4YYGA

Crystal structure of brd9 bromodomain bound to a butyryllysine peptide
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
100
structure length
100
Chain Sequence
TPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDFGTMKDKIVANEYKSVTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bromodomain-containing protein 9
publication title A Subset of Human Bromodomains Recognizes Butyryllysine and Crotonyllysine Histone Peptide Modifications.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 35
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2015-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4yygA00
4YYKA 2WP2A 4UYDA 4NRCA 3NXBA 5DYCA 5HQ5A 5I88A 4YYHA 4N4HA 4QSPA 5HQ7A 5DBMA 4O7CA 5II2A 3QZTA 5BT5A 4MENA 4NR9A 4QYDA 4OGJA 5D24A 4TU6A 4TZ2A 4ZC9A 5FE7A 4NRBA 4RVRA 5AMEA 3IU5A 5DFCA 5AD3A 4KV1A 4ZW1A 4HXKA 2YELA 1ZS5A 2DVSA 5E74A 3U5PA 2L85A 4QZSA 5EI4A 5HENA 5IGLA 5FE2A 4MR6A 5ENFA 5H1TA 4TYLA 5H85A 2DATA 4YYJA 5KTWA 4NYXA 5F1HA 4HXOA 5F63A 3JVMA 4Q0NA 5LUUA 4TT2A 3U5MA 4YC9A 5C87A 1WUGA 4XUAA 4TU4A 2RI7A 2R0VA 4IOQA 3HMHA 5HFQA 4BW2A 5FH7A 5A81A 4MR5A 2F6NA 2RNXA 5F3AA 3UV5A 5C4QA 3DAIA 2F6JA 2L5EA 5I80A 2OO1A 3G0LA 4O76A 5DFBA 2YW5A 5L96A 4IR5A 3U5JA 4HXPA 4QR3A 4LYSA 5FE0A 4YATA 4QNSA 5LJ1A 5L97A 5D3HA 4UIUA 4MEPA 5HCLA 4A9NA 2YYNA 5HEMA 3AQAA 3O37A 5LJ0A 4UYFA 5EICA 4HBYA 3Q2FA 4LR6A 5FE9A 4UIVA 4YK0A 4NYWA 5FFWA 4OUFA 5FFVA 5J0DA 3U5LA 3MB3A 4TT6A 5A5QA 3P1DA 4YAXA 2MJVB 3U5KA 5BT3A 4HXNA 5D26A 5JWMA 3Q2EA 4J3IA 5L98A 5ACYA 4FLPA 5EQ1A 3MUKA 3D7CA 4F3IA 5ENGA 4MR3A 4O78A 4X2IA 3MB4A 3O33A 5D7XA 4A9OA 5DFDA 4CUSA 5D0CA 1JM4B 2DKWA 5DY7A 5DLZA 5I83A 4LDFA 3IU6A 3UVXA 5D3RA 2WP1A 4BW3A 4A9IA 5I86A 4J0SA 2G4AA 3UV2A 4QSVA 4O7EA 4YYGA 5DYXA 5CQ7A 4ALGA 4QEWA 4IORA 2YEMA 5ENEA 4UYHA 4CLBA 5KHMA 2KTBB 5ETDA 5IGKA 4QC1A 3SVHA 4N4IA 4YH3A 3HMFA 3LQHA 3SVGA 5IGNA 4O75A 5CUGA 5IGMA 4UITA 3QZVA 4O7BA 5LVQA 4N3WA 4O77A 3SVFA 3FKMX 5FE5A 4YYNA 5EGUA 4IR3A 4UYGA 5EPSA 5D3JA 3AADA 5FH8A 5IBNA 1WUMA 4AKNA 2FSAA 5KTXA 4IR4A 4CUPA 4O7FA 4MR4A 5E9MA 5CU8A 5FE3A 4PY6A 2GRCA 3U5NA 4J1PA 4MEOA 4HXRA 5EV9A 4YYIA 4NQMA 4Z93A 5DYAA 5HRXA 2N9GA 5FFYA 5G4RA 5E9IA 5HFRA 4IR6A 5FE6A 5FG5A 4TTEA 2YDWA 5IG6A 5C89A 3K2JA 4O72A 4A9JA 2E3KA 2DVRA 5EWVA 5E9KA 5CRMA 4QEVA 4DONA 2RO1A 4YH4A 4BW4A 2H60A 4BHWA 2LSPB 5CUCA 3G0JA 5E3GA 5E3DA 5CQAA 4QR4A 5L8UA 5E9LA 5DKCA 2YEKA 5CQ6A 5COIA 5F25A 5FB1A 5JI8A 4MEQA 4QUUA 4NUEA 2I8NA 4OGIA 4QSQA 5HJCA 5A5PA 5AMFA 4CL9A 2D82A 3JVKA 3U5OA 5CUEA 2RS9B 5ENJA 5LKZA 4CFLA 4ALHA 3UVDA 5FG6A 3UW9A 3P5OA 5EK9A 5FDZA 4UIYA 4PS5A 5HELA 5CFWA 3DWYA 4QBMA 4CURA 4PTBA 4QSRA 4TT4A 4QYLA 3JVLA 4A9LA 4KCXA 5ENIA 5EWHA 4J0RA 5CY9A 5FE8A 4YBTA 4UYEA 4N4FA 5FG4A 5TB6A 4TS8A 5A5RA 2YQDA 4QSXA 4BJXA 4XY9A 5F60A 4YBMA 3MULA 5CUBA 5EM3A 2R0YA 5LKTA 5DKHA 4A9EA 4YY6A 5D3TA 3P1FA 4ZQLA 5HRVA 4NUDA 5I7XA 1X0JA 4NXJA 4O71A 5E9YA 4NRAA 4QSUA 5A82A 1E6IA 5EPRA 4Z1SA 5DX4A 5CPEA 5A7CA 5FBXA 3P1EA 5FE4A 5CRZA 4YYDA 4LZRA 5CS8A 5A83A 4LYIA 5LVRA 3LXJA 4LZSA 4E96A 5CQ8A 3LQJA 4XUBA 4C66A 5ETBA 4A9HA 2R0SA 4PCIA 4CUUA 5F1LA 4PKLA 3ZYUA 4KV4A 2D9EA 4UIWA 2RNWA 4Z6IA 4QY4A 5FB0A 4CUQA 5CGPA 5KO4A 4A9FA 2R10A 5CZGA 5CQTA 3TLPA 4QSWA 5EP7A 4NR6A 5HQ6A 5AD2A 5HLSA 4Z1QA 4HBXA 5TCMA 5F36A 4O7AA 3RCWA 4N4GA 5D3PA 5I40A 5HRWA 4NR5A 4XY8A 5EVAA 5HM0A 5LKXA 4O70A 5E9VA 5KTUA 4QR5A 5II1A 5IIDA 3UVYA 3MQMA 4XYAA 5DYUA 5EU1A 5EWDA 5H1VA 4HXLA 2L84A 4GPJA 5DW1A 5D3SA 5EA1A 4UYFB 5F5ZA 3UVWA 5ENBA 2NXBA 3JVJA 4QSSA 5ENHA 5CQ3A 5E7DA 5DW2A 5G4SA 1F68A 4WHWA 5I29A 1N72A 4A9MA 2I7KA 5ENCA 4YYMA 5CUDA 3S91A 5A5OA 4LC2A 4WIVA 4TQNA 2OUOA 3QZSA 4CUTA 4IOOA 5CTLA 3LJWA 4NS5A 2E7NA 5A5SA 4Z6HA 4LRGA 5LJ2A 5C85A 4NQNA 2DVQA 3I3JA 4YADA 4QEUA 3P1CA 5A85A 3UV4A 5FE1A 3MXFA 4O74A 4LZ2A 5E73A 4NR4A 5EWCA 1EQFA 4Y03A 5CQ4A 3O36A 4QSTA 5F62A 4QB3A 4CFKA 5DLXA 4HBWA 2RNYA 2RFJA 5L8TA 4YBSA 4WHUA 4UIZA 5LKUA 5I1QA 5CQ5A 4NR8A 5C7NA 3HMEA 4NYVA 4QC3A 2OSSA 5EWWA 5H1UA 5EISA 5F2PA 4Q0OA 5F61A 5D25A 4A9KA 4HXMA 4C67A 4TZ8A 4BW1A 4UIXA 1JSPB 5I89A 5C8GA 5K29A 4YABA 4QUTA 4NR7A 5BT4A 5EPBA 2DWWA 4YY4A 4NUCA 5DKDA 5E0RA 5KU3A 2E7OA 5CUAA 4LYWA 4HBVA 3O34A 4HXSA 3ONIA 3LQIA 3GG3A 5FH6A 5D3NA 5D3LA 5A5NA 5CP5A 4PCEA 3S92A 5I7YA 3O35A 5L99A 2DVVA
chains in the Genus database with same CATH superfamily
4YYKA 2WP2A 4UYDA 4NRCA 3NXBA 5DYCA 5HQ5A 5I88A 4YYHA 4N4HA 4QSPA 5HQ7A 5DBMA 4O7CA 5II2A 3QZTA 5BT5A 4MENA 4NR9A 4QYDA 4OGJA 5D24A 4TU6A 4TZ2A 4ZC9A 5FE7A 4NRBA 4RVRA 5AMEA 3IU5A 5DFCA 5AD3A 4KV1A 4ZW1A 4HXKA 2YELA 1ZS5A 2DVSA 5E74A 3U5PA 2L85A 4QZSA 4AKGA 5EI4A 5HENA 5IGLA 5FE2A 4MR6A 5ENFA 5H1TA 4TYLA 5H85A 2DATA 4YYJA 5KTWA 4NYXA 3VKHA 5F1HA 3VKGA 4HXOA 5F63A 3JVMA 4Q0NA 5LUUA 4TT2A 3U5MA 4YC9A 5C87A 1WUGA 4XUAA 4TU4A 2RI7A 2R0VA 4IOQA 3HMHA 5HFQA 4BW2A 5FH7A 5A81A 4MR5A 2F6NA 2RNXA 5F3AA 3UV5A 5C4QA 3DAIA 2F6JA 2L5EA 5I80A 2OO1A 3G0LA 4O76A 5DFBA 2YW5A 5L96A 4IR5A 3U5JA 4HXPA 4QR3A 4LYSA 5FE0A 4YATA 4QNSA 5LJ1A 5L97A 5D3HA 4UIUA 4MEPA 5HCLA 1ZKRA 4A9NA 2YYNA 5HEMA 3AQAA 3O37A 5LJ0A 4UYFA 5EICA 4HBYA 3Q2FA 4LR6A 5FE9A 4UIVA 4YK0A 4NYWA 5FFWA 4OUFA 5FFVA 5J0DA 3U5LA 3MB3A 4TT6A 5A5QA 3P1DA 4YAXA 2MJVB 3U5KA 5BT3A 4HXNA 5D26A 5JWMA 3Q2EA 4J3IA 5L98A 5ACYA 4FLPA 5EQ1A 3MUKA 3D7CA 4F3IA 5ENGA 4MR3A 4O78A 4X2IA 3MB4A 3O33A 5D7XA 4A9OA 5DFDA 4CUSA 5D0CA 1JM4B 2DKWA 5DY7A 5DLZA 5I83A 4LDFA 3IU6A 3UVXA 5D3RA 2WP1A 4BW3A 4A9IA 5I86A 4J0SA 4AKHA 2G4AA 3UV2A 4QSVA 4O7EA 4YYGA 5DYXA 5CQ7A 4ALGA 4QEWA 4IORA 2YEMA 5ENEA 4UYHA 4CLBA 5KHMA 2KTBB 5ETDA 5IGKA 4QC1A 3SVHA 4N4IA 4YH3A 3HMFA 3LQHA 3SVGA 5IGNA 4O75A 5CUGA 5IGMA 4UITA 3QZVA 4O7BA 5LVQA 4N3WA 4O77A 3SVFA 3FKMX 5FE5A 4YYNA 5EGUA 4IR3A 4UYGA 5EPSA 5D3JA 3AADA 5FH8A 5IBNA 1WUMA 4AKNA 2FSAA 5KTXA 4IR4A 4CUPA 4O7FA 4MR4A 5E9MA 5CU8A 5FE3A 4PY6A 2GRCA 3U5NA 4J1PA 4MEOA 4HXRA 5EV9A 4YYIA 4NQMA 4Z93A 5DYAA 5HRXA 2N9GA 5FFYA 5G4RA 5E9IA 5HFRA 4IR6A 5FE6A 5FG5A 4TTEA 2YDWA 5IG6A 5C89A 3K2JA 4O72A 4A9JA 2E3KA 2DVRA 5EWVA 5E9KA 5CRMA 4QEVA 4DONA 2RO1A 4YH4A 4BW4A 2H60A 4BHWA 2LSPB 5CUCA 3G0JA 5E3GA 5E3DA 5CQAA 4QR4A 5L8UA 5E9LA 5DKCA 2YEKA 5CQ6A 5COIA 5F25A 5FB1A 5JI8A 4MEQA 4QUUA 4NUEA 2I8NA 4OGIA 4QSQA 5HJCA 5A5PA 5AMFA 4CL9A 2D82A 3JVKA 3U5OA 5CUEA 2RS9B 5ENJA 5LKZA 4CFLA 4ALHA 3UVDA 5FG6A 3UW9A 3P5OA 5EK9A 5FDZA 4UIYA 4PS5A 5HELA 5CFWA 3DWYA 4QBMA 1PUOA 4PTBA 4QSRA 4CURA 4TT4A 4QYLA 3JVLA 4A9LA 4KCXA 3D1BA 5ENIA 5EWHA 4J0RA 5CY9A 4AKIA 5FE8A 4YBTA 4UYEA 4N4FA 5FG4A 5TB6A 4TS8A 5A5RA 2YQDA 4QSXA 4BJXA 4XY9A 5F60A 4YBMA 3MULA 5CUBA 5EM3A 2R0YA 5LKTA 5DKHA 4A9EA 4YY6A 5D3TA 3P1FA 4ZQLA 5HRVA 4NUDA 5I7XA 1X0JA 4NXJA 4O71A 5E9YA 4NRAA 4QSUA 5A82A 1E6IA 5EPRA 4Z1SA 5DX4A 5CPEA 5A7CA 5FBXA 3P1EA 5FE4A 5CRZA 4YYDA 4LZRA 5CS8A 5A83A 3ERRA 4LYIA 5LVRA 3LXJA 4LZSA 4E96A 5CQ8A 3LQJA 4XUBA 4C66A 5ETBA 4A9HA 2R0SA 4PCIA 4CUUA 5F1LA 4PKLA 3ZYUA 4KV4A 2D9EA 3D1DA 4UIWA 2RNWA 4Z6IA 4QY4A 5FB0A 4CUQA 5CGPA 5KO4A 4A9FA 2R10A 5CZGA 5CQTA 3TLPA 4QSWA 5EP7A 4NR6A 5HQ6A 5AD2A 5HLSA 4Z1QA 4HBXA 5TCMA 5F36A 4O7AA 3RCWA 4N4GA 5D3PA 5I40A 5HRWA 4NR5A 4XY8A 5EVAA 5HM0A 5LKXA 4O70A 5E9VA 5KTUA 4QR5A 5II1A 5IIDA 3UVYA 3MQMA 4XYAA 5DYUA 5EU1A 5EWDA 5H1VA 4HXLA 2L84A 4GPJA 5DW1A 5D3SA 5EA1A 4UYFB 5F5ZA 3UVWA 5ENBA 2NXBA 3JVJA 4QSSA 5ENHA 5CQ3A 5E7DA 4AI6A 2EJNA 5DW2A 5G4SA 1F68A 4WHWA 5I29A 1N72A 4A9MA 2I7KA 5ENCA 4YYMA 5CUDA 3S91A 5A5OA 4LC2A 4WIVA 4TQNA 2OUOA 3QZSA 4CUTA 4IOOA 5CTLA 3LJWA 4NS5A 2E7NA 5A5SA 4Z6HA 4LRGA 5LJ2A 5C85A 4NQNA 2DVQA 3I3JA 4YADA 4QEUA 3P1CA 5A85A 3UV4A 5FE1A 3MXFA 4O74A 4LZ2A 5E73A 4NR4A 5EWCA 1EQFA 4Y03A 5CQ4A 3O36A 4QSTA 5F62A 4QB3A 4CFKA 5DLXA 4HBWA 2RNYA 2RFJA 5L8TA 4YBSA 4WHUA 4UIZA 5LKUA 5I1QA 5CQ5A 4NR8A 5C7NA 3HMEA 4NYVA 4QC3A 2OSSA 5EWWA 5H1UA 5EISA 5F2PA 4Q0OA 5F61A 5D25A 4A9KA 4HXMA 4C67A 4TZ8A 4BW1A 4UIXA 1JSPB 5I89A 5C8GA 5K29A 4YABA 4QUTA 4NR7A 5BT4A 5EPBA 2DWWA 4YY4A 4NUCA 5DKDA 5E0RA 5KU3A 2E7OA 5CUAA 4LYWA 4HBVA 3O34A 4HXSA 3ONIA 3LQIA 3GG3A 5FH6A 5D3NA 5D3LA 5A5NA 5CP5A 4PCEA 3S92A 5I7YA 3O35A 5L99A 2DVVA
chains in the Genus database with same CATH topology
4YYKA 2WP2A 4UYDA 4NRCA 3NXBA 5DYCA 5HQ5A 5I88A 4YYHA 4N4HA 4QSPA 5HQ7A 5DBMA 4O7CA 5II2A 3QZTA 5BT5A 4MENA 4NR9A 4QYDA 4OGJA 5D24A 4TU6A 4TZ2A 4ZC9A 5FE7A 4NRBA 4RVRA 5AMEA 3IU5A 5DFCA 5AD3A 4KV1A 4ZW1A 4HXKA 2YELA 1ZS5A 2DVSA 5E74A 3U5PA 2L85A 4QZSA 5EI4A 5HENA 5IGLA 5FE2A 4MR6A 5ENFA 5H1TA 4TYLA 5H85A 2DATA 4YYJA 5KTWA 4NYXA 5F1HA 4HXOA 5F63A 3JVMA 4Q0NA 5LUUA 4TT2A 3U5MA 4YC9A 5C87A 1WUGA 4XUAA 4TU4A 2RI7A 2R0VA 4IOQA 3HMHA 5HFQA 4BW2A 5FH7A 5A81A 4MR5A 2F6NA 2RNXA 5F3AA 3UV5A 5C4QA 3DAIA 2F6JA 2L5EA 5I80A 2OO1A 3G0LA 4O76A 5DFBA 2YW5A 5L96A 4IR5A 3U5JA 4HXPA 4QR3A 4LYSA 5FE0A 4YATA 4QNSA 5LJ1A 5L97A 5D3HA 4UIUA 4MEPA 5HCLA 4A9NA 2YYNA 5HEMA 3AQAA 3O37A 5LJ0A 4UYFA 5EICA 4HBYA 3Q2FA 4LR6A 5FE9A 4UIVA 4YK0A 4NYWA 5FFWA 4OUFA 5FFVA 5J0DA 3U5LA 3MB3A 4TT6A 5A5QA 3P1DA 4YAXA 2MJVB 3U5KA 5BT3A 4HXNA 5D26A 5JWMA 3Q2EA 4J3IA 5L98A 5ACYA 4FLPA 5EQ1A 3MUKA 3D7CA 4F3IA 5ENGA 4MR3A 4O78A 4X2IA 3MB4A 3O33A 5D7XA 4A9OA 5DFDA 4CUSA 5D0CA 1JM4B 2DKWA 5DY7A 5DLZA 5I83A 4LDFA 3IU6A 3UVXA 5D3RA 2WP1A 4BW3A 4A9IA 5I86A 4J0SA 2G4AA 3UV2A 4QSVA 4O7EA 4YYGA 5DYXA 5CQ7A 4ALGA 4QEWA 4IORA 2YEMA 5ENEA 4UYHA 4CLBA 5KHMA 2KTBB 5ETDA 5IGKA 4QC1A 3SVHA 4N4IA 4YH3A 3HMFA 3LQHA 3SVGA 5IGNA 4O75A 5CUGA 5IGMA 4UITA 3QZVA 4O7BA 5LVQA 4N3WA 4O77A 3SVFA 3FKMX 5FE5A 4YYNA 5EGUA 4IR3A 4UYGA 5EPSA 5D3JA 3AADA 5FH8A 5IBNA 1WUMA 4AKNA 2FSAA 5KTXA 4IR4A 4CUPA 4O7FA 4MR4A 5E9MA 5CU8A 5FE3A 4PY6A 2GRCA 3U5NA 4J1PA 4MEOA 4HXRA 5EV9A 4YYIA 4NQMA 4Z93A 5DYAA 5HRXA 2N9GA 5FFYA 5G4RA 5E9IA 5HFRA 4IR6A 5FE6A 5FG5A 4TTEA 2YDWA 5IG6A 5C89A 3K2JA 4O72A 4A9JA 2E3KA 2DVRA 5EWVA 5E9KA 5CRMA 4QEVA 4DONA 2RO1A 4YH4A 4BW4A 2H60A 4BHWA 2LSPB 5CUCA 3G0JA 5E3GA 5E3DA 5CQAA 4QR4A 5L8UA 5E9LA 5DKCA 2YEKA 5CQ6A 5COIA 5F25A 5FB1A 5JI8A 4MEQA 4QUUA 4NUEA 2I8NA 4OGIA 4QSQA 5HJCA 5A5PA 5AMFA 4CL9A 2D82A 3JVKA 3U5OA 5CUEA 2RS9B 5ENJA 5LKZA 4CFLA 4ALHA 3UVDA 5FG6A 3UW9A 3P5OA 5EK9A 5FDZA 4UIYA 4PS5A 5HELA 5CFWA 3DWYA 4QBMA 4CURA 4PTBA 4QSRA 4TT4A 4QYLA 3JVLA 4A9LA 4KCXA 5ENIA 5EWHA 4J0RA 5CY9A 5FE8A 4YBTA 4UYEA 4N4FA 5FG4A 5TB6A 4TS8A 5A5RA 2YQDA 4QSXA 4BJXA 4XY9A 5F60A 4YBMA 3MULA 5CUBA 5EM3A 2R0YA 5LKTA 5DKHA 4A9EA 4YY6A 5D3TA 3P1FA 4ZQLA 5HRVA 4NUDA 5I7XA 1X0JA 4NXJA 4O71A 5E9YA 4NRAA 4QSUA 5A82A 1E6IA 5EPRA 4Z1SA 5DX4A 5CPEA 5A7CA 5FBXA 3P1EA 5FE4A 5CRZA 4YYDA 4LZRA 5CS8A 5A83A 4LYIA 5LVRA 3LXJA 4LZSA 4E96A 5CQ8A 3LQJA 4XUBA 4C66A 5ETBA 4A9HA 2R0SA 4PCIA 4CUUA 5F1LA 4PKLA 3ZYUA 4KV4A 2D9EA 4UIWA 2RNWA 4Z6IA 4QY4A 5FB0A 4CUQA 5CGPA 5KO4A 4A9FA 2R10A 5CZGA 5CQTA 3TLPA 4QSWA 5EP7A 4NR6A 5HQ6A 5AD2A 5HLSA 4Z1QA 4HBXA 5TCMA 5F36A 4O7AA 3RCWA 4N4GA 5D3PA 5I40A 5HRWA 4NR5A 4XY8A 5EVAA 5HM0A 5LKXA 4O70A 5E9VA 5KTUA 4QR5A 5II1A 5IIDA 3UVYA 3MQMA 4XYAA 5DYUA 5EU1A 5EWDA 5H1VA 4HXLA 2L84A 4GPJA 5DW1A 5D3SA 5EA1A 4UYFB 5F5ZA 3UVWA 5ENBA 2NXBA 3JVJA 4QSSA 5ENHA 5CQ3A 5E7DA 5DW2A 5G4SA 1F68A 4WHWA 5I29A 1N72A 4A9MA 2I7KA 5ENCA 4YYMA 5CUDA 3S91A 5A5OA 4LC2A 4WIVA 4TQNA 2OUOA 3QZSA 4CUTA 4IOOA 5CTLA 3LJWA 4NS5A 2E7NA 5A5SA 4Z6HA 4LRGA 5LJ2A 5C85A 4NQNA 2DVQA 3I3JA 4YADA 4QEUA 3P1CA 5A85A 3UV4A 5FE1A 3MXFA 4O74A 4LZ2A 5E73A 4NR4A 5EWCA 1EQFA 4Y03A 5CQ4A 3O36A 4QSTA 5F62A 4QB3A 4CFKA 5DLXA 4HBWA 2RNYA 2RFJA 5L8TA 4YBSA 4WHUA 4UIZA 5LKUA 5I1QA 5CQ5A 4NR8A 5C7NA 3HMEA 4NYVA 4QC3A 2OSSA 5EWWA 5H1UA 5EISA 5F2PA 4Q0OA 5F61A 5D25A 4A9KA 4HXMA 4C67A 4TZ8A 4BW1A 4UIXA 1JSPB 5I89A 5C8GA 5K29A 4YABA 4QUTA 4NR7A 5BT4A 5EPBA 2DWWA 4YY4A 4NUCA 5DKDA 5E0RA 5KU3A 2E7OA 5CUAA 4LYWA 4HBVA 3O34A 4HXSA 3ONIA 3LQIA 3GG3A 5FH6A 5D3NA 5D3LA 5A5NA 5CP5A 4PCEA 3S92A 5I7YA 3O35A 5L99A 2DVVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YYK A;  2WP2 A;  4UYD A;  4NRC A;  3NXB A;  5DYC A;  5HQ5 A;  5I88 A;  4YYH A;  4N4H A;  4QSP A;  5HQ7 A;  5DBM A;  4O7C A;  5II2 A;  3QZT A;  5BT5 A;  4MEN A;  4NR9 A;  4QYD A;  4OGJ A;  5D24 A;  4TU6 A;  4TZ2 A;  4ZC9 A;  5FE7 A;  4NRB A;  4RVR A;  5AME A;  3IU5 A;  5DFC A;  5AD3 A;  4KV1 A;  4ZW1 A;  4HXK A;  2YEL A;  1ZS5 A;  2DVS A;  5E74 A;  3U5P A;  2L85 A;  4QZS A;  5EI4 A;  5HEN A;  5IGL A;  5FE2 A;  4MR6 A;  5ENF A;  5H1T A;  4TYL A;  5H85 A;  2DAT A;  4YYJ A;  5KTW A;  4NYX A;  5F1H A;  4HXO A;  5F63 A;  3JVM A;  4Q0N A;  5LUU A;  4TT2 A;  3U5M A;  4YC9 A;  5C87 A;  1WUG A;  4XUA A;  4TU4 A;  2RI7 A;  2R0V A;  4IOQ A;  3HMH A;  5HFQ A;  4BW2 A;  5FH7 A;  5A81 A;  4MR5 A;  2F6N A;  2RNX A;  5F3A A;  3UV5 A;  5C4Q A;  3DAI A;  2F6J A;  2L5E A;  5I80 A;  2OO1 A;  3G0L A;  4O76 A;  5DFB A;  2YW5 A;  5L96 A;  4IR5 A;  3U5J A;  4HXP A;  4QR3 A;  4LYS A;  5FE0 A;  4YAT A;  4QNS A;  5LJ1 A;  5L97 A;  5D3H A;  4UIU A;  4MEP A;  5HCL A;  4A9N A;  2YYN A;  5HEM A;  3AQA A;  3O37 A;  5LJ0 A;  4UYF A;  5EIC A;  4HBY A;  3Q2F A;  4LR6 A;  5FE9 A;  4UIV A;  4YK0 A;  4NYW A;  5FFW A;  4OUF A;  5FFV A;  5J0D A;  3U5L A;  3MB3 A;  4TT6 A;  5A5Q A;  3P1D A;  4YAX A;  2MJV B;  3U5K A;  5BT3 A;  4HXN A;  5D26 A;  5JWM A;  3Q2E A;  4J3I A;  5L98 A;  5ACY A;  4FLP A;  5EQ1 A;  3MUK A;  3D7C A;  4F3I A;  5ENG A;  4MR3 A;  4O78 A;  4X2I A;  3MB4 A;  3O33 A;  5D7X A;  4A9O A;  5DFD A;  4CUS A;  5D0C A;  1JM4 B;  2DKW A;  5DY7 A;  5DLZ A;  5I83 A;  4LDF A;  3IU6 A;  3UVX A;  5D3R A;  2WP1 A;  4BW3 A;  4A9I A;  5I86 A;  4J0S A;  2G4A A;  3UV2 A;  4QSV A;  4O7E A;  4YYG A;  5DYX A;  5CQ7 A;  4ALG A;  4QEW A;  4IOR A;  2YEM A;  5ENE A;  4UYH A;  4CLB A;  5KHM A;  2KTB B;  5ETD A;  5IGK A;  4QC1 A;  3SVH A;  4N4I A;  4YH3 A;  3HMF A;  3LQH A;  3SVG A;  5IGN A;  4O75 A;  5CUG A;  5IGM A;  4UIT A;  3QZV A;  4O7B A;  5LVQ A;  4N3W A;  4O77 A;  3SVF A;  3FKM X;  5FE5 A;  4YYN A;  5EGU A;  4IR3 A;  4UYG A;  5EPS A;  5D3J A;  3AAD A;  5FH8 A;  5IBN A;  1WUM A;  4AKN A;  2FSA A;  5KTX A;  4IR4 A;  4CUP A;  4O7F A;  4MR4 A;  5E9M A;  5CU8 A;  5FE3 A;  4PY6 A;  2GRC A;  3U5N A;  4J1P A;  4MEO A;  4HXR A;  5EV9 A;  4YYI A;  4NQM A;  4Z93 A;  5DYA A;  5HRX A;  2N9G A;  5FFY A;  5G4R A;  5E9I A;  5HFR A;  4IR6 A;  5FE6 A;  5FG5 A;  4TTE A;  2YDW A;  5IG6 A;  5C89 A;  3K2J A;  4O72 A;  4A9J A;  2E3K A;  2DVR A;  5EWV A;  5E9K A;  5CRM A;  4QEV A;  4DON A;  2RO1 A;  4YH4 A;  4BW4 A;  2H60 A;  4BHW A;  2LSP B;  5CUC A;  3G0J A;  5E3G A;  5E3D A;  5CQA A;  4QR4 A;  5L8U A;  5E9L A;  5DKC A;  2YEK A;  5CQ6 A;  5COI A;  5F25 A;  5FB1 A;  5JI8 A;  4MEQ A;  4QUU A;  4NUE A;  2I8N A;  4OGI A;  4QSQ A;  5HJC A;  5A5P A;  5AMF A;  4CL9 A;  2D82 A;  3JVK A;  3U5O A;  5CUE A;  2RS9 B;  5ENJ A;  5LKZ A;  4CFL A;  4ALH A;  3UVD A;  5FG6 A;  3UW9 A;  3P5O A;  5EK9 A;  5FDZ A;  4UIY A;  4PS5 A;  5HEL A;  5CFW A;  3DWY A;  4QBM A;  4CUR A;  4PTB A;  4QSR A;  4TT4 A;  4QYL A;  3JVL A;  4A9L A;  4KCX A;  5ENI A;  5EWH A;  4J0R A;  5CY9 A;  5FE8 A;  4YBT A;  4UYE A;  4N4F A;  5FG4 A;  5TB6 A;  4TS8 A;  5A5R A;  2YQD A;  4QSX A;  4BJX A;  4XY9 A;  5F60 A;  4YBM A;  3MUL A;  5CUB A;  5EM3 A;  2R0Y A;  5LKT A;  5DKH A;  4A9E A;  4YY6 A;  5D3T A;  3P1F A;  4ZQL A;  5HRV A;  4NUD A;  5I7X A;  1X0J A;  4NXJ A;  4O71 A;  5E9Y A;  4NRA A;  4QSU A;  5A82 A;  1E6I A;  5EPR A;  4Z1S A;  5DX4 A;  5CPE A;  5A7C A;  5FBX A;  3P1E A;  5FE4 A;  5CRZ A;  4YYD A;  4LZR A;  5CS8 A;  5A83 A;  4LYI A;  5LVR A;  3LXJ A;  4LZS A;  4E96 A;  5CQ8 A;  3LQJ A;  4XUB A;  4C66 A;  5ETB A;  4A9H A;  2R0S A;  4PCI A;  4CUU A;  5F1L A;  4PKL A;  3ZYU A;  4KV4 A;  2D9E A;  4UIW A;  2RNW A;  4Z6I A;  4QY4 A;  5FB0 A;  4CUQ A;  5CGP A;  5KO4 A;  4A9F A;  2R10 A;  5CZG A;  5CQT A;  3TLP A;  4QSW A;  5EP7 A;  4NR6 A;  5HQ6 A;  5AD2 A;  5HLS A;  4Z1Q A;  4HBX A;  5TCM A;  5F36 A;  4O7A A;  3RCW A;  4N4G A;  5D3P A;  5I40 A;  5HRW A;  4NR5 A;  4XY8 A;  5EVA A;  5HM0 A;  5LKX A;  4O70 A;  5E9V A;  5KTU A;  4QR5 A;  5II1 A;  5IID A;  3UVY A;  3MQM A;  4XYA A;  5DYU A;  5EU1 A;  5EWD A;  5H1V A;  4HXL A;  2L84 A;  4GPJ A;  5DW1 A;  5D3S A;  5EA1 A;  4UYF B;  5F5Z A;  3UVW A;  5ENB A;  2NXB A;  3JVJ A;  4QSS A;  5ENH A;  5CQ3 A;  5E7D A;  5DW2 A;  5G4S A;  1F68 A;  4WHW A;  5I29 A;  1N72 A;  4A9M A;  2I7K A;  5ENC A;  4YYM A;  5CUD A;  3S91 A;  5A5O A;  4LC2 A;  4WIV A;  4TQN A;  2OUO A;  3QZS A;  4CUT A;  4IOO A;  5CTL A;  3LJW A;  4NS5 A;  2E7N A;  5A5S A;  4Z6H A;  4LRG A;  5LJ2 A;  5C85 A;  4NQN A;  2DVQ A;  3I3J A;  4YAD A;  4QEU A;  3P1C A;  5A85 A;  3UV4 A;  5FE1 A;  3MXF A;  4O74 A;  4LZ2 A;  5E73 A;  4NR4 A;  5EWC A;  1EQF A;  4Y03 A;  5CQ4 A;  3O36 A;  4QST A;  5F62 A;  4QB3 A;  4CFK A;  5DLX A;  4HBW A;  2RNY A;  2RFJ A;  5L8T A;  4YBS A;  4WHU A;  4UIZ A;  5LKU A;  5I1Q A;  5CQ5 A;  4NR8 A;  5C7N A;  3HME A;  4NYV A;  4QC3 A;  2OSS A;  5EWW A;  5H1U A;  5EIS A;  5F2P A;  4Q0O A;  5F61 A;  5D25 A;  4A9K A;  4HXM A;  4C67 A;  4TZ8 A;  4BW1 A;  4UIX A;  1JSP B;  5I89 A;  5C8G A;  5K29 A;  4YAB A;  4QUT A;  4NR7 A;  5BT4 A;  5EPB A;  2DWW A;  4YY4 A;  4NUC A;  5DKD A;  5E0R A;  5KU3 A;  2E7O A;  5CUA A;  4LYW A;  4HBV A;  3O34 A;  4HXS A;  3ONI A;  3LQI A;  3GG3 A;  5FH6 A;  5D3N A;  5D3L A;  5A5N A;  5CP5 A;  4PCE A;  3S92 A;  5I7Y A;  3O35 A;  5L99 A;  2DVV A; 
#chains in the Genus database with same CATH topology
 4YYK A;  2WP2 A;  4UYD A;  4NRC A;  3NXB A;  5DYC A;  5HQ5 A;  5I88 A;  4YYH A;  4N4H A;  4QSP A;  5HQ7 A;  5DBM A;  4O7C A;  5II2 A;  3QZT A;  5BT5 A;  4MEN A;  4NR9 A;  4QYD A;  4OGJ A;  5D24 A;  4TU6 A;  4TZ2 A;  4ZC9 A;  5FE7 A;  4NRB A;  4RVR A;  5AME A;  3IU5 A;  5DFC A;  5AD3 A;  4KV1 A;  4ZW1 A;  4HXK A;  2YEL A;  1ZS5 A;  2DVS A;  5E74 A;  3U5P A;  2L85 A;  4QZS A;  4AKG A;  5EI4 A;  5HEN A;  5IGL A;  5FE2 A;  4MR6 A;  5ENF A;  5H1T A;  4TYL A;  5H85 A;  2DAT A;  4YYJ A;  5KTW A;  4NYX A;  3VKH A;  5F1H A;  3VKG A;  4HXO A;  5F63 A;  3JVM A;  4Q0N A;  5LUU A;  4TT2 A;  3U5M A;  4YC9 A;  5C87 A;  1WUG A;  4XUA A;  4TU4 A;  2RI7 A;  2R0V A;  4IOQ A;  3HMH A;  5HFQ A;  4BW2 A;  5FH7 A;  5A81 A;  4MR5 A;  2F6N A;  2RNX A;  5F3A A;  3UV5 A;  5C4Q A;  3DAI A;  2F6J A;  2L5E A;  5I80 A;  2OO1 A;  3G0L A;  4O76 A;  5DFB A;  2YW5 A;  5L96 A;  4IR5 A;  3U5J A;  4HXP A;  4QR3 A;  4LYS A;  5FE0 A;  4YAT A;  4QNS A;  5LJ1 A;  5L97 A;  5D3H A;  4UIU A;  4MEP A;  5HCL A;  1ZKR A;  4A9N A;  2YYN A;  5HEM A;  3AQA A;  3O37 A;  5LJ0 A;  4UYF A;  5EIC A;  4HBY A;  3Q2F A;  4LR6 A;  5FE9 A;  4UIV A;  4YK0 A;  4NYW A;  5FFW A;  4OUF A;  5FFV A;  5J0D A;  3U5L A;  3MB3 A;  4TT6 A;  5A5Q A;  3P1D A;  4YAX A;  2MJV B;  3U5K A;  5BT3 A;  4HXN A;  5D26 A;  5JWM A;  3Q2E A;  4J3I A;  5L98 A;  5ACY A;  4FLP A;  5EQ1 A;  3MUK A;  3D7C A;  4F3I A;  5ENG A;  4MR3 A;  4O78 A;  4X2I A;  3MB4 A;  3O33 A;  5D7X A;  4A9O A;  5DFD A;  4CUS A;  5D0C A;  1JM4 B;  2DKW A;  5DY7 A;  5DLZ A;  5I83 A;  4LDF A;  3IU6 A;  3UVX A;  5D3R A;  2WP1 A;  4BW3 A;  4A9I A;  5I86 A;  4J0S A;  4AKH A;  2G4A A;  3UV2 A;  4QSV A;  4O7E A;  4YYG A;  5DYX A;  5CQ7 A;  4ALG A;  4QEW A;  4IOR A;  2YEM A;  5ENE A;  4UYH A;  4CLB A;  5KHM A;  2KTB B;  5ETD A;  5IGK A;  4QC1 A;  3SVH A;  4N4I A;  4YH3 A;  3HMF A;  3LQH A;  3SVG A;  5IGN A;  4O75 A;  5CUG A;  5IGM A;  4UIT A;  3QZV A;  4O7B A;  5LVQ A;  4N3W A;  4O77 A;  3SVF A;  3FKM X;  5FE5 A;  4YYN A;  5EGU A;  4IR3 A;  4UYG A;  5EPS A;  5D3J A;  3AAD A;  5FH8 A;  5IBN A;  1WUM A;  4AKN A;  2FSA A;  5KTX A;  4IR4 A;  4CUP A;  4O7F A;  4MR4 A;  5E9M A;  5CU8 A;  5FE3 A;  4PY6 A;  2GRC A;  3U5N A;  4J1P A;  4MEO A;  4HXR A;  5EV9 A;  4YYI A;  4NQM A;  4Z93 A;  5DYA A;  5HRX A;  2N9G A;  5FFY A;  5G4R A;  5E9I A;  5HFR A;  4IR6 A;  5FE6 A;  5FG5 A;  4TTE A;  2YDW A;  5IG6 A;  5C89 A;  3K2J A;  4O72 A;  4A9J A;  2E3K A;  2DVR A;  5EWV A;  5E9K A;  5CRM A;  4QEV A;  4DON A;  2RO1 A;  4YH4 A;  4BW4 A;  2H60 A;  4BHW A;  2LSP B;  5CUC A;  3G0J A;  5E3G A;  5E3D A;  5CQA A;  4QR4 A;  5L8U A;  5E9L A;  5DKC A;  2YEK A;  5CQ6 A;  5COI A;  5F25 A;  5FB1 A;  5JI8 A;  4MEQ A;  4QUU A;  4NUE A;  2I8N A;  4OGI A;  4QSQ A;  5HJC A;  5A5P A;  5AMF A;  4CL9 A;  2D82 A;  3JVK A;  3U5O A;  5CUE A;  2RS9 B;  5ENJ A;  5LKZ A;  4CFL A;  4ALH A;  3UVD A;  5FG6 A;  3UW9 A;  3P5O A;  5EK9 A;  5FDZ A;  4UIY A;  4PS5 A;  5HEL A;  5CFW A;  3DWY A;  4QBM A;  1PUO A;  4PTB A;  4QSR A;  4CUR A;  4TT4 A;  4QYL A;  3JVL A;  4A9L A;  4KCX A;  3D1B A;  5ENI A;  5EWH A;  4J0R A;  5CY9 A;  4AKI A;  5FE8 A;  4YBT A;  4UYE A;  4N4F A;  5FG4 A;  5TB6 A;  4TS8 A;  5A5R A;  2YQD A;  4QSX A;  4BJX A;  4XY9 A;  5F60 A;  4YBM A;  3MUL A;  5CUB A;  5EM3 A;  2R0Y A;  5LKT A;  5DKH A;  4A9E A;  4YY6 A;  5D3T A;  3P1F A;  4ZQL A;  5HRV A;  4NUD A;  5I7X A;  1X0J A;  4NXJ A;  4O71 A;  5E9Y A;  4NRA A;  4QSU A;  5A82 A;  1E6I A;  5EPR A;  4Z1S A;  5DX4 A;  5CPE A;  5A7C A;  5FBX A;  3P1E A;  5FE4 A;  5CRZ A;  4YYD A;  4LZR A;  5CS8 A;  5A83 A;  3ERR A;  4LYI A;  5LVR A;  3LXJ A;  4LZS A;  4E96 A;  5CQ8 A;  3LQJ A;  4XUB A;  4C66 A;  5ETB A;  4A9H A;  2R0S A;  4PCI A;  4CUU A;  5F1L A;  4PKL A;  3ZYU A;  4KV4 A;  2D9E A;  3D1D A;  4UIW A;  2RNW A;  4Z6I A;  4QY4 A;  5FB0 A;  4CUQ A;  5CGP A;  5KO4 A;  4A9F A;  2R10 A;  5CZG A;  5CQT A;  3TLP A;  4QSW A;  5EP7 A;  4NR6 A;  5HQ6 A;  5AD2 A;  5HLS A;  4Z1Q A;  4HBX A;  5TCM A;  5F36 A;  4O7A A;  3RCW A;  4N4G A;  5D3P A;  5I40 A;  5HRW A;  4NR5 A;  4XY8 A;  5EVA A;  5HM0 A;  5LKX A;  4O70 A;  5E9V A;  5KTU A;  4QR5 A;  5II1 A;  5IID A;  3UVY A;  3MQM A;  4XYA A;  5DYU A;  5EU1 A;  5EWD A;  5H1V A;  4HXL A;  2L84 A;  4GPJ A;  5DW1 A;  5D3S A;  5EA1 A;  4UYF B;  5F5Z A;  3UVW A;  5ENB A;  2NXB A;  3JVJ A;  4QSS A;  5ENH A;  5CQ3 A;  5E7D A;  4AI6 A;  2EJN A;  5DW2 A;  5G4S A;  1F68 A;  4WHW A;  5I29 A;  1N72 A;  4A9M A;  2I7K A;  5ENC A;  4YYM A;  5CUD A;  3S91 A;  5A5O A;  4LC2 A;  4WIV A;  4TQN A;  2OUO A;  3QZS A;  4CUT A;  4IOO A;  5CTL A;  3LJW A;  4NS5 A;  2E7N A;  5A5S A;  4Z6H A;  4LRG A;  5LJ2 A;  5C85 A;  4NQN A;  2DVQ A;  3I3J A;  4YAD A;  4QEU A;  3P1C A;  5A85 A;  3UV4 A;  5FE1 A;  3MXF A;  4O74 A;  4LZ2 A;  5E73 A;  4NR4 A;  5EWC A;  1EQF A;  4Y03 A;  5CQ4 A;  3O36 A;  4QST A;  5F62 A;  4QB3 A;  4CFK A;  5DLX A;  4HBW A;  2RNY A;  2RFJ A;  5L8T A;  4YBS A;  4WHU A;  4UIZ A;  5LKU A;  5I1Q A;  5CQ5 A;  4NR8 A;  5C7N A;  3HME A;  4NYV A;  4QC3 A;  2OSS A;  5EWW A;  5H1U A;  5EIS A;  5F2P A;  4Q0O A;  5F61 A;  5D25 A;  4A9K A;  4HXM A;  4C67 A;  4TZ8 A;  4BW1 A;  4UIX A;  1JSP B;  5I89 A;  5C8G A;  5K29 A;  4YAB A;  4QUT A;  4NR7 A;  5BT4 A;  5EPB A;  2DWW A;  4YY4 A;  4NUC A;  5DKD A;  5E0R A;  5KU3 A;  2E7O A;  5CUA A;  4LYW A;  4HBV A;  3O34 A;  4HXS A;  3ONI A;  3LQI A;  3GG3 A;  5FH6 A;  5D3N A;  5D3L A;  5A5N A;  5CP5 A;  4PCE A;  3S92 A;  5I7Y A;  3O35 A;  5L99 A;  2DVV A; 
#chains in the Genus database with same CATH homology
 4YYK A;  2WP2 A;  4UYD A;  4NRC A;  3NXB A;  5DYC A;  5HQ5 A;  5I88 A;  4YYH A;  4N4H A;  4QSP A;  5HQ7 A;  5DBM A;  4O7C A;  5II2 A;  3QZT A;  5BT5 A;  4MEN A;  4NR9 A;  4QYD A;  4OGJ A;  5D24 A;  4TU6 A;  4TZ2 A;  4ZC9 A;  5FE7 A;  4NRB A;  4RVR A;  5AME A;  3IU5 A;  5DFC A;  5AD3 A;  4KV1 A;  4ZW1 A;  4HXK A;  2YEL A;  1ZS5 A;  2DVS A;  5E74 A;  3U5P A;  2L85 A;  4QZS A;  5EI4 A;  5HEN A;  5IGL A;  5FE2 A;  4MR6 A;  5ENF A;  5H1T A;  4TYL A;  5H85 A;  2DAT A;  4YYJ A;  5KTW A;  4NYX A;  5F1H A;  4HXO A;  5F63 A;  3JVM A;  4Q0N A;  5LUU A;  4TT2 A;  3U5M A;  4YC9 A;  5C87 A;  1WUG A;  4XUA A;  4TU4 A;  2RI7 A;  2R0V A;  4IOQ A;  3HMH A;  5HFQ A;  4BW2 A;  5FH7 A;  5A81 A;  4MR5 A;  2F6N A;  2RNX A;  5F3A A;  3UV5 A;  5C4Q A;  3DAI A;  2F6J A;  2L5E A;  5I80 A;  2OO1 A;  3G0L A;  4O76 A;  5DFB A;  2YW5 A;  5L96 A;  4IR5 A;  3U5J A;  4HXP A;  4QR3 A;  4LYS A;  5FE0 A;  4YAT A;  4QNS A;  5LJ1 A;  5L97 A;  5D3H A;  4UIU A;  4MEP A;  5HCL A;  4A9N A;  2YYN A;  5HEM A;  3AQA A;  3O37 A;  5LJ0 A;  4UYF A;  5EIC A;  4HBY A;  3Q2F A;  4LR6 A;  5FE9 A;  4UIV A;  4YK0 A;  4NYW A;  5FFW A;  4OUF A;  5FFV A;  5J0D A;  3U5L A;  3MB3 A;  4TT6 A;  5A5Q A;  3P1D A;  4YAX A;  2MJV B;  3U5K A;  5BT3 A;  4HXN A;  5D26 A;  5JWM A;  3Q2E A;  4J3I A;  5L98 A;  5ACY A;  4FLP A;  5EQ1 A;  3MUK A;  3D7C A;  4F3I A;  5ENG A;  4MR3 A;  4O78 A;  4X2I A;  3MB4 A;  3O33 A;  5D7X A;  4A9O A;  5DFD A;  4CUS A;  5D0C A;  1JM4 B;  2DKW A;  5DY7 A;  5DLZ A;  5I83 A;  4LDF A;  3IU6 A;  3UVX A;  5D3R A;  2WP1 A;  4BW3 A;  4A9I A;  5I86 A;  4J0S A;  2G4A A;  3UV2 A;  4QSV A;  4O7E A;  4YYG A;  5DYX A;  5CQ7 A;  4ALG A;  4QEW A;  4IOR A;  2YEM A;  5ENE A;  4UYH A;  4CLB A;  5KHM A;  2KTB B;  5ETD A;  5IGK A;  4QC1 A;  3SVH A;  4N4I A;  4YH3 A;  3HMF A;  3LQH A;  3SVG A;  5IGN A;  4O75 A;  5CUG A;  5IGM A;  4UIT A;  3QZV A;  4O7B A;  5LVQ A;  4N3W A;  4O77 A;  3SVF A;  3FKM X;  5FE5 A;  4YYN A;  5EGU A;  4IR3 A;  4UYG A;  5EPS A;  5D3J A;  3AAD A;  5FH8 A;  5IBN A;  1WUM A;  4AKN A;  2FSA A;  5KTX A;  4IR4 A;  4CUP A;  4O7F A;  4MR4 A;  5E9M A;  5CU8 A;  5FE3 A;  4PY6 A;  2GRC A;  3U5N A;  4J1P A;  4MEO A;  4HXR A;  5EV9 A;  4YYI A;  4NQM A;  4Z93 A;  5DYA A;  5HRX A;  2N9G A;  5FFY A;  5G4R A;  5E9I A;  5HFR A;  4IR6 A;  5FE6 A;  5FG5 A;  4TTE A;  2YDW A;  5IG6 A;  5C89 A;  3K2J A;  4O72 A;  4A9J A;  2E3K A;  2DVR A;  5EWV A;  5E9K A;  5CRM A;  4QEV A;  4DON A;  2RO1 A;  4YH4 A;  4BW4 A;  2H60 A;  4BHW A;  2LSP B;  5CUC A;  3G0J A;  5E3G A;  5E3D A;  5CQA A;  4QR4 A;  5L8U A;  5E9L A;  5DKC A;  2YEK A;  5CQ6 A;  5COI A;  5F25 A;  5FB1 A;  5JI8 A;  4MEQ A;  4QUU A;  4NUE A;  2I8N A;  4OGI A;  4QSQ A;  5HJC A;  5A5P A;  5AMF A;  4CL9 A;  2D82 A;  3JVK A;  3U5O A;  5CUE A;  2RS9 B;  5ENJ A;  5LKZ A;  4CFL A;  4ALH A;  3UVD A;  5FG6 A;  3UW9 A;  3P5O A;  5EK9 A;  5FDZ A;  4UIY A;  4PS5 A;  5HEL A;  5CFW A;  3DWY A;  4QBM A;  4CUR A;  4PTB A;  4QSR A;  4TT4 A;  4QYL A;  3JVL A;  4A9L A;  4KCX A;  5ENI A;  5EWH A;  4J0R A;  5CY9 A;  5FE8 A;  4YBT A;  4UYE A;  4N4F A;  5FG4 A;  5TB6 A;  4TS8 A;  5A5R A;  2YQD A;  4QSX A;  4BJX A;  4XY9 A;  5F60 A;  4YBM A;  3MUL A;  5CUB A;  5EM3 A;  2R0Y A;  5LKT A;  5DKH A;  4A9E A;  4YY6 A;  5D3T A;  3P1F A;  4ZQL A;  5HRV A;  4NUD A;  5I7X A;  1X0J A;  4NXJ A;  4O71 A;  5E9Y A;  4NRA A;  4QSU A;  5A82 A;  1E6I A;  5EPR A;  4Z1S A;  5DX4 A;  5CPE A;  5A7C A;  5FBX A;  3P1E A;  5FE4 A;  5CRZ A;  4YYD A;  4LZR A;  5CS8 A;  5A83 A;  4LYI A;  5LVR A;  3LXJ A;  4LZS A;  4E96 A;  5CQ8 A;  3LQJ A;  4XUB A;  4C66 A;  5ETB A;  4A9H A;  2R0S A;  4PCI A;  4CUU A;  5F1L A;  4PKL A;  3ZYU A;  4KV4 A;  2D9E A;  4UIW A;  2RNW A;  4Z6I A;  4QY4 A;  5FB0 A;  4CUQ A;  5CGP A;  5KO4 A;  4A9F A;  2R10 A;  5CZG A;  5CQT A;  3TLP A;  4QSW A;  5EP7 A;  4NR6 A;  5HQ6 A;  5AD2 A;  5HLS A;  4Z1Q A;  4HBX A;  5TCM A;  5F36 A;  4O7A A;  3RCW A;  4N4G A;  5D3P A;  5I40 A;  5HRW A;  4NR5 A;  4XY8 A;  5EVA A;  5HM0 A;  5LKX A;  4O70 A;  5E9V A;  5KTU A;  4QR5 A;  5II1 A;  5IID A;  3UVY A;  3MQM A;  4XYA A;  5DYU A;  5EU1 A;  5EWD A;  5H1V A;  4HXL A;  2L84 A;  4GPJ A;  5DW1 A;  5D3S A;  5EA1 A;  4UYF B;  5F5Z A;  3UVW A;  5ENB A;  2NXB A;  3JVJ A;  4QSS A;  5ENH A;  5CQ3 A;  5E7D A;  5DW2 A;  5G4S A;  1F68 A;  4WHW A;  5I29 A;  1N72 A;  4A9M A;  2I7K A;  5ENC A;  4YYM A;  5CUD A;  3S91 A;  5A5O A;  4LC2 A;  4WIV A;  4TQN A;  2OUO A;  3QZS A;  4CUT A;  4IOO A;  5CTL A;  3LJW A;  4NS5 A;  2E7N A;  5A5S A;  4Z6H A;  4LRG A;  5LJ2 A;  5C85 A;  4NQN A;  2DVQ A;  3I3J A;  4YAD A;  4QEU A;  3P1C A;  5A85 A;  3UV4 A;  5FE1 A;  3MXF A;  4O74 A;  4LZ2 A;  5E73 A;  4NR4 A;  5EWC A;  1EQF A;  4Y03 A;  5CQ4 A;  3O36 A;  4QST A;  5F62 A;  4QB3 A;  4CFK A;  5DLX A;  4HBW A;  2RNY A;  2RFJ A;  5L8T A;  4YBS A;  4WHU A;  4UIZ A;  5LKU A;  5I1Q A;  5CQ5 A;  4NR8 A;  5C7N A;  3HME A;  4NYV A;  4QC3 A;  2OSS A;  5EWW A;  5H1U A;  5EIS A;  5F2P A;  4Q0O A;  5F61 A;  5D25 A;  4A9K A;  4HXM A;  4C67 A;  4TZ8 A;  4BW1 A;  4UIX A;  1JSP B;  5I89 A;  5C8G A;  5K29 A;  4YAB A;  4QUT A;  4NR7 A;  5BT4 A;  5EPB A;  2DWW A;  4YY4 A;  4NUC A;  5DKD A;  5E0R A;  5KU3 A;  2E7O A;  5CUA A;  4LYW A;  4HBV A;  3O34 A;  4HXS A;  3ONI A;  3LQI A;  3GG3 A;  5FH6 A;  5D3N A;  5D3L A;  5A5N A;  5CP5 A;  4PCE A;  3S92 A;  5I7Y A;  3O35 A;  5L99 A;  2DVV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...