6 A;  5DLX A;  3MUL A;  4A9F A;  4F3I A;  4YAD A;  4Z1Q A;  5FBX A;  2H60 A;  4N4I A;  4LR6 A;  4Z6I A;  5D0C A;  2RNW A;  5D25 A;  2DKW A;  5DKC A; 
#chains in the Genus database with same CATH topology
 4CUP A;  5FB0 A;  4Z93 A;  3ZYU A;  5DYX A;  4A9H A;  4NR4 A;  4TU4 A;  4UIV A;  4ZQL A;  4NUD A;  2DVQ A;  4TS8 A;  2R0V A;  5AD2 A;  5ETD A;  4WHU A;  4N4H A;  5CGP A;  4IR3 A;  4YK0 A;  4LDF A;  5E9M A;  5HRV A;  5EWD A;  5D3H A;  4N4F A;  5EK9 A;  5FFW A;  4CUS A;  4QC3 A;  5F1H A;  5H85 A;  5L99 A;  3K2J A;  5I40 A;  4LYI A;  5EWH A;  5L8T A;  4QSP A;  2GRC A;  3AQA A;  5CS8 A;  4XY9 A;  2L84 A;  5C87 A;  4LYW A;  4YY4 A;  4QZS A;  5CQ4 A;  4LC2 A;  4LZS A;  5CRM A;  5EPB A;  4AKI A;  4HXO A;  3O34 A;  4IOR A;  4MR6 A;  5G4S A;  5FG6 A;  4ZC9 A;  4QYD A;  4C66 A;  3ONI A;  3P1F A;  5A81 A;  3P1E A;  4CLB A;  4J0S A;  4Z1S A;  5C8G A;  3UW9 A;  4QSX A;  3SVF A;  4UIZ A;  5DKH A;  2L5E A;  2YEM A;  5A83 A;  4CUU A;  4YYK A;  3Q2E A;  4YYD A;  5HEM A;  4UIW A;  5BT4 A;  5EI4 A;  3G0J A;  3UV2 A;  2R0Y A;  4O7C A;  5A5O A;  3HMH A;  5IGM A;  4UYD A;  3U5N A;  5DX4 A;  4O72 A;  2I8N A;  5ENG A;  4AI6 A;  5KHM A;  3G0L A;  4TQN A;  5EPR A;  2EJN A;  4ZW1 A;  2YEL A;  4QR3 A;  5CY9 A;  5C89 A;  3O36 A;  5DBM A;  4X2I A;  4YBT A;  4UIU A;  2F6J A;  3HMF A;  3MB4 A;  5DYA A;  5CUC A;  5EIC A;  5K29 A;  5FDZ A;  5I89 A;  5FE9 A;  4TT4 A;  4XUB A;  5FE0 A;  5KO4 A;  5E9V A;  3U5O A;  5CQT A;  5ENI A;  2YQD A;  1WUG A;  5AMF A;  4NR8 A;  4CFK A;  5G4R A;  2R0S A;  5FE4 A;  5E0R A;  1WUM A;  3MQM A;  5EM3 A;  3UV4 A;  4MEP A;  4O78 A;  5A7C A;  4BHW A;  5HFQ A;  4DON A;  5D3L A;  4RVR A;  5EU1 A;  4A9I A;  5LUU A;  3QZS A;  4UIT A;  5CUA A;  5II1 A;  5CUE A;  5E9L A;  3UV5 A;  5E9I A;  2OSS A;  4XYA A;  4HXK A;  5L97 A;  3MB3 A;  4HXN A;  5C85 A;  3D1D A;  4AKG A;  2RO1 A;  3U5M A;  5F62 A;  3AAD A;  5HQ5 A;  3LQH A;  3S91 A;  5EQ1 A;  5LJ1 A;  4TYL A;  3QZV A;  4MEN A;  4PKL A;  4BW3 A;  4MEQ A;  4NRB A;  4QST A;  4QEW A;  5H1V A;  5EWW A;  4GPJ A;  4YYM A;  5TB6 A;  4FLP A;  4Y03 A;  4HXS A;  5A5R A;  4KCX A;  5IGL A;  4WHW A;  4NR6 A;  4YYH A;  5EPS A;  3SVH A;  1JM4 B;  4O71 A;  4LRG A;  4Z6H A;  1JSP B;  4KV1 A;  5L96 A;  3S92 A;  5EIS A;  3VKH A;  4QR5 A;  5I86 A;  4NYW A;  2G4A A;  4IR5 A;  5DFB A;  3HME A;  5IGK A;  4QSW A;  5EP7 A;  4KV4 A;  4IR4 A;  4NQM A;  3LJW A;  3P5O A;  4YAX A;  5DFC A;  5HLS A;  4QBM A;  5FE8 A;  5A85 A;  3UVY A;  5JWM A;  4NRA A;  5EV9 A;  5IID A;  5E73 A;  4IR6 A;  3GG3 A;  4A9O A;  4MR3 A;  5E7D A;  5HQ7 A;  4QC1 A;  5FFV A;  4YYN A;  4QSV A;  3DWY A;  5E3D A;  5ENF A;  4N3W A;  5FE1 A;  5E3G A;  5ENJ A;  4HBX A;  4QSU A;  5HEN A;  2RS9 B;  5D3P A;  4OGI A;  5CQA A;  2WP1 A;  5I80 A;  4MR4 A;  5L98 A;  5LJ0 A;  4TZ8 A;  2E7N A;  3U5J A;  5FE6 A;  5FE3 A;  5F61 A;  4UIY A;  3MXF A;  5KTW A;  4LZR A;  4QSS A;  5JI8 A;  4TTE A;  4QEU A;  4UYG A;  4WIV A;  4NUE A;  2D9E A;  3IU6 A;  5EGU A;  5DW1 A;  4PS5 A;  5ENC A;  3JVJ A;  5H1U A;  2RNX A;  5LVQ A;  1ZS5 A;  2I7K A;  4HBV A;  5FH7 A;  5FG4 A;  4NR9 A;  5D7X A;  4A9M A;  4O7A A;  4O7F A;  5DYU A;  5EVA A;  5II2 A;  3ERR A;  4YBM A;  4J1P A;  5CP5 A;  1N72 A;  5CRZ A;  4TZ2 A;  4MR5 A;  2R10 A;  5FFY A;  5E9Y A;  5I7X A;  5ETB A;  5A5N A;  4IOO A;  5ENB A;  4CUR A;  3U5K A;  5HRX A;  5F36 A;  2DWW A;  4XUA A;  5H1T A;  5DW2 A;  5ACY A;  2DVS A;  4J0R A;  3I3J A;  4HXP A;  4OUF A;  5CQ5 A;  3LQI A;  2F6N A;  4UYF A;  3UVD A;  3LXJ A;  4E96 A;  3O35 A;  3JVK A;  4AKH A;  5C4Q A;  2E7O A;  5HCL A;  4A9L A;  1F68 A;  5D26 A;  5ENH A;  3QZT A;  5HM0 A;  5LKZ A;  5CUD A;  3P1D A;  5E9K A;  2L85 A;  4ALG A;  2E3K A;  5A5S A;  5HRW A;  5IG6 A;  5LJ2 A;  2DAT A;  5D3N A;  4J3I A;  3MUK A;  4QR4 A;  4O77 A;  5DYC A;  5AD3 A;  3IU5 A;  4YH4 A;  5LVR A;  5FB1 A;  5D3S A;  4A9E A;  2DVR A;  3D1B A;  4HBY A;  5ENE A;  3Q2F A;  5F1L A;  5KTU A;  3VKG A;  5HQ6 A;  5F2P A;  3U5P A;  4O7E A;  5A5Q A;  3P1C A;  3SVG A;  5EA1 A;  5KTX A;  4QNS A;  4C67 A;  4NR5 A;  5LKU A;  2YEK A;  4YYJ A;  4YC9 A;  3LQJ A;  5FE5 A;  4NS5 A;  4YAB A;  5L8U A;  5D3J A;  4PY6 A;  4O70 A;  5J0D A;  4NYX A;  4YBS A;  4NRC A;  5A5P A;  4LYS A;  5EWC A;  2RNY A;  4UYE A;  3RCW A;  4YY6 A;  4NR7 A;  4QUT A;  4TU6 A;  4PTB A;  5A82 A;  1E6I A;  4N4G A;  4IOQ A;  1X0J A;  2LSP B;  3UVX A;  4ALH A;  2OO1 A;  4BW1 A;  4PCE A;  4QY4 A;  5F5Z A;  2YDW A;  4AKN A;  5FE7 A;  5E74 A;  2WP2 A;  2MJV B;  3JVL A;  5I1Q A;  4NQN A;  1EQF A;  5CTL A;  2N9G A;  4QSQ A;  5TCM A;  5AME A;  5CFW A;  4O76 A;  4HXR A;  2YW5 A;  2KTB B;  4O74 A;  5D3R A;  4UYH A;  2RFJ A;  5F25 A;  3TLP A;  5I83 A;  4LZ2 A;  5BT5 A;  4O7B A;  5HFR A;  4Q0O A;  4HXL A;  1ZKR A;  4A9J A;  5FE2 A;  3D7C A;  3JVM A;  5DY7 A;  5F60 A;  5CUB A;  4PCI A;  5CU8 A;  5HEL A;  4CL9 A;  4TT6 A;  5DKD A;  4OGJ A;  4Q0N A;  2FSA A;  3O37 A;  2D82 A;  4QYL A;  2OUO A;  2RI7 A;  4A9K A;  4BW2 A;  5FH8 A;  1PUO A;  4CUT A;  5I29 A;  5I7Y A;  4O75 A;  4TT2 A;  5CQ6 A;  5CQ3 A;  5CQ7 A;  5C7N A;  4CUQ A;  3UVW A;  5F63 A;  4BJX A;  5EWV A;  3DAI A;  4BW4 A;  5CZG A;  4CFL A;  4YH3 A;  4XY8 A;  5DFD A;  4QB3 A;  5I88 A;  5KU3 A;  5CPE A;  5D3T A;  2YYN A;  4NUC A;  5FG5 A;  3O33 A;  5BT3 A;  5LKX A;  4NXJ A;  4QEV A;  4UIX A;  2DVV A;  5F3A A;  5HJC A;  4UYF B;  3FKM X;  4MEO A;  2NXB A;  5LKT A;  3U5L A;  4YAT A;  5CUG A;  5IBN A;  4QSR A;  4NYV A;  4YYG A;  4A9N A;  4HBW A;  5COI A;  4YYI A;  5IGN A;  5CQ8 A;  4HXM A;  5DLZ A;  3NXB A;  5D24 A;  4QUU A;  5FH6 A;  5DLX A;  3MUL A;  4A9F A;  4F3I A;  4YAD A;  4Z1Q A;  5FBX A;  2H60 A;  4N4I A;  4LR6 A;  4Z6I A;  5D0C A;  2RNW A;  5D25 A;  2DKW A;  5DKC A; 
#chains in the Genus database with same CATH homology
 4CUP A;  5FB0 A;  4Z93 A;  3ZYU A;  5DYX A;  4A9H A;  4NR4 A;  4TU4 A;  4UIV A;  4ZQL A;  4NUD A;  2DVQ A;  4TS8 A;  2R0V A;  5AD2 A;  5ETD A;  4WHU A;  4N4H A;  5CGP A;  4IR3 A;  4YK0 A;  4LDF A;  5E9M A;  5HRV A;  5EWD A;  5D3H A;  4N4F A;  5EK9 A;  5FFW A;  4CUS A;  4QC3 A;  5F1H A;  5H85 A;  5L99 A;  3K2J A;  5I40 A;  4LYI A;  5EWH A;  5L8T A;  4QSP A;  2GRC A;  3AQA A;  5CS8 A;  4XY9 A;  2L84 A;  5C87 A;  4LYW A;  4YY4 A;  4QZS A;  5CQ4 A;  4LC2 A;  4LZS A;  5CRM A;  5EPB A;  4HXO A;  3O34 A;  4IOR A;  4MR6 A;  5G4S A;  5FG6 A;  4ZC9 A;  4QYD A;  4C66 A;  3ONI A;  3P1F A;  5A81 A;  3P1E A;  4CLB A;  4J0S A;  4Z1S A;  5C8G A;  3UW9 A;  4QSX A;  3SVF A;  4UIZ A;  5DKH A;  2L5E A;  2YEM A;  5A83 A;  4CUU A;  4YYK A;  3Q2E A;  4YYD A;  5HEM A;  4UIW A;  5BT4 A;  5EI4 A;  3G0J A;  3UV2 A;  2R0Y A;  4O7C A;  5A5O A;  3HMH A;  5IGM A;  4UYD A;  3U5N A;  5DX4 A;  4O72 A;  2I8N A;  5ENG A;  5KHM A;  3G0L A;  4TQN A;  5EPR A;  4ZW1 A;  2YEL A;  4QR3 A;  5CY9 A;  5C89 A;  3O36 A;  5DBM A;  4X2I A;  4YBT A;  4UIU A;  2F6J A;  3HMF A;  3MB4 A;  5DYA A;  5CUC A;  5EIC A;  5K29 A;  5FDZ A;  5I89 A;  5FE9 A;  4TT4 A;  4XUB A;  5FE0 A;  5KO4 A;  5E9V A;  3U5O A;  5CQT A;  5ENI A;  2YQD A;  1WUG A;  5AMF A;  4NR8 A;  4CFK A;  5G4R A;  2R0S A;  5FE4 A;  5E0R A;  1WUM A;  3MQM A;  5EM3 A;  3UV4 A;  4MEP A;  4O78 A;  5A7C A;  4BHW A;  5HFQ A;  4DON A;  5D3L A;  4RVR A;  5EU1 A;  4A9I A;  5LUU A;  3QZS A;  4UIT A;  5CUA A;  5II1 A;  5CUE A;  5E9L A;  3UV5 A;  5E9I A;  2OSS A;  4XYA A;  4HXK A;  5L97 A;  3MB3 A;  4HXN A;  5C85 A;  2RO1 A;  3U5M A;  5F62 A;  3AAD A;  5HQ5 A;  3LQH A;  3S91 A;  5EQ1 A;  5LJ1 A;  4TYL A;  3QZV A;  4MEN A;  4PKL A;  4BW3 A;  4MEQ A;  4NRB A;  4QST A;  4QEW A;  5H1V A;  5EWW A;  4GPJ A;  4YYM A;  5TB6 A;  4FLP A;  4Y03 A;  4HXS A;  5A5R A;  4KCX A;  5IGL A;  4WHW A;  4NR6 A;  4YYH A;  5EPS A;  3SVH A;  1JM4 B;  4O71 A;  4LRG A;  4Z6H A;  1JSP B;  4KV1 A;  5L96 A;  3S92 A;  5EIS A;  4QR5 A;  5I86 A;  4NYW A;  2G4A A;  4IR5 A;  5DFB A;  3HME A;  5IGK A;  4QSW A;  5EP7 A;  4KV4 A;  4IR4 A;  4NQM A;  3LJW A;  3P5O A;  4YAX A;  5DFC A;  5HLS A;  4QBM A;  5FE8 A;  5A85 A;  3UVY A;  5JWM A;  4NRA A;  5EV9 A;  5IID A;  5E73 A;  4IR6 A;  3GG3 A;  4A9O A;  4MR3 A;  5E7D A;  5HQ7 A;  4QC1 A;  5FFV A;  4YYN A;  4QSV A;  3DWY A;  5E3D A;  5ENF A;  4N3W A;  5FE1 A;  5E3G A;  5ENJ A;  4HBX A;  4QSU A;  5HEN A;  2RS9 B;  5D3P A;  4OGI A;  5CQA A;  2WP1 A;  5I80 A;  4MR4 A;  5L98 A;  5LJ0 A;  4TZ8 A;  2E7N A;  3U5J A;  5FE6 A;  5FE3 A;  5F61 A;  4UIY A;  3MXF A;  5KTW A;  4LZR A;  4QSS A;  5JI8 A;  4TTE A;  4QEU A;  4UYG A;  4WIV A;  4NUE A;  2D9E A;  3IU6 A;  5EGU A;  5DW1 A;  4PS5 A;  5ENC A;  3JVJ A;  5H1U A;  2RNX A;  5LVQ A;  1ZS5 A;  2I7K A;  4HBV A;  5FH7 A;  5FG4 A;  4NR9 A;  5D7X A;  4A9M A;  4O7A A;  4O7F A;  5DYU A;  5EVA A;  5II2 A;  4YBM A;  4J1P A;  5CP5 A;  1N72 A;  5CRZ A;  4TZ2 A;  4MR5 A;  2R10 A;  5FFY A;  5E9Y A;  5I7X A;  5ETB A;  5A5N A;  4IOO A;  5ENB A;  4CUR A;  3U5K A;  5HRX A;  5F36 A;  2DWW A;  4XUA A;  5H1T A;  5DW2 A;  5ACY A;  2DVS A;  4J0R A;  3I3J A;  4HXP A;  4OUF A;  5CQ5 A;  3LQI A;  2F6N A;  4UYF A;  3UVD A;  3LXJ A;  4E96 A;  3O35 A;  3JVK A;  5C4Q A;  2E7O A;  5HCL A;  4A9L A;  1F68 A;  5D26 A;  5ENH A;  3QZT A;  5HM0 A;  5LKZ A;  5CUD A;  3P1D A;  5E9K A;  2L85 A;  4ALG A;  2E3K A;  5A5S A;  5HRW A;  5IG6 A;  5LJ2 A;  2DAT A;  5D3N A;  4J3I A;  3MUK A;  4QR4 A;  4O77 A;  5DYC A;  5AD3 A;  3IU5 A;  4YH4 A;  5LVR A;  5FB1 A;  5D3S A;  4A9E A;  2DVR A;  4HBY A;  5ENE A;  3Q2F A;  5F1L A;  5KTU A;  5HQ6 A;  5F2P A;  3U5P A;  4O7E A;  5A5Q A;  3P1C A;  3SVG A;  5EA1 A;  5KTX A;  4QNS A;  4C67 A;  4NR5 A;  5LKU A;  2YEK A;  4YYJ A;  4YC9 A;  3LQJ A;  5FE5 A;  4NS5 A;  4YAB A;  5L8U A;  5D3J A;  4PY6 A;  4O70 A;  5J0D A;  4NYX A;  4YBS A;  4NRC A;  5A5P A;  4LYS A;  5EWC A;  2RNY A;  4UYE A;  3RCW A;  4YY6 A;  4NR7 A;  4QUT A;  4TU6 A;  4PTB A;  5A82 A;  1E6I A;  4N4G A;  4IOQ A;  1X0J A;  2LSP B;  3UVX A;  4ALH A;  2OO1 A;  4BW1 A;  4PCE A;  4QY4 A;  5F5Z A;  2YDW A;  4AKN A;  5FE7 A;  5E74 A;  2WP2 A;  2MJV B;  3JVL A;  5I1Q A;  4NQN A;  1EQF A;  5CTL A;  2N9G A;  4QSQ A;  5TCM A;  5AME A;  5CFW A;  4O76 A;  4HXR A;  2YW5 A;  2KTB B;  4O74 A;  5D3R A;  4UYH A;  2RFJ A;  5F25 A;  3TLP A;  5I83 A;  4LZ2 A;  5BT5 A;  4O7B A;  5HFR A;  4Q0O A;  4HXL A;  4A9J A;  5FE2 A;  3D7C A;  3JVM A;  5DY7 A;  5F60 A;  5CUB A;  4PCI A;  5CU8 A;  5HEL A;  4CL9 A;  4TT6 A;  5DKD A;  4OGJ A;  4Q0N A;  2FSA A;  3O37 A;  2D82 A;  4QYL A;  2OUO A;  2RI7 A;  4A9K A;  4BW2 A;  5FH8 A;  4CUT A;  5I29 A;  5I7Y A;  4O75 A;  4TT2 A;  5CQ6 A;  5CQ3 A;  5CQ7 A;  5C7N A;  4CUQ A;  3UVW A;  5F63 A;  4BJX A;  5EWV A;  3DAI A;  4BW4 A;  5CZG A;  4CFL A;  4YH3 A;  4XY8 A;  5DFD A;  4QB3 A;  5I88 A;  5KU3 A;  5CPE A;  5D3T A;  2YYN A;  4NUC A;  5FG5 A;  3O33 A;  5BT3 A;  5LKX A;  4NXJ A;  4QEV A;  4UIX A;  2DVV A;  5F3A A;  5HJC A;  4UYF B;  3FKM X;  4MEO A;  2NXB A;  5LKT A;  3U5L A;  4YAT A;  5CUG A;  5IBN A;  4QSR A;  4NYV A;  4YYG A;  4A9N A;  4HBW A;  5COI A;  4YYI A;  5IGN A;  5CQ8 A;  4HXM A;  5DLZ A;  3NXB A;  5D24 A;  4QUU A;  5FH6 A;  5DLX A;  3MUL A;  4A9F A;  4F3I A;  4YAD A;  4Z1Q A;  5FBX A;  2H60 A;  4N4I A;  4LR6 A;  4Z6I A;  5D0C A;  2RNW A;  5D25 A;  2DKW A;  5DKC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...