1N72A

Structure and ligand of a histone acetyltransferase bromodomain
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
115
structure length
115
Chain Sequence
MSKEPRDPDQLYSTLKSILQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLKNRYYVSKKLFMADLQRVFTNCKEYNPPESEYYKCANILEKFFFSKIKEAGLIDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HISTONE ACETYLTRANSFERASE
publication title Structure and Ligand of a Histone Acetyltransferase Bromodomain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 27
structure length 115
sequence length 115
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2002-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 1n72A00
3UVYA 4ALHA 5FFVA 4HXLA 4NYVA 4LRGA 3U5LA 3DAIA 4Y03A 5C7NA 5FG5A 5CTLA 5DFDA 4QSUA 2YYNA 5A83A 4NR8A 4YYMA 4QSRA 4HXPA 5E9YA 2R0VA 4O75A 5KHMA 4CLBA 3I3JA 4LZRA 5FH8A 5D26A 5D3NA 2DWWA 2R0SA 5D3RA 4YYJA 4WHUA 3UV4A 4PS5A 4NS5A 4MEPA 5CQAA 4J0RA 4YBMA 5KO4A 4YH4A 5FH7A 5HEMA 5A7CA 3Q2EA 4YBTA 2R10A 4PKLA 4HXRA 5HRWA 3IU5A 4NUCA 4ZQLA 4MEOA 4QC1A 1JSPB 4YH3A 3P1DA 5K29A 3P1FA 5DFCA 5CUCA 3NXBA 4OUFA 5CS8A 4XUAA 5HJCA 5D3PA 5IGMA 4LYWA 5G4RA 5II1A 5C87A 5A81A 5FE4A 2YQDA 5ENFA 4HXSA 2OO1A 5F60A 4YY6A 4CL9A 5ENCA 4A9JA 5I1QA 4NRBA 2YW5A 2YDWA 5DYAA 4IOOA 5I83A 3UVWA 5EV9A 4YYNA 4UITA 4PCIA 5CQ4A 4IORA 4O76A 4NR4A 4QSSA 5COIA 4O7AA 2KTBB 3GG3A 5EPBA 4O70A 2OUOA 5D3TA 4YC9A 5AD3A 4HXOA 4QZSA 4X2IA 3S91A 5DW2A 5EGUA 5L97A 5CQ8A 2YEMA 5DKCA 4UIZA 4O71A 4PTBA 4MR4A 5I88A 4HXNA 3S92A 4TS8A 5KU3A 5DX4A 5J0DA 5EWWA 2RI7A 5D3LA 4C66A 4KCXA 3IU6A 5CPEA 4A9KA 2GRCA 2F6NA 4O7FA 5CY9A 5EP7A 5FB1A 5HQ5A 3JVJA 3LQIA 4XY8A 4A9HA 3O33A 4UYDA 5KTWA 4QYDA 3D7CA 4YY4A 4Z6IA 5D24A 3SVHA 5EI4A 3O37A 5CUAA 5FG6A 5ENIA 4A9EA 2D82A 4TZ8A 3MQMA 5FFWA 4CURA 3MB3A 4YYGA 5HLSA 4BW2A 2DVVA 4UYFB 3LJWA 5LKZA 5DKHA 2DVQA 4TU4A 5KTUA 2G4AA 4Q0NA 5EU1A 2R0YA 3LQHA 5F62A 5F2PA 3DWYA 5EWCA 4MR5A 5A85A 2RNWA 5I7YA 4HBWA 4TYLA 2FSAA 5D3JA 4HBVA 1N72A 5E73A 5EWHA 5TCMA 5AD2A 4O7EA 4FLPA 2YELA 4YYKA 4GPJA 5E7DA 3P1EA 3JVLA 4NYWA 5EVAA 4LR6A 5F3AA 4WIVA 4O78A 4QR3A 5L8TA 3UV5A 5ENHA 5CGPA 4CUTA 4DONA 3HMFA 3MULA 5A5RA 5CQ6A 4YADA 4RVRA 3JVMA 4QUTA 4NUDA 5DFBA 5HELA 5LJ1A 4YYIA 5AMEA 5DYCA 1F68A 4A9IA 1WUMA 5F61A 5I80A 5DW1A 4BW3A 4QYLA 4IOQA 5AMFA 5FH6A 5FDZA 5I86A 4LC2A 4QSWA 4QSPA 5D3SA 5I40A 5IIDA 4QSVA 5H1VA 4LZ2A 2DVRA 3RCWA 3SVGA 5H1UA 5IGKA 5BT3A 4NXJA 4LZSA 4Z93A 5BT5A 5A5PA 5CQ3A 1ZS5A 3K2JA 5HRXA 4YATA 5TB6A 4YABA 5F36A 4TT4A 4UYGA 4AKNA 4CFLA 1EQFA 5A82A 3U5PA 4MR3A 2L85A 3ZYUA 4OGIA 5D25A 4NR6A 5CQ7A 3MB4A 2E7OA 4Z1QA 1X0JA 3LXJA 4A9FA 3QZTA 5CRMA 4LYSA 3MUKA 5L99A 4IR5A 5EPRA 5E9IA 5H1TA 4O74A 4QBMA 3HMHA 3U5OA 4N4HA 5FE8A 3LQJA 5I89A 5ENJA 3O34A 4HXMA 3O36A 4UYFA 4E96A 4QEWA 3UV2A 5CP5A 3FKMX 4BW1A 4Z1SA 5FE2A 5IGNA 4N4FA 5D7XA 5KTXA 4MENA 5I7XA 5EPSA 4CUUA 5CUEA 5HENA 3TLPA 4O7CA 4ZC9A 4N4GA 5FE7A 4UIXA 5FB0A 4PY6A 4YYHA 4KV4A 5DBMA 4A9LA 2DKWA 5L96A 5LUUA 5G4SA 4BW4A 2LSPB 4N4IA 4IR4A 3JVKA 4CFKA 5DLZA 5I29A 2E7NA 5FE0A 5FE5A 5HCLA 4XYAA 2E3KA 4IR3A 5L8UA 5EISA 5IG6A 5HQ7A 5A5NA 4QB3A 4O72A 4QY4A 5LKUA 2F6JA 4NQMA 5D0CA 5EICA 5ETDA 5F63A 4BHWA 4QNSA 4KV1A 2I8NA 5DY7A 4A9MA 4A9NA 4TT2A 5E74A 4LYIA 5BT4A 2MJVB 2L5EA 5ENBA 3G0LA 4PCEA 4YK0A 5FBXA 4OGJA 5CUDA 4QR5A 3AADA 4QC3A 5EK9A 5IGLA 4NRCA 2RS9B 4TU6A 5HFQA 5JI8A 3Q2FA 3ONIA 5FE9A 5EWVA 2RFJA 4WHWA 5EM3A 3UW9A 4N3WA 5ETBA 4O7BA 5CU8A 4XY9A 5C89A 4QSXA 3G0JA 5FE3A 4QEVA 5E9LA 3U5KA 2WP1A 5JWMA 5L98A 4J3IA 5E9KA 5EWDA 5ACYA 2N9GA 1WUGA 1E6IA 5C4QA 4YBSA 4UIVA 4O77A 4Q0OA 5FG4A 5F1HA 4C67A 4MEQA 4IR6A 5A5QA 4TZ2A 5FE6A 3P1CA 3U5MA 5HRVA 4TT6A 3UVXA 4QR4A 5FFYA 5C85A 5C8GA 5FE1A 5LJ2A 5CRZA 3QZSA 4J1PA 2D9EA 5A5SA 4UIYA 4TTEA 4NR7A 5ENEA 3UVDA 4QSTA 5E3GA 2DVSA 5H85A 4ALGA 4HXKA 5DYUA 4NYXA 4NUEA 5F25A 4Z6HA 5IBNA 5E9VA 5E3DA 4NQNA 4QSQA 5LKTA 3HMEA 5CFWA 2RNXA 3O35A 5E9MA 4YYDA 1JM4B 4CUPA 2L84A 4J0SA 5LVRA 3MXFA 3P5OA 4NR5A 5EQ1A 5CQTA 5DYXA 4F3IA 5LVQA 4QEUA 4YAXA 2H60A 4BJXA 4UYEA 4NRAA 5D3HA 4A9OA 5LKXA 2RNYA 4CUSA 3U5NA 5F5ZA 2NXBA 2DATA 4LDFA 4XUBA 5F1LA 4ZW1A 5A5OA 5EA1A 5DLXA 5DKDA 2YEKA 4MR6A 2I7KA 5CZGA 4NR9A 4UYHA 3SVFA 5CUGA 5HFRA 4UIWA 4UIUA 4QUUA 5LJ0A 4HBXA 5ENGA 5II2A 5HQ6A 2WP2A 5CQ5A 4TQNA 5HM0A 5E0RA 2OSSA 3AQAA 5CUBA 3U5JA 2RO1A 3QZVA 4HBYA 4CUQA
chains in the Genus database with same CATH superfamily
3UVYA 4ALHA 5FFVA 4HXLA 4NYVA 4LRGA 3U5LA 3DAIA 4Y03A 5C7NA 5FG5A 5CTLA 5DFDA 4QSUA 2YYNA 5A83A 4NR8A 4YYMA 4QSRA 4HXPA 5E9YA 2R0VA 4O75A 5KHMA 4CLBA 3I3JA 4LZRA 5FH8A 5D26A 5D3NA 2DWWA 3D1BA 2R0SA 5D3RA 4YYJA 4WHUA 3UV4A 4PS5A 4NS5A 4MEPA 5CQAA 4J0RA 4YBMA 5KO4A 4YH4A 5FH7A 5HEMA 5A7CA 3Q2EA 4YBTA 2R10A 4PKLA 4HXRA 5HRWA 3IU5A 4NUCA 4ZQLA 4MEOA 4QC1A 1JSPB 4YH3A 3P1DA 5K29A 3P1FA 5DFCA 5CUCA 3NXBA 4OUFA 5CS8A 4XUAA 5HJCA 5D3PA 5IGMA 3ERRA 4LYWA 5G4RA 5II1A 5C87A 5A81A 5FE4A 2YQDA 5ENFA 4HXSA 2OO1A 5F60A 4YY6A 4CL9A 5ENCA 4A9JA 5I1QA 4NRBA 2YW5A 2YDWA 5DYAA 4IOOA 5I83A 3UVWA 5EV9A 4YYNA 4UITA 4PCIA 5CQ4A 4IORA 4O76A 4NR4A 4QSSA 5COIA 4O7AA 2KTBB 3GG3A 5EPBA 4O70A 2OUOA 5D3TA 4YC9A 5AD3A 4HXOA 4QZSA 4X2IA 3S91A 5DW2A 5EGUA 5L97A 5CQ8A 2YEMA 5DKCA 4UIZA 4O71A 4PTBA 4MR4A 5I88A 4HXNA 3S92A 4TS8A 5KU3A 5DX4A 5J0DA 5EWWA 2RI7A 5D3LA 4C66A 4KCXA 3IU6A 5CPEA 4A9KA 2GRCA 2F6NA 4O7FA 5CY9A 5EP7A 5FB1A 5HQ5A 3JVJA 3LQIA 4XY8A 4A9HA 3O33A 4UYDA 5KTWA 4QYDA 3D7CA 4YY4A 4Z6IA 5D24A 3SVHA 5EI4A 3O37A 5CUAA 5FG6A 5ENIA 4A9EA 3D1DA 2D82A 4TZ8A 3MQMA 5FFWA 4CURA 3MB3A 4YYGA 5HLSA 4BW2A 2DVVA 4UYFB 3LJWA 5LKZA 5DKHA 2DVQA 4TU4A 5KTUA 2G4AA 4Q0NA 5EU1A 2R0YA 3LQHA 5F62A 5F2PA 3DWYA 5EWCA 4MR5A 5A85A 2RNWA 5I7YA 4HBWA 4TYLA 2FSAA 5D3JA 4HBVA 1N72A 5E73A 5EWHA 5TCMA 5AD2A 4O7EA 4FLPA 2YELA 4YYKA 4GPJA 5E7DA 3P1EA 3JVLA 4NYWA 5EVAA 4LR6A 5F3AA 4WIVA 4O78A 4QR3A 5L8TA 4AI6A 3UV5A 5ENHA 5CGPA 4CUTA 4DONA 3HMFA 3MULA 5A5RA 5CQ6A 4YADA 4RVRA 3JVMA 4QUTA 4NUDA 5DFBA 5HELA 5LJ1A 4YYIA 5AMEA 5DYCA 1F68A 4A9IA 1WUMA 5F61A 5I80A 5DW1A 4BW3A 4QYLA 4IOQA 5AMFA 5FH6A 5FDZA 5I86A 4LC2A 4QSWA 4QSPA 5D3SA 5I40A 5IIDA 4QSVA 5H1VA 4LZ2A 2DVRA 3RCWA 3SVGA 5H1UA 5IGKA 5BT3A 4NXJA 4LZSA 4Z93A 1PUOA 5A5PA 5BT5A 5CQ3A 1ZS5A 3K2JA 5HRXA 4YATA 5TB6A 4YABA 5F36A 4TT4A 4UYGA 4AKNA 4CFLA 1EQFA 5A82A 3U5PA 4MR3A 2L85A 3ZYUA 2EJNA 4OGIA 5D25A 4NR6A 5CQ7A 3MB4A 2E7OA 4Z1QA 1X0JA 3LXJA 4A9FA 3QZTA 5CRMA 4LYSA 3MUKA 5L99A 4IR5A 5EPRA 5E9IA 5H1TA 4O74A 4QBMA 3HMHA 3U5OA 4AKIA 4N4HA 5FE8A 3LQJA 5I89A 5ENJA 3O34A 4HXMA 3O36A 4UYFA 4E96A 4QEWA 3UV2A 5CP5A 3FKMX 4BW1A 4Z1SA 5FE2A 5IGNA 4N4FA 5D7XA 5KTXA 4MENA 5I7XA 5EPSA 4CUUA 5CUEA 5HENA 3VKHA 3TLPA 4O7CA 4ZC9A 4N4GA 5FE7A 4UIXA 5FB0A 4PY6A 4YYHA 4KV4A 5DBMA 4A9LA 2DKWA 5L96A 5LUUA 5G4SA 4BW4A 2LSPB 4N4IA 4IR4A 3JVKA 4CFKA 5DLZA 5I29A 2E7NA 4AKHA 5FE0A 5FE5A 5HCLA 4XYAA 2E3KA 4IR3A 5L8UA 5EISA 5IG6A 5HQ7A 5A5NA 4QB3A 4O72A 4QY4A 5LKUA 2F6JA 4NQMA 5D0CA 5EICA 5ETDA 5F63A 4BHWA 4QNSA 4KV1A 2I8NA 5DY7A 4A9MA 1ZKRA 4A9NA 4TT2A 5E74A 4LYIA 5BT4A 2MJVB 2L5EA 5ENBA 3G0LA 4PCEA 4YK0A 5FBXA 4OGJA 5CUDA 4QR5A 3AADA 4QC3A 5EK9A 5IGLA 4NRCA 2RS9B 4TU6A 5HFQA 5JI8A 3Q2FA 3ONIA 5FE9A 5EWVA 2RFJA 4WHWA 5EM3A 3UW9A 4N3WA 5ETBA 4O7BA 5CU8A 4XY9A 5C89A 4QSXA 3G0JA 5FE3A 4QEVA 5E9LA 3U5KA 2WP1A 5JWMA 5L98A 4J3IA 5E9KA 5EWDA 5ACYA 2N9GA 1WUGA 1E6IA 4AKGA 5C4QA 4YBSA 4UIVA 4O77A 4Q0OA 5FG4A 5F1HA 4C67A 4MEQA 4IR6A 5A5QA 4TZ2A 5FE6A 3P1CA 3U5MA 5HRVA 4TT6A 3UVXA 4QR4A 5FFYA 5C85A 5C8GA 5FE1A 5LJ2A 5CRZA 3QZSA 4J1PA 2D9EA 5A5SA 4UIYA 4TTEA 4NR7A 5ENEA 3UVDA 4QSTA 5E3GA 3VKGA 2DVSA 5H85A 4ALGA 4HXKA 5DYUA 4NYXA 4NUEA 5F25A 4Z6HA 5IBNA 5E9VA 5E3DA 4NQNA 4QSQA 5LKTA 3HMEA 5CFWA 2RNXA 3O35A 5E9MA 4YYDA 1JM4B 4CUPA 2L84A 4J0SA 5LVRA 3MXFA 3P5OA 4NR5A 5EQ1A 5CQTA 5DYXA 4F3IA 5LVQA 4QEUA 4YAXA 2H60A 4BJXA 4UYEA 4NRAA 5D3HA 4A9OA 5LKXA 2RNYA 4CUSA 3U5NA 5F5ZA 2NXBA 2DATA 4LDFA 4XUBA 5F1LA 4ZW1A 5A5OA 5EA1A 5DLXA 5DKDA 2YEKA 4MR6A 2I7KA 5CZGA 4NR9A 4UYHA 3SVFA 5CUGA 5HFRA 4UIWA 4UIUA 4QUUA 5LJ0A 4HBXA 5ENGA 5II2A 5HQ6A 2WP2A 5CQ5A 4TQNA 5HM0A 5E0RA 2OSSA 3AQAA 5CUBA 3U5JA 2RO1A 3QZVA 4HBYA 4CUQA
chains in the Genus database with same CATH topology
3UVYA 4ALHA 5FFVA 4HXLA 4NYVA 4LRGA 3U5LA 3DAIA 4Y03A 5C7NA 5FG5A 5CTLA 5DFDA 4QSUA 2YYNA 5A83A 4NR8A 4YYMA 4QSRA 4HXPA 5E9YA 2R0VA 4O75A 5KHMA 4CLBA 3I3JA 4LZRA 5FH8A 5D26A 5D3NA 2DWWA 2R0SA 5D3RA 4YYJA 4WHUA 3UV4A 4PS5A 4NS5A 4MEPA 5CQAA 4J0RA 4YBMA 5KO4A 4YH4A 5FH7A 5HEMA 5A7CA 3Q2EA 4YBTA 2R10A 4PKLA 4HXRA 5HRWA 3IU5A 4NUCA 4ZQLA 4MEOA 4QC1A 1JSPB 4YH3A 3P1DA 5K29A 3P1FA 5DFCA 5CUCA 3NXBA 4OUFA 5CS8A 4XUAA 5HJCA 5D3PA 5IGMA 4LYWA 5G4RA 5II1A 5C87A 5A81A 5FE4A 2YQDA 5ENFA 4HXSA 2OO1A 5F60A 4YY6A 4CL9A 5ENCA 4A9JA 5I1QA 4NRBA 2YW5A 2YDWA 5DYAA 4IOOA 5I83A 3UVWA 5EV9A 4YYNA 4UITA 4PCIA 5CQ4A 4IORA 4O76A 4NR4A 4QSSA 5COIA 4O7AA 2KTBB 3GG3A 5EPBA 4O70A 2OUOA 5D3TA 4YC9A 5AD3A 4HXOA 4QZSA 4X2IA 3S91A 5DW2A 5EGUA 5L97A 5CQ8A 2YEMA 5DKCA 4UIZA 4O71A 4PTBA 4MR4A 5I88A 4HXNA 3S92A 4TS8A 5KU3A 5DX4A 5J0DA 5EWWA 2RI7A 5D3LA 4C66A 4KCXA 3IU6A 5CPEA 4A9KA 2GRCA 2F6NA 4O7FA 5CY9A 5EP7A 5FB1A 5HQ5A 3JVJA 3LQIA 4XY8A 4A9HA 3O33A 4UYDA 5KTWA 4QYDA 3D7CA 4YY4A 4Z6IA 5D24A 3SVHA 5EI4A 3O37A 5CUAA 5FG6A 5ENIA 4A9EA 2D82A 4TZ8A 3MQMA 5FFWA 4CURA 3MB3A 4YYGA 5HLSA 4BW2A 2DVVA 4UYFB 3LJWA 5LKZA 5DKHA 2DVQA 4TU4A 5KTUA 2G4AA 4Q0NA 5EU1A 2R0YA 3LQHA 5F62A 5F2PA 3DWYA 5EWCA 4MR5A 5A85A 2RNWA 5I7YA 4HBWA 4TYLA 2FSAA 5D3JA 4HBVA 1N72A 5E73A 5EWHA 5TCMA 5AD2A 4O7EA 4FLPA 2YELA 4YYKA 4GPJA 5E7DA 3P1EA 3JVLA 4NYWA 5EVAA 4LR6A 5F3AA 4WIVA 4O78A 4QR3A 5L8TA 3UV5A 5ENHA 5CGPA 4CUTA 4DONA 3HMFA 3MULA 5A5RA 5CQ6A 4YADA 4RVRA 3JVMA 4QUTA 4NUDA 5DFBA 5HELA 5LJ1A 4YYIA 5AMEA 5DYCA 1F68A 4A9IA 1WUMA 5F61A 5I80A 5DW1A 4BW3A 4QYLA 4IOQA 5AMFA 5FH6A 5FDZA 5I86A 4LC2A 4QSWA 4QSPA 5D3SA 5I40A 5IIDA 4QSVA 5H1VA 4LZ2A 2DVRA 3RCWA 3SVGA 5H1UA 5IGKA 5BT3A 4NXJA 4LZSA 4Z93A 5BT5A 5A5PA 5CQ3A 1ZS5A 3K2JA 5HRXA 4YATA 5TB6A 4YABA 5F36A 4TT4A 4UYGA 4AKNA 4CFLA 1EQFA 5A82A 3U5PA 4MR3A 2L85A 3ZYUA 4OGIA 5D25A 4NR6A 5CQ7A 3MB4A 2E7OA 4Z1QA 1X0JA 3LXJA 4A9FA 3QZTA 5CRMA 4LYSA 3MUKA 5L99A 4IR5A 5EPRA 5E9IA 5H1TA 4O74A 4QBMA 3HMHA 3U5OA 4N4HA 5FE8A 3LQJA 5I89A 5ENJA 3O34A 4HXMA 3O36A 4UYFA 4E96A 4QEWA 3UV2A 5CP5A 3FKMX 4BW1A 4Z1SA 5FE2A 5IGNA 4N4FA 5D7XA 5KTXA 4MENA 5I7XA 5EPSA 4CUUA 5CUEA 5HENA 3TLPA 4O7CA 4ZC9A 4N4GA 5FE7A 4UIXA 5FB0A 4PY6A 4YYHA 4KV4A 5DBMA 4A9LA 2DKWA 5L96A 5LUUA 5G4SA 4BW4A 2LSPB 4N4IA 4IR4A 3JVKA 4CFKA 5DLZA 5I29A 2E7NA 5FE0A 5FE5A 5HCLA 4XYAA 2E3KA 4IR3A 5L8UA 5EISA 5IG6A 5HQ7A 5A5NA 4QB3A 4O72A 4QY4A 5LKUA 2F6JA 4NQMA 5D0CA 5EICA 5ETDA 5F63A 4BHWA 4QNSA 4KV1A 2I8NA 5DY7A 4A9MA 4A9NA 4TT2A 5E74A 4LYIA 5BT4A 2MJVB 2L5EA 5ENBA 3G0LA 4PCEA 4YK0A 5FBXA 4OGJA 5CUDA 4QR5A 3AADA 4QC3A 5EK9A 5IGLA 4NRCA 2RS9B 4TU6A 5HFQA 5JI8A 3Q2FA 3ONIA 5FE9A 5EWVA 2RFJA 4WHWA 5EM3A 3UW9A 4N3WA 5ETBA 4O7BA 5CU8A 4XY9A 5C89A 4QSXA 3G0JA 5FE3A 4QEVA 5E9LA 3U5KA 2WP1A 5JWMA 5L98A 4J3IA 5E9KA 5EWDA 5ACYA 2N9GA 1WUGA 1E6IA 5C4QA 4YBSA 4UIVA 4O77A 4Q0OA 5FG4A 5F1HA 4C67A 4MEQA 4IR6A 5A5QA 4TZ2A 5FE6A 3P1CA 3U5MA 5HRVA 4TT6A 3UVXA 4QR4A 5FFYA 5C85A 5C8GA 5FE1A 5LJ2A 5CRZA 3QZSA 4J1PA 2D9EA 5A5SA 4UIYA 4TTEA 4NR7A 5ENEA 3UVDA 4QSTA 5E3GA 2DVSA 5H85A 4ALGA 4HXKA 5DYUA 4NYXA 4NUEA 5F25A 4Z6HA 5IBNA 5E9VA 5E3DA 4NQNA 4QSQA 5LKTA 3HMEA 5CFWA 2RNXA 3O35A 5E9MA 4YYDA 1JM4B 4CUPA 2L84A 4J0SA 5LVRA 3MXFA 3P5OA 4NR5A 5EQ1A 5CQTA 5DYXA 4F3IA 5LVQA 4QEUA 4YAXA 2H60A 4BJXA 4UYEA 4NRAA 5D3HA 4A9OA 5LKXA 2RNYA 4CUSA 3U5NA 5F5ZA 2NXBA 2DATA 4LDFA 4XUBA 5F1LA 4ZW1A 5A5OA 5EA1A 5DLXA 5DKDA 2YEKA 4MR6A 2I7KA 5CZGA 4NR9A 4UYHA 3SVFA 5CUGA 5HFRA 4UIWA 4UIUA 4QUUA 5LJ0A 4HBXA 5ENGA 5II2A 5HQ6A 2WP2A 5CQ5A 4TQNA 5HM0A 5E0RA 2OSSA 3AQAA 5CUBA 3U5JA 2RO1A 3QZVA 4HBYA 4CUQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UVY A;  4ALH A;  5FFV A;  4HXL A;  4NYV A;  4LRG A;  3U5L A;  3DAI A;  4Y03 A;  5C7N A;  5FG5 A;  5CTL A;  5DFD A;  4QSU A;  2YYN A;  5A83 A;  4NR8 A;  4YYM A;  4QSR A;  4HXP A;  5E9Y A;  2R0V A;  4O75 A;  5KHM A;  4CLB A;  3I3J A;  4LZR A;  5FH8 A;  5D26 A;  5D3N A;  2DWW A;  2R0S A;  5D3R A;  4YYJ A;  4WHU A;  3UV4 A;  4PS5 A;  4NS5 A;  4MEP A;  5CQA A;  4J0R A;  4YBM A;  5KO4 A;  4YH4 A;  5FH7 A;  5HEM A;  5A7C A;  3Q2E A;  4YBT A;  2R10 A;  4PKL A;  4HXR A;  5HRW A;  3IU5 A;  4NUC A;  4ZQL A;  4MEO A;  4QC1 A;  1JSP B;  4YH3 A;  3P1D A;  5K29 A;  3P1F A;  5DFC A;  5CUC A;  3NXB A;  4OUF A;  5CS8 A;  4XUA A;  5HJC A;  5D3P A;  5IGM A;  4LYW A;  5G4R A;  5II1 A;  5C87 A;  5A81 A;  5FE4 A;  2YQD A;  5ENF A;  4HXS A;  2OO1 A;  5F60 A;  4YY6 A;  4CL9 A;  5ENC A;  4A9J A;  5I1Q A;  4NRB A;  2YW5 A;  2YDW A;  5DYA A;  4IOO A;  5I83 A;  3UVW A;  5EV9 A;  4YYN A;  4UIT A;  4PCI A;  5CQ4 A;  4IOR A;  4O76 A;  4NR4 A;  4QSS A;  5COI A;  4O7A A;  2KTB B;  3GG3 A;  5EPB A;  4O70 A;  2OUO A;  5D3T A;  4YC9 A;  5AD3 A;  4HXO A;  4QZS A;  4X2I A;  3S91 A;  5DW2 A;  5EGU A;  5L97 A;  5CQ8 A;  2YEM A;  5DKC A;  4UIZ A;  4O71 A;  4PTB A;  4MR4 A;  5I88 A;  4HXN A;  3S92 A;  4TS8 A;  5KU3 A;  5DX4 A;  5J0D A;  5EWW A;  2RI7 A;  5D3L A;  4C66 A;  4KCX A;  3IU6 A;  5CPE A;  4A9K A;  2GRC A;  2F6N A;  4O7F A;  5CY9 A;  5EP7 A;  5FB1 A;  5HQ5 A;  3JVJ A;  3LQI A;  4XY8 A;  4A9H A;  3O33 A;  4UYD A;  5KTW A;  4QYD A;  3D7C A;  4YY4 A;  4Z6I A;  5D24 A;  3SVH A;  5EI4 A;  3O37 A;  5CUA A;  5FG6 A;  5ENI A;  4A9E A;  2D82 A;  4TZ8 A;  3MQM A;  5FFW A;  4CUR A;  3MB3 A;  4YYG A;  5HLS A;  4BW2 A;  2DVV A;  4UYF B;  3LJW A;  5LKZ A;  5DKH A;  2DVQ A;  4TU4 A;  5KTU A;  2G4A A;  4Q0N A;  5EU1 A;  2R0Y A;  3LQH A;  5F62 A;  5F2P A;  3DWY A;  5EWC A;  4MR5 A;  5A85 A;  2RNW A;  5I7Y A;  4HBW A;  4TYL A;  2FSA A;  5D3J A;  4HBV A;  1N72 A;  5E73 A;  5EWH A;  5TCM A;  5AD2 A;  4O7E A;  4FLP A;  2YEL A;  4YYK A;  4GPJ A;  5E7D A;  3P1E A;  3JVL A;  4NYW A;  5EVA A;  4LR6 A;  5F3A A;  4WIV A;  4O78 A;  4QR3 A;  5L8T A;  3UV5 A;  5ENH A;  5CGP A;  4CUT A;  4DON A;  3HMF A;  3MUL A;  5A5R A;  5CQ6 A;  4YAD A;  4RVR A;  3JVM A;  4QUT A;  4NUD A;  5DFB A;  5HEL A;  5LJ1 A;  4YYI A;  5AME A;  5DYC A;  1F68 A;  4A9I A;  1WUM A;  5F61 A;  5I80 A;  5DW1 A;  4BW3 A;  4QYL A;  4IOQ A;  5AMF A;  5FH6 A;  5FDZ A;  5I86 A;  4LC2 A;  4QSW A;  4QSP A;  5D3S A;  5I40 A;  5IID A;  4QSV A;  5H1V A;  4LZ2 A;  2DVR A;  3RCW A;  3SVG A;  5H1U A;  5IGK A;  5BT3 A;  4NXJ A;  4LZS A;  4Z93 A;  5BT5 A;  5A5P A;  5CQ3 A;  1ZS5 A;  3K2J A;  5HRX A;  4YAT A;  5TB6 A;  4YAB A;  5F36 A;  4TT4 A;  4UYG A;  4AKN A;  4CFL A;  1EQF A;  5A82 A;  3U5P A;  4MR3 A;  2L85 A;  3ZYU A;  4OGI A;  5D25 A;  4NR6 A;  5CQ7 A;  3MB4 A;  2E7O A;  4Z1Q A;  1X0J A;  3LXJ A;  4A9F A;  3QZT A;  5CRM A;  4LYS A;  3MUK A;  5L99 A;  4IR5 A;  5EPR A;  5E9I A;  5H1T A;  4O74 A;  4QBM A;  3HMH A;  3U5O A;  4N4H A;  5FE8 A;  3LQJ A;  5I89 A;  5ENJ A;  3O34 A;  4HXM A;  3O36 A;  4UYF A;  4E96 A;  4QEW A;  3UV2 A;  5CP5 A;  3FKM X;  4BW1 A;  4Z1S A;  5FE2 A;  5IGN A;  4N4F A;  5D7X A;  5KTX A;  4MEN A;  5I7X A;  5EPS A;  4CUU A;  5CUE A;  5HEN A;  3TLP A;  4O7C A;  4ZC9 A;  4N4G A;  5FE7 A;  4UIX A;  5FB0 A;  4PY6 A;  4YYH A;  4KV4 A;  5DBM A;  4A9L A;  2DKW A;  5L96 A;  5LUU A;  5G4S A;  4BW4 A;  2LSP B;  4N4I A;  4IR4 A;  3JVK A;  4CFK A;  5DLZ A;  5I29 A;  2E7N A;  5FE0 A;  5FE5 A;  5HCL A;  4XYA A;  2E3K A;  4IR3 A;  5L8U A;  5EIS A;  5IG6 A;  5HQ7 A;  5A5N A;  4QB3 A;  4O72 A;  4QY4 A;  5LKU A;  2F6J A;  4NQM A;  5D0C A;  5EIC A;  5ETD A;  5F63 A;  4BHW A;  4QNS A;  4KV1 A;  2I8N A;  5DY7 A;  4A9M A;  4A9N A;  4TT2 A;  5E74 A;  4LYI A;  5BT4 A;  2MJV B;  2L5E A;  5ENB A;  3G0L A;  4PCE A;  4YK0 A;  5FBX A;  4OGJ A;  5CUD A;  4QR5 A;  3AAD A;  4QC3 A;  5EK9 A;  5IGL A;  4NRC A;  2RS9 B;  4TU6 A;  5HFQ A;  5JI8 A;  3Q2F A;  3ONI A;  5FE9 A;  5EWV A;  2RFJ A;  4WHW A;  5EM3 A;  3UW9 A;  4N3W A;  5ETB A;  4O7B A;  5CU8 A;  4XY9 A;  5C89 A;  4QSX A;  3G0J A;  5FE3 A;  4QEV A;  5E9L A;  3U5K A;  2WP1 A;  5JWM A;  5L98 A;  4J3I A;  5E9K A;  5EWD A;  5ACY A;  2N9G A;  1WUG A;  1E6I A;  5C4Q A;  4YBS A;  4UIV A;  4O77 A;  4Q0O A;  5FG4 A;  5F1H A;  4C67 A;  4MEQ A;  4IR6 A;  5A5Q A;  4TZ2 A;  5FE6 A;  3P1C A;  3U5M A;  5HRV A;  4TT6 A;  3UVX A;  4QR4 A;  5FFY A;  5C85 A;  5C8G A;  5FE1 A;  5LJ2 A;  5CRZ A;  3QZS A;  4J1P A;  2D9E A;  5A5S A;  4UIY A;  4TTE A;  4NR7 A;  5ENE A;  3UVD A;  4QST A;  5E3G A;  2DVS A;  5H85 A;  4ALG A;  4HXK A;  5DYU A;  4NYX A;  4NUE A;  5F25 A;  4Z6H A;  5IBN A;  5E9V A;  5E3D A;  4NQN A;  4QSQ A;  5LKT A;  3HME A;  5CFW A;  2RNX A;  3O35 A;  5E9M A;  4YYD A;  1JM4 B;  4CUP A;  2L84 A;  4J0S A;  5LVR A;  3MXF A;  3P5O A;  4NR5 A;  5EQ1 A;  5CQT A;  5DYX A;  4F3I A;  5LVQ A;  4QEU A;  4YAX A;  2H60 A;  4BJX A;  4UYE A;  4NRA A;  5D3H A;  4A9O A;  5LKX A;  2RNY A;  4CUS A;  3U5N A;  5F5Z A;  2NXB A;  2DAT A;  4LDF A;  4XUB A;  5F1L A;  4ZW1 A;  5A5O A;  5EA1 A;  5DLX A;  5DKD A;  2YEK A;  4MR6 A;  2I7K A;  5CZG A;  4NR9 A;  4UYH A;  3SVF A;  5CUG A;  5HFR A;  4UIW A;  4UIU A;  4QUU A;  5LJ0 A;  4HBX A;  5ENG A;  5II2 A;  5HQ6 A;  2WP2 A;  5CQ5 A;  4TQN A;  5HM0 A;  5E0R A;  2OSS A;  3AQA A;  5CUB A;  3U5J A;  2RO1 A;  3QZV A;  4HBY A;  4CUQ A; 
#chains in the Genus database with same CATH topology
 3UVY A;  4ALH A;  5FFV A;  4HXL A;  4NYV A;  4LRG A;  3U5L A;  3DAI A;  4Y03 A;  5C7N A;  5FG5 A;  5CTL A;  5DFD A;  4QSU A;  2YYN A;  5A83 A;  4NR8 A;  4YYM A;  4QSR A;  4HXP A;  5E9Y A;  2R0V A;  4O75 A;  5KHM A;  4CLB A;  3I3J A;  4LZR A;  5FH8 A;  5D26 A;  5D3N A;  2DWW A;  3D1B A;  2R0S A;  5D3R A;  4YYJ A;  4WHU A;  3UV4 A;  4PS5 A;  4NS5 A;  4MEP A;  5CQA A;  4J0R A;  4YBM A;  5KO4 A;  4YH4 A;  5FH7 A;  5HEM A;  5A7C A;  3Q2E A;  4YBT A;  2R10 A;  4PKL A;  4HXR A;  5HRW A;  3IU5 A;  4NUC A;  4ZQL A;  4MEO A;  4QC1 A;  1JSP B;  4YH3 A;  3P1D A;  5K29 A;  3P1F A;  5DFC A;  5CUC A;  3NXB A;  4OUF A;  5CS8 A;  4XUA A;  5HJC A;  5D3P A;  5IGM A;  3ERR A;  4LYW A;  5G4R A;  5II1 A;  5C87 A;  5A81 A;  5FE4 A;  2YQD A;  5ENF A;  4HXS A;  2OO1 A;  5F60 A;  4YY6 A;  4CL9 A;  5ENC A;  4A9J A;  5I1Q A;  4NRB A;  2YW5 A;  2YDW A;  5DYA A;  4IOO A;  5I83 A;  3UVW A;  5EV9 A;  4YYN A;  4UIT A;  4PCI A;  5CQ4 A;  4IOR A;  4O76 A;  4NR4 A;  4QSS A;  5COI A;  4O7A A;  2KTB B;  3GG3 A;  5EPB A;  4O70 A;  2OUO A;  5D3T A;  4YC9 A;  5AD3 A;  4HXO A;  4QZS A;  4X2I A;  3S91 A;  5DW2 A;  5EGU A;  5L97 A;  5CQ8 A;  2YEM A;  5DKC A;  4UIZ A;  4O71 A;  4PTB A;  4MR4 A;  5I88 A;  4HXN A;  3S92 A;  4TS8 A;  5KU3 A;  5DX4 A;  5J0D A;  5EWW A;  2RI7 A;  5D3L A;  4C66 A;  4KCX A;  3IU6 A;  5CPE A;  4A9K A;  2GRC A;  2F6N A;  4O7F A;  5CY9 A;  5EP7 A;  5FB1 A;  5HQ5 A;  3JVJ A;  3LQI A;  4XY8 A;  4A9H A;  3O33 A;  4UYD A;  5KTW A;  4QYD A;  3D7C A;  4YY4 A;  4Z6I A;  5D24 A;  3SVH A;  5EI4 A;  3O37 A;  5CUA A;  5FG6 A;  5ENI A;  4A9E A;  3D1D A;  2D82 A;  4TZ8 A;  3MQM A;  5FFW A;  4CUR A;  3MB3 A;  4YYG A;  5HLS A;  4BW2 A;  2DVV A;  4UYF B;  3LJW A;  5LKZ A;  5DKH A;  2DVQ A;  4TU4 A;  5KTU A;  2G4A A;  4Q0N A;  5EU1 A;  2R0Y A;  3LQH A;  5F62 A;  5F2P A;  3DWY A;  5EWC A;  4MR5 A;  5A85 A;  2RNW A;  5I7Y A;  4HBW A;  4TYL A;  2FSA A;  5D3J A;  4HBV A;  1N72 A;  5E73 A;  5EWH A;  5TCM A;  5AD2 A;  4O7E A;  4FLP A;  2YEL A;  4YYK A;  4GPJ A;  5E7D A;  3P1E A;  3JVL A;  4NYW A;  5EVA A;  4LR6 A;  5F3A A;  4WIV A;  4O78 A;  4QR3 A;  5L8T A;  4AI6 A;  3UV5 A;  5ENH A;  5CGP A;  4CUT A;  4DON A;  3HMF A;  3MUL A;  5A5R A;  5CQ6 A;  4YAD A;  4RVR A;  3JVM A;  4QUT A;  4NUD A;  5DFB A;  5HEL A;  5LJ1 A;  4YYI A;  5AME A;  5DYC A;  1F68 A;  4A9I A;  1WUM A;  5F61 A;  5I80 A;  5DW1 A;  4BW3 A;  4QYL A;  4IOQ A;  5AMF A;  5FH6 A;  5FDZ A;  5I86 A;  4LC2 A;  4QSW A;  4QSP A;  5D3S A;  5I40 A;  5IID A;  4QSV A;  5H1V A;  4LZ2 A;  2DVR A;  3RCW A;  3SVG A;  5H1U A;  5IGK A;  5BT3 A;  4NXJ A;  4LZS A;  4Z93 A;  1PUO A;  5A5P A;  5BT5 A;  5CQ3 A;  1ZS5 A;  3K2J A;  5HRX A;  4YAT A;  5TB6 A;  4YAB A;  5F36 A;  4TT4 A;  4UYG A;  4AKN A;  4CFL A;  1EQF A;  5A82 A;  3U5P A;  4MR3 A;  2L85 A;  3ZYU A;  2EJN A;  4OGI A;  5D25 A;  4NR6 A;  5CQ7 A;  3MB4 A;  2E7O A;  4Z1Q A;  1X0J A;  3LXJ A;  4A9F A;  3QZT A;  5CRM A;  4LYS A;  3MUK A;  5L99 A;  4IR5 A;  5EPR A;  5E9I A;  5H1T A;  4O74 A;  4QBM A;  3HMH A;  3U5O A;  4AKI A;  4N4H A;  5FE8 A;  3LQJ A;  5I89 A;  5ENJ A;  3O34 A;  4HXM A;  3O36 A;  4UYF A;  4E96 A;  4QEW A;  3UV2 A;  5CP5 A;  3FKM X;  4BW1 A;  4Z1S A;  5FE2 A;  5IGN A;  4N4F A;  5D7X A;  5KTX A;  4MEN A;  5I7X A;  5EPS A;  4CUU A;  5CUE A;  5HEN A;  3VKH A;  3TLP A;  4O7C A;  4ZC9 A;  4N4G A;  5FE7 A;  4UIX A;  5FB0 A;  4PY6 A;  4YYH A;  4KV4 A;  5DBM A;  4A9L A;  2DKW A;  5L96 A;  5LUU A;  5G4S A;  4BW4 A;  2LSP B;  4N4I A;  4IR4 A;  3JVK A;  4CFK A;  5DLZ A;  5I29 A;  2E7N A;  4AKH A;  5FE0 A;  5FE5 A;  5HCL A;  4XYA A;  2E3K A;  4IR3 A;  5L8U A;  5EIS A;  5IG6 A;  5HQ7 A;  5A5N A;  4QB3 A;  4O72 A;  4QY4 A;  5LKU A;  2F6J A;  4NQM A;  5D0C A;  5EIC A;  5ETD A;  5F63 A;  4BHW A;  4QNS A;  4KV1 A;  2I8N A;  5DY7 A;  4A9M A;  1ZKR A;  4A9N A;  4TT2 A;  5E74 A;  4LYI A;  5BT4 A;  2MJV B;  2L5E A;  5ENB A;  3G0L A;  4PCE A;  4YK0 A;  5FBX A;  4OGJ A;  5CUD A;  4QR5 A;  3AAD A;  4QC3 A;  5EK9 A;  5IGL A;  4NRC A;  2RS9 B;  4TU6 A;  5HFQ A;  5JI8 A;  3Q2F A;  3ONI A;  5FE9 A;  5EWV A;  2RFJ A;  4WHW A;  5EM3 A;  3UW9 A;  4N3W A;  5ETB A;  4O7B A;  5CU8 A;  4XY9 A;  5C89 A;  4QSX A;  3G0J A;  5FE3 A;  4QEV A;  5E9L A;  3U5K A;  2WP1 A;  5JWM A;  5L98 A;  4J3I A;  5E9K A;  5EWD A;  5ACY A;  2N9G A;  1WUG A;  1E6I A;  4AKG A;  5C4Q A;  4YBS A;  4UIV A;  4O77 A;  4Q0O A;  5FG4 A;  5F1H A;  4C67 A;  4MEQ A;  4IR6 A;  5A5Q A;  4TZ2 A;  5FE6 A;  3P1C A;  3U5M A;  5HRV A;  4TT6 A;  3UVX A;  4QR4 A;  5FFY A;  5C85 A;  5C8G A;  5FE1 A;  5LJ2 A;  5CRZ A;  3QZS A;  4J1P A;  2D9E A;  5A5S A;  4UIY A;  4TTE A;  4NR7 A;  5ENE A;  3UVD A;  4QST A;  5E3G A;  3VKG A;  2DVS A;  5H85 A;  4ALG A;  4HXK A;  5DYU A;  4NYX A;  4NUE A;  5F25 A;  4Z6H A;  5IBN A;  5E9V A;  5E3D A;  4NQN A;  4QSQ A;  5LKT A;  3HME A;  5CFW A;  2RNX A;  3O35 A;  5E9M A;  4YYD A;  1JM4 B;  4CUP A;  2L84 A;  4J0S A;  5LVR A;  3MXF A;  3P5O A;  4NR5 A;  5EQ1 A;  5CQT A;  5DYX A;  4F3I A;  5LVQ A;  4QEU A;  4YAX A;  2H60 A;  4BJX A;  4UYE A;  4NRA A;  5D3H A;  4A9O A;  5LKX A;  2RNY A;  4CUS A;  3U5N A;  5F5Z A;  2NXB A;  2DAT A;  4LDF A;  4XUB A;  5F1L A;  4ZW1 A;  5A5O A;  5EA1 A;  5DLX A;  5DKD A;  2YEK A;  4MR6 A;  2I7K A;  5CZG A;  4NR9 A;  4UYH A;  3SVF A;  5CUG A;  5HFR A;  4UIW A;  4UIU A;  4QUU A;  5LJ0 A;  4HBX A;  5ENG A;  5II2 A;  5HQ6 A;  2WP2 A;  5CQ5 A;  4TQN A;  5HM0 A;  5E0R A;  2OSS A;  3AQA A;  5CUB A;  3U5J A;  2RO1 A;  3QZV A;  4HBY A;  4CUQ A; 
#chains in the Genus database with same CATH homology
 3UVY A;  4ALH A;  5FFV A;  4HXL A;  4NYV A;  4LRG A;  3U5L A;  3DAI A;  4Y03 A;  5C7N A;  5FG5 A;  5CTL A;  5DFD A;  4QSU A;  2YYN A;  5A83 A;  4NR8 A;  4YYM A;  4QSR A;  4HXP A;  5E9Y A;  2R0V A;  4O75 A;  5KHM A;  4CLB A;  3I3J A;  4LZR A;  5FH8 A;  5D26 A;  5D3N A;  2DWW A;  2R0S A;  5D3R A;  4YYJ A;  4WHU A;  3UV4 A;  4PS5 A;  4NS5 A;  4MEP A;  5CQA A;  4J0R A;  4YBM A;  5KO4 A;  4YH4 A;  5FH7 A;  5HEM A;  5A7C A;  3Q2E A;  4YBT A;  2R10 A;  4PKL A;  4HXR A;  5HRW A;  3IU5 A;  4NUC A;  4ZQL A;  4MEO A;  4QC1 A;  1JSP B;  4YH3 A;  3P1D A;  5K29 A;  3P1F A;  5DFC A;  5CUC A;  3NXB A;  4OUF A;  5CS8 A;  4XUA A;  5HJC A;  5D3P A;  5IGM A;  4LYW A;  5G4R A;  5II1 A;  5C87 A;  5A81 A;  5FE4 A;  2YQD A;  5ENF A;  4HXS A;  2OO1 A;  5F60 A;  4YY6 A;  4CL9 A;  5ENC A;  4A9J A;  5I1Q A;  4NRB A;  2YW5 A;  2YDW A;  5DYA A;  4IOO A;  5I83 A;  3UVW A;  5EV9 A;  4YYN A;  4UIT A;  4PCI A;  5CQ4 A;  4IOR A;  4O76 A;  4NR4 A;  4QSS A;  5COI A;  4O7A A;  2KTB B;  3GG3 A;  5EPB A;  4O70 A;  2OUO A;  5D3T A;  4YC9 A;  5AD3 A;  4HXO A;  4QZS A;  4X2I A;  3S91 A;  5DW2 A;  5EGU A;  5L97 A;  5CQ8 A;  2YEM A;  5DKC A;  4UIZ A;  4O71 A;  4PTB A;  4MR4 A;  5I88 A;  4HXN A;  3S92 A;  4TS8 A;  5KU3 A;  5DX4 A;  5J0D A;  5EWW A;  2RI7 A;  5D3L A;  4C66 A;  4KCX A;  3IU6 A;  5CPE A;  4A9K A;  2GRC A;  2F6N A;  4O7F A;  5CY9 A;  5EP7 A;  5FB1 A;  5HQ5 A;  3JVJ A;  3LQI A;  4XY8 A;  4A9H A;  3O33 A;  4UYD A;  5KTW A;  4QYD A;  3D7C A;  4YY4 A;  4Z6I A;  5D24 A;  3SVH A;  5EI4 A;  3O37 A;  5CUA A;  5FG6 A;  5ENI A;  4A9E A;  2D82 A;  4TZ8 A;  3MQM A;  5FFW A;  4CUR A;  3MB3 A;  4YYG A;  5HLS A;  4BW2 A;  2DVV A;  4UYF B;  3LJW A;  5LKZ A;  5DKH A;  2DVQ A;  4TU4 A;  5KTU A;  2G4A A;  4Q0N A;  5EU1 A;  2R0Y A;  3LQH A;  5F62 A;  5F2P A;  3DWY A;  5EWC A;  4MR5 A;  5A85 A;  2RNW A;  5I7Y A;  4HBW A;  4TYL A;  2FSA A;  5D3J A;  4HBV A;  1N72 A;  5E73 A;  5EWH A;  5TCM A;  5AD2 A;  4O7E A;  4FLP A;  2YEL A;  4YYK A;  4GPJ A;  5E7D A;  3P1E A;  3JVL A;  4NYW A;  5EVA A;  4LR6 A;  5F3A A;  4WIV A;  4O78 A;  4QR3 A;  5L8T A;  3UV5 A;  5ENH A;  5CGP A;  4CUT A;  4DON A;  3HMF A;  3MUL A;  5A5R A;  5CQ6 A;  4YAD A;  4RVR A;  3JVM A;  4QUT A;  4NUD A;  5DFB A;  5HEL A;  5LJ1 A;  4YYI A;  5AME A;  5DYC A;  1F68 A;  4A9I A;  1WUM A;  5F61 A;  5I80 A;  5DW1 A;  4BW3 A;  4QYL A;  4IOQ A;  5AMF A;  5FH6 A;  5FDZ A;  5I86 A;  4LC2 A;  4QSW A;  4QSP A;  5D3S A;  5I40 A;  5IID A;  4QSV A;  5H1V A;  4LZ2 A;  2DVR A;  3RCW A;  3SVG A;  5H1U A;  5IGK A;  5BT3 A;  4NXJ A;  4LZS A;  4Z93 A;  5BT5 A;  5A5P A;  5CQ3 A;  1ZS5 A;  3K2J A;  5HRX A;  4YAT A;  5TB6 A;  4YAB A;  5F36 A;  4TT4 A;  4UYG A;  4AKN A;  4CFL A;  1EQF A;  5A82 A;  3U5P A;  4MR3 A;  2L85 A;  3ZYU A;  4OGI A;  5D25 A;  4NR6 A;  5CQ7 A;  3MB4 A;  2E7O A;  4Z1Q A;  1X0J A;  3LXJ A;  4A9F A;  3QZT A;  5CRM A;  4LYS A;  3MUK A;  5L99 A;  4IR5 A;  5EPR A;  5E9I A;  5H1T A;  4O74 A;  4QBM A;  3HMH A;  3U5O A;  4N4H A;  5FE8 A;  3LQJ A;  5I89 A;  5ENJ A;  3O34 A;  4HXM A;  3O36 A;  4UYF A;  4E96 A;  4QEW A;  3UV2 A;  5CP5 A;  3FKM X;  4BW1 A;  4Z1S A;  5FE2 A;  5IGN A;  4N4F A;  5D7X A;  5KTX A;  4MEN A;  5I7X A;  5EPS A;  4CUU A;  5CUE A;  5HEN A;  3TLP A;  4O7C A;  4ZC9 A;  4N4G A;  5FE7 A;  4UIX A;  5FB0 A;  4PY6 A;  4YYH A;  4KV4 A;  5DBM A;  4A9L A;  2DKW A;  5L96 A;  5LUU A;  5G4S A;  4BW4 A;  2LSP B;  4N4I A;  4IR4 A;  3JVK A;  4CFK A;  5DLZ A;  5I29 A;  2E7N A;  5FE0 A;  5FE5 A;  5HCL A;  4XYA A;  2E3K A;  4IR3 A;  5L8U A;  5EIS A;  5IG6 A;  5HQ7 A;  5A5N A;  4QB3 A;  4O72 A;  4QY4 A;  5LKU A;  2F6J A;  4NQM A;  5D0C A;  5EIC A;  5ETD A;  5F63 A;  4BHW A;  4QNS A;  4KV1 A;  2I8N A;  5DY7 A;  4A9M A;  4A9N A;  4TT2 A;  5E74 A;  4LYI A;  5BT4 A;  2MJV B;  2L5E A;  5ENB A;  3G0L A;  4PCE A;  4YK0 A;  5FBX A;  4OGJ A;  5CUD A;  4QR5 A;  3AAD A;  4QC3 A;  5EK9 A;  5IGL A;  4NRC A;  2RS9 B;  4TU6 A;  5HFQ A;  5JI8 A;  3Q2F A;  3ONI A;  5FE9 A;  5EWV A;  2RFJ A;  4WHW A;  5EM3 A;  3UW9 A;  4N3W A;  5ETB A;  4O7B A;  5CU8 A;  4XY9 A;  5C89 A;  4QSX A;  3G0J A;  5FE3 A;  4QEV A;  5E9L A;  3U5K A;  2WP1 A;  5JWM A;  5L98 A;  4J3I A;  5E9K A;  5EWD A;  5ACY A;  2N9G A;  1WUG A;  1E6I A;  5C4Q A;  4YBS A;  4UIV A;  4O77 A;  4Q0O A;  5FG4 A;  5F1H A;  4C67 A;  4MEQ A;  4IR6 A;  5A5Q A;  4TZ2 A;  5FE6 A;  3P1C A;  3U5M A;  5HRV A;  4TT6 A;  3UVX A;  4QR4 A;  5FFY A;  5C85 A;  5C8G A;  5FE1 A;  5LJ2 A;  5CRZ A;  3QZS A;  4J1P A;  2D9E A;  5A5S A;  4UIY A;  4TTE A;  4NR7 A;  5ENE A;  3UVD A;  4QST A;  5E3G A;  2DVS A;  5H85 A;  4ALG A;  4HXK A;  5DYU A;  4NYX A;  4NUE A;  5F25 A;  4Z6H A;  5IBN A;  5E9V A;  5E3D A;  4NQN A;  4QSQ A;  5LKT A;  3HME A;  5CFW A;  2RNX A;  3O35 A;  5E9M A;  4YYD A;  1JM4 B;  4CUP A;  2L84 A;  4J0S A;  5LVR A;  3MXF A;  3P5O A;  4NR5 A;  5EQ1 A;  5CQT A;  5DYX A;  4F3I A;  5LVQ A;  4QEU A;  4YAX A;  2H60 A;  4BJX A;  4UYE A;  4NRA A;  5D3H A;  4A9O A;  5LKX A;  2RNY A;  4CUS A;  3U5N A;  5F5Z A;  2NXB A;  2DAT A;  4LDF A;  4XUB A;  5F1L A;  4ZW1 A;  5A5O A;  5EA1 A;  5DLX A;  5DKD A;  2YEK A;  4MR6 A;  2I7K A;  5CZG A;  4NR9 A;  4UYH A;  3SVF A;  5CUG A;  5HFR A;  4UIW A;  4UIU A;  4QUU A;  5LJ0 A;  4HBX A;  5ENG A;  5II2 A;  5HQ6 A;  2WP2 A;  5CQ5 A;  4TQN A;  5HM0 A;  5E0R A;  2OSS A;  3AQA A;  5CUB A;  3U5J A;  2RO1 A;  3QZV A;  4HBY A;  4CUQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...