4YYGA

Crystal structure of brd9 bromodomain bound to a butyryllysine peptide
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
100
structure length
100
Chain Sequence
TPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDFGTMKDKIVANEYKSVTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Bromodomain-containing protein 9
publication title A Subset of Human Bromodomains Recognizes Butyryllysine and Crotonyllysine Histone Peptide Modifications.
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2015-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4yygA00
5IIDA 5DFDA 4UYDA 3U5JA 5KTUA 3ONIA 5HQ5A 5KTWA 5EWVA 4QC3A 5C87A 5HCLA 5ACYA 3UVWA 4N4FA 3P1CA 4HXPA 4YYGA 4IR3A 2D82A 5CQ8A 2DATA 3SVFA 4YBMA 2RFJA 3LQIA 4A9FA 3P1DA 5ETDA 5H1UA 4ZC9A 4TZ8A 5A83A 2DVVA 4CFKA 4XYAA 4BHWA 2YDWA 4E96A 3FKMX 3S92A 5EGUA 3DAIA 5J0DA 2H60A 4J1PA 2LSPB 3HMHA 4QBMA 1E6IA 4HBWA 5FH7A 3JVMA 4QSXA 5D25A 4UIZA 2R0SA 3UVDA 5FE4A 3MB3A 5HJCA 5F25A 5FFWA 5DKCA 5HM0A 3QZVA 4LYWA 4O76A 5D24A 5EV9A 4LZSA 4FLPA 4UIWA 5LKUA 1JM4B 2WP1A 5H85A 4A9MA 5E9MA 2N9GA 5IBNA 1X0JA 4NXJA 5D3PA 4IR4A 5DX4A 2YEKA 2YELA 3O33A 5FFYA 4NR7A 3LQJA 4O78A 5EISA 5KTXA 4YYDA 4Z6IA 5A5OA 5CUEA 4WHUA 5I86A 4NYWA 4HXMA 5CUDA 5FE1A 5DY7A 5HRXA 4YYNA 2DVSA 4MR6A 4LDFA 3UW9A 5JWMA 4MEPA 2L5EA 5F2PA 5E3GA 4O7BA 2I7KA 4PCEA 5FB1A 2DVQA 5CUAA 4XUBA 5HQ7A 3DWYA 5I89A 4BW1A 5DYCA 5LKXA 4HXOA 5A5PA 5D7XA 5ETBA 5CGPA 4BW4A 5ENFA 5L97A 4QYLA 2OSSA 4QSVA 4YH3A 4WIVA 5EICA 5A5NA 4YYIA 3HMEA 4MR4A 5EP7A 3O35A 5D3JA 5K29A 5EK9A 5HELA 4QEUA 5E9VA 5FB0A 4TS8A 3I3JA 5DKDA 4ALHA 4NR8A 5FG4A 3U5PA 4QEWA 3LJWA 4TTEA 4O7EA 2E7NA 3IU6A 5A82A 4Z6HA 4QR5A 4NRAA 4QSSA 4A9JA 4LC2A 4UIVA 5EWDA 5I40A 5KHMA 4A9OA 5D0CA 4C66A 5FE8A 5F1LA 3GG3A 4J0RA 4QSRA 4PS5A 4UIXA 4CUQA 5F5ZA 5D3HA 4YYMA 3U5MA 5CUCA 5I83A 5FE6A 5CU8A 5L96A 3U5OA 5CS8A 2F6JA 4BJXA 5FH6A 4O77A 5IG6A 3SVHA 4BW2A 3Q2EA 4QYDA 5DW2A 4A9KA 4CLBA 5I7XA 5ENJA 4IOOA 5F3AA 2RS9B 4O75A 5EPBA 4HXNA 3UV2A 4A9NA 4QR3A 2YQDA 4YC9A 4QSWA 5I7YA 5E9LA 3QZSA 2KTBB 4NS5A 2YEMA 5CQ7A 5BT5A 4YATA 3RCWA 4CURA 5F60A 5D3RA 2G4AA 4HBVA 3P1FA 5FBXA 4NUDA 4YABA 5BT4A 5DBMA 4CUUA 4F3IA 4Y03A 5I80A 5I88A 2RNXA 4YY4A 4NRCA 4NR4A 4HXRA 5D3SA 3MUKA 5EU1A 5L8UA 5EPSA 4J3IA 4UITA 5CUBA 4C67A 5E3DA 5HFQA 5I29A 3MULA 4LYSA 5JI8A 3LQHA 5I1QA 4X2IA 3G0LA 4YAXA 4CUSA 3JVKA 5E9KA 4TU4A 4CUPA 5H1VA 4YYHA 5HEMA 4UIYA 5ENBA 4NR5A 5FDZA 5EI4A 5IGLA 4TT4A 4ZQLA 4QC1A 4NUCA 5TCMA 5CRMA 5EQ1A 2E3KA 5LVQA 5EWCA 4HBYA 4XY8A 4NR6A 5CQTA 5D3LA 5LKTA 3U5KA 4MR5A 5IGNA 5ENHA 4YH4A 4N4HA 5E9YA 5CY9A 2MJVB 5ENGA 3JVLA 2OUOA 4O70A 5FE0A 4PKLA 4WHWA 4TYLA 1WUGA 4Q0OA 4NYXA 2RI7A 5BT3A 4YADA 2R10A 5CTLA 5DYUA 5G4RA 2YYNA 5FG5A 4N4GA 4QSUA 2GRCA 1ZS5A 5COIA 4MEOA 3UV5A 5FH8A 5KO4A 5EM3A 5KU3A 3K2JA 1EQFA 5FE5A 3SVGA 5DKHA 5DFBA 5LJ2A 5CFWA 4YYKA 5E9IA 4Q0NA 5LKZA 2E7OA 4A9IA 5FFVA 1JSPB 2YW5A 4KCXA 4UYEA 4QSQA 5DYAA 5D26A 4O71A 2I8NA 4HBXA 4N3WA 2RNWA 4RVRA 3MXFA 4NUEA 5EWWA 5LJ0A 4PCIA 5A5SA 4MEQA 5HQ6A 4NQNA 5G4SA 4YY6A 5EVAA 5FE9A 2DWWA 3O37A 1F68A 5HRVA 5A5RA 4ZW1A 4Z93A 5L8TA 3AQAA 2L85A 4TQNA 5CQ4A 4KV1A 4NRBA 4TU6A 5L98A 5C4QA 3D7CA 4HXSA 4UIUA 3MB4A 2FSAA 4NR9A 4TZ2A 4QSTA 5LVRA 5II1A 3P1EA 2WP2A 5H1TA 2R0VA 4QB3A 4QUTA 4LR6A 5DW1A 4J0SA 3QZTA 5II2A 4CUTA 5CPEA 4IR5A 5CUGA 5F36A 4QUUA 5TB6A 5CQ6A 4NQMA 3U5LA 4QEVA 5EA1A 5L99A 4Z1SA 4LZRA 5CQAA 4LZ2A 5C7NA 3Q2FA 2DKWA 5EPRA 5FE2A 3LXJA 4ALGA 5IGKA 4N4IA 5A7CA 4LYIA 4TT6A 3UVXA 3UV4A 4PY6A 4UYGA 4UYFA 4YBTA 3HMFA 5FE7A 4IOQA 5ENCA 4A9EA 4QNSA 4OUFA 3NXBA 5A81A 2RNYA 2NXBA 3AADA 4A9HA 4OGJA 4CL9A 3U5NA 4GPJA 4BW3A 5F62A 5CP5A 5F61A 5C85A 2DVRA 3JVJA 3UVYA 4DONA 3O34A 5CZGA 5C8GA 5F63A 4QY4A 5HENA 5LUUA 5AMEA 2D9EA 2R0YA 4XY9A 4MENA 5HLSA 4CFLA 4NYVA 4O7FA 5A85A 5D3NA 4Z1QA 4AKNA 4O7CA 5D3TA 5CQ5A 5IGMA 3TLPA 1WUMA 4O72A 5F1HA 3ZYUA 5A5QA 5E0RA 4TT2A 5DYXA 5CQ3A 5AD2A 5AD3A 3IU5A 4QR4A 5E73A 5ENIA 5E74A 4O7AA 4XUAA 5LJ1A 4LRGA 2RO1A 5C89A 4QSPA 3G0JA 5EWHA 5DLZA 3MQMA 2L84A 4HXLA 2F6NA 5DLXA 4OGIA 2OO1A 3P5OA 4IORA 4O74A 5DFCA 4YYJA 5CRZA 5HFRA 4YBSA 4A9LA 5FG6A 5E7DA 3O36A 4KV4A 4IR6A 5FE3A 4UYFB 1N72A 4MR3A 4HXKA 4PTBA 4UYHA 5HRWA 5AMFA 4QZSA 4YK0A 3S91A 5ENEA
chains in the Genus database with same CATH superfamily
5IIDA 5DFDA 4UYDA 1ZKRA 5KTUA 3U5JA 3ONIA 5HQ5A 5KTWA 5EWVA 4QC3A 5C87A 5HCLA 5ACYA 3UVWA 4N4FA 3P1CA 4HXPA 4YYGA 4IR3A 2D82A 5CQ8A 2DATA 3SVFA 4YBMA 2RFJA 3LQIA 4AI6A 4A9FA 3P1DA 5ETDA 5H1UA 4ZC9A 4TZ8A 5A83A 2DVVA 4CFKA 4XYAA 4BHWA 2YDWA 4E96A 3FKMX 3S92A 5EGUA 3DAIA 5J0DA 2H60A 4J1PA 2LSPB 3HMHA 4QBMA 1E6IA 4HBWA 5FH7A 3JVMA 4QSXA 5D25A 4UIZA 2R0SA 3UVDA 5FE4A 3MB3A 5HJCA 5F25A 5FFWA 5DKCA 5HM0A 3QZVA 4LYWA 4O76A 5D24A 5EV9A 4LZSA 4FLPA 4UIWA 5LKUA 1JM4B 2WP1A 5H85A 4A9MA 5E9MA 2N9GA 5IBNA 1X0JA 4NXJA 5D3PA 4IR4A 5DX4A 2YEKA 2YELA 3O33A 5FFYA 4NR7A 3ERRA 3LQJA 4O78A 5EISA 5KTXA 4YYDA 4Z6IA 5A5OA 5CUEA 4WHUA 5I86A 4NYWA 4HXMA 5CUDA 5FE1A 5DY7A 5HRXA 4YYNA 2DVSA 4MR6A 4LDFA 3UW9A 5JWMA 4MEPA 2L5EA 5F2PA 5E3GA 4O7BA 2I7KA 4PCEA 5FB1A 2DVQA 5CUAA 4XUBA 5HQ7A 3DWYA 5I89A 4BW1A 5DYCA 5LKXA 4HXOA 5A5PA 5D7XA 5ETBA 5CGPA 4BW4A 5ENFA 5L97A 4QYLA 2OSSA 4QSVA 4YH3A 4WIVA 5EICA 5A5NA 4YYIA 3HMEA 4MR4A 5EP7A 3O35A 5D3JA 5K29A 5EK9A 5HELA 4AKHA 4QEUA 5E9VA 5FB0A 4TS8A 3I3JA 5DKDA 4ALHA 2EJNA 4NR8A 5FG4A 3U5PA 4QEWA 3LJWA 4TTEA 4O7EA 2E7NA 3IU6A 5A82A 4Z6HA 4QR5A 4NRAA 4QSSA 4A9JA 4LC2A 4UIVA 5EWDA 5I40A 5KHMA 4A9OA 5D0CA 4C66A 5FE8A 5F1LA 3GG3A 4J0RA 4QSRA 4PS5A 4UIXA 4CUQA 5F5ZA 5D3HA 4YYMA 3U5MA 5CUCA 5I83A 5FE6A 5CU8A 5L96A 3U5OA 5CS8A 2F6JA 4BJXA 5FH6A 4O77A 5IG6A 3SVHA 4BW2A 3Q2EA 4QYDA 5DW2A 4A9KA 4CLBA 5I7XA 5ENJA 4IOOA 5F3AA 2RS9B 4O75A 5EPBA 4HXNA 3UV2A 4A9NA 4QR3A 2YQDA 4YC9A 4QSWA 5I7YA 5E9LA 3QZSA 2KTBB 4NS5A 2YEMA 5CQ7A 5BT5A 4YATA 3RCWA 4CURA 5F60A 5D3RA 1PUOA 2G4AA 4HBVA 3P1FA 5FBXA 4NUDA 4YABA 5BT4A 5DBMA 4CUUA 4F3IA 4Y03A 5I80A 5I88A 2RNXA 4YY4A 4NRCA 4NR4A 4HXRA 5D3SA 3MUKA 5EU1A 5L8UA 5EPSA 4J3IA 4UITA 5CUBA 4C67A 5E3DA 5HFQA 5I29A 3MULA 4LYSA 5JI8A 3LQHA 5I1QA 4X2IA 3G0LA 4YAXA 4CUSA 3JVKA 5E9KA 4TU4A 4CUPA 5H1VA 4YYHA 5HEMA 4UIYA 5ENBA 4NR5A 5FDZA 5EI4A 5IGLA 4TT4A 4ZQLA 4QC1A 4NUCA 5TCMA 5CRMA 5EQ1A 2E3KA 5LVQA 5EWCA 4HBYA 4XY8A 4NR6A 5CQTA 5D3LA 5LKTA 3U5KA 3D1BA 4MR5A 5IGNA 5ENHA 4YH4A 4N4HA 5E9YA 5CY9A 2MJVB 5ENGA 3JVLA 2OUOA 4O70A 5FE0A 4PKLA 4WHWA 4TYLA 1WUGA 4Q0OA 4AKIA 4NYXA 2RI7A 5BT3A 4YADA 2R10A 5CTLA 5DYUA 5G4RA 2YYNA 5FG5A 4N4GA 4QSUA 2GRCA 1ZS5A 5COIA 4MEOA 3UV5A 5FH8A 5KO4A 5EM3A 5KU3A 3K2JA 1EQFA 5FE5A 3SVGA 5DKHA 5DFBA 5LJ2A 3VKHA 5CFWA 4YYKA 5E9IA 4Q0NA 5LKZA 2E7OA 4A9IA 5FFVA 1JSPB 2YW5A 4KCXA 4UYEA 4QSQA 5DYAA 5D26A 4O71A 2I8NA 4HBXA 4N3WA 2RNWA 4RVRA 3MXFA 4NUEA 5EWWA 5LJ0A 4PCIA 5A5SA 4MEQA 5HQ6A 4NQNA 5G4SA 4YY6A 5EVAA 5FE9A 2DWWA 3O37A 1F68A 5HRVA 5A5RA 4ZW1A 4Z93A 5L8TA 3AQAA 2L85A 5CQ4A 4TQNA 4KV1A 4NRBA 4TU6A 5L98A 5C4QA 3D7CA 4HXSA 4UIUA 3MB4A 2FSAA 4NR9A 4TZ2A 4QSTA 5LVRA 5II1A 3P1EA 2WP2A 5H1TA 2R0VA 4QB3A 4QUTA 4LR6A 5DW1A 4J0SA 3QZTA 5II2A 4CUTA 5CPEA 4IR5A 5CUGA 5F36A 4QUUA 5TB6A 5CQ6A 4NQMA 3U5LA 4QEVA 5EA1A 5L99A 4Z1SA 4LZRA 5CQAA 4LZ2A 5C7NA 3Q2FA 2DKWA 5EPRA 5FE2A 4AKGA 3LXJA 4ALGA 5IGKA 4N4IA 5A7CA 4LYIA 4TT6A 3UVXA 3UV4A 4PY6A 4UYGA 4UYFA 4YBTA 3HMFA 5FE7A 4IOQA 5ENCA 4A9EA 4QNSA 4OUFA 3NXBA 5A81A 2RNYA 2NXBA 3AADA 4A9HA 4OGJA 4CL9A 3U5NA 4GPJA 4BW3A 5F62A 5CP5A 5F61A 5C85A 2DVRA 3JVJA 3UVYA 4DONA 3O34A 5CZGA 5C8GA 5F63A 4QY4A 5HENA 5LUUA 5AMEA 2D9EA 2R0YA 4XY9A 4MENA 5HLSA 4CFLA 4NYVA 4O7FA 5A85A 5D3NA 4Z1QA 4AKNA 4O7CA 5D3TA 5CQ5A 5IGMA 3TLPA 1WUMA 4O72A 5F1HA 3ZYUA 5A5QA 5E0RA 3D1DA 4TT2A 5DYXA 5CQ3A 5AD2A 5AD3A 3IU5A 4QR4A 5E73A 5ENIA 5E74A 4O7AA 4XUAA 5LJ1A 4LRGA 2RO1A 5C89A 4QSPA 3G0JA 5EWHA 5DLZA 3MQMA 2L84A 4HXLA 2F6NA 5DLXA 4OGIA 2OO1A 3P5OA 4IORA 4O74A 5DFCA 4YYJA 5CRZA 5HFRA 4YBSA 4A9LA 5FG6A 5E7DA 3VKGA 3O36A 4KV4A 4IR6A 5FE3A 4UYFB 1N72A 4MR3A 4HXKA 4PTBA 4UYHA 5HRWA 5AMFA 4QZSA 4YK0A 3S91A 5ENEA
chains in the Genus database with same CATH topology
5IIDA 5DFDA 4UYDA 3U5JA 5KTUA 3ONIA 5HQ5A 5KTWA 5EWVA 4QC3A 5C87A 5HCLA 5ACYA 3UVWA 4N4FA 3P1CA 4HXPA 4YYGA 4IR3A 2D82A 5CQ8A 2DATA 3SVFA 4YBMA 2RFJA 3LQIA 4A9FA 3P1DA 5ETDA 5H1UA 4ZC9A 4TZ8A 5A83A 2DVVA 4CFKA 4XYAA 4BHWA 2YDWA 4E96A 3FKMX 3S92A 5EGUA 3DAIA 5J0DA 2H60A 4J1PA 2LSPB 3HMHA 4QBMA 1E6IA 4HBWA 5FH7A 3JVMA 4QSXA 5D25A 4UIZA 2R0SA 3UVDA 5FE4A 3MB3A 5HJCA 5F25A 5FFWA 5DKCA 5HM0A 3QZVA 4LYWA 4O76A 5D24A 5EV9A 4LZSA 4FLPA 4UIWA 5LKUA 1JM4B 2WP1A 5H85A 4A9MA 5E9MA 2N9GA 5IBNA 1X0JA 4NXJA 5D3PA 4IR4A 5DX4A 2YEKA 2YELA 3O33A 5FFYA 4NR7A 3LQJA 4O78A 5EISA 5KTXA 4YYDA 4Z6IA 5A5OA 5CUEA 4WHUA 5I86A 4NYWA 4HXMA 5CUDA 5FE1A 5DY7A 5HRXA 4YYNA 2DVSA 4MR6A 4LDFA 3UW9A 5JWMA 4MEPA 2L5EA 5F2PA 5E3GA 4O7BA 2I7KA 4PCEA 5FB1A 2DVQA 5CUAA 4XUBA 5HQ7A 3DWYA 5I89A 4BW1A 5DYCA 5LKXA 4HXOA 5A5PA 5D7XA 5ETBA 5CGPA 4BW4A 5ENFA 5L97A 4QYLA 2OSSA 4QSVA 4YH3A 4WIVA 5EICA 5A5NA 4YYIA 3HMEA 4MR4A 5EP7A 3O35A 5D3JA 5K29A 5EK9A 5HELA 4QEUA 5E9VA 5FB0A 4TS8A 3I3JA 5DKDA 4ALHA 4NR8A 5FG4A 3U5PA 4QEWA 3LJWA 4TTEA 4O7EA 2E7NA 3IU6A 5A82A 4Z6HA 4QR5A 4NRAA 4QSSA 4A9JA 4LC2A 4UIVA 5EWDA 5I40A 5KHMA 4A9OA 5D0CA 4C66A 5FE8A 5F1LA 3GG3A 4J0RA 4QSRA 4PS5A 4UIXA 4CUQA 5F5ZA 5D3HA 4YYMA 3U5MA 5CUCA 5I83A 5FE6A 5CU8A 5L96A 3U5OA 5CS8A 2F6JA 4BJXA 5FH6A 4O77A 5IG6A 3SVHA 4BW2A 3Q2EA 4QYDA 5DW2A 4A9KA 4CLBA 5I7XA 5ENJA 4IOOA 5F3AA 2RS9B 4O75A 5EPBA 4HXNA 3UV2A 4A9NA 4QR3A 2YQDA 4YC9A 4QSWA 5I7YA 5E9LA 3QZSA 2KTBB 4NS5A 2YEMA 5CQ7A 5BT5A 4YATA 3RCWA 4CURA 5F60A 5D3RA 2G4AA 4HBVA 3P1FA 5FBXA 4NUDA 4YABA 5BT4A 5DBMA 4CUUA 4F3IA 4Y03A 5I80A 5I88A 2RNXA 4YY4A 4NRCA 4NR4A 4HXRA 5D3SA 3MUKA 5EU1A 5L8UA 5EPSA 4J3IA 4UITA 5CUBA 4C67A 5E3DA 5HFQA 5I29A 3MULA 4LYSA 5JI8A 3LQHA 5I1QA 4X2IA 3G0LA 4YAXA 4CUSA 3JVKA 5E9KA 4TU4A 4CUPA 5H1VA 4YYHA 5HEMA 4UIYA 5ENBA 4NR5A 5FDZA 5EI4A 5IGLA 4TT4A 4ZQLA 4QC1A 4NUCA 5TCMA 5CRMA 5EQ1A 2E3KA 5LVQA 5EWCA 4HBYA 4XY8A 4NR6A 5CQTA 5D3LA 5LKTA 3U5KA 4MR5A 5IGNA 5ENHA 4YH4A 4N4HA 5E9YA 5CY9A 2MJVB 5ENGA 3JVLA 2OUOA 4O70A 5FE0A 4PKLA 4WHWA 4TYLA 1WUGA 4Q0OA 4NYXA 2RI7A 5BT3A 4YADA 2R10A 5CTLA 5DYUA 5G4RA 2YYNA 5FG5A 4N4GA 4QSUA 2GRCA 1ZS5A 5COIA 4MEOA 3UV5A 5FH8A 5KO4A 5EM3A 5KU3A 3K2JA 1EQFA 5FE5A 3SVGA 5DKHA 5DFBA 5LJ2A 5CFWA 4YYKA 5E9IA 4Q0NA 5LKZA 2E7OA 4A9IA 5FFVA 1JSPB 2YW5A 4KCXA 4UYEA 4QSQA 5DYAA 5D26A 4O71A 2I8NA 4HBXA 4N3WA 2RNWA 4RVRA 3MXFA 4NUEA 5EWWA 5LJ0A 4PCIA 5A5SA 4MEQA 5HQ6A 4NQNA 5G4SA 4YY6A 5EVAA 5FE9A 2DWWA 3O37A 1F68A 5HRVA 5A5RA 4ZW1A 4Z93A 5L8TA 3AQAA 2L85A 4TQNA 5CQ4A 4KV1A 4NRBA 4TU6A 5L98A 5C4QA 3D7CA 4HXSA 4UIUA 3MB4A 2FSAA 4NR9A 4TZ2A 4QSTA 5LVRA 5II1A 3P1EA 2WP2A 5H1TA 2R0VA 4QB3A 4QUTA 4LR6A 5DW1A 4J0SA 3QZTA 5II2A 4CUTA 5CPEA 4IR5A 5CUGA 5F36A 4QUUA 5TB6A 5CQ6A 4NQMA 3U5LA 4QEVA 5EA1A 5L99A 4Z1SA 4LZRA 5CQAA 4LZ2A 5C7NA 3Q2FA 2DKWA 5EPRA 5FE2A 3LXJA 4ALGA 5IGKA 4N4IA 5A7CA 4LYIA 4TT6A 3UVXA 3UV4A 4PY6A 4UYGA 4UYFA 4YBTA 3HMFA 5FE7A 4IOQA 5ENCA 4A9EA 4QNSA 4OUFA 3NXBA 5A81A 2RNYA 2NXBA 3AADA 4A9HA 4OGJA 4CL9A 3U5NA 4GPJA 4BW3A 5F62A 5CP5A 5F61A 5C85A 2DVRA 3JVJA 3UVYA 4DONA 3O34A 5CZGA 5C8GA 5F63A 4QY4A 5HENA 5LUUA 5AMEA 2D9EA 2R0YA 4XY9A 4MENA 5HLSA 4CFLA 4NYVA 4O7FA 5A85A 5D3NA 4Z1QA 4AKNA 4O7CA 5D3TA 5CQ5A 5IGMA 3TLPA 1WUMA 4O72A 5F1HA 3ZYUA 5A5QA 5E0RA 4TT2A 5DYXA 5CQ3A 5AD2A 5AD3A 3IU5A 4QR4A 5E73A 5ENIA 5E74A 4O7AA 4XUAA 5LJ1A 4LRGA 2RO1A 5C89A 4QSPA 3G0JA 5EWHA 5DLZA 3MQMA 2L84A 4HXLA 2F6NA 5DLXA 4OGIA 2OO1A 3P5OA 4IORA 4O74A 5DFCA 4YYJA 5CRZA 5HFRA 4YBSA 4A9LA 5FG6A 5E7DA 3O36A 4KV4A 4IR6A 5FE3A 4UYFB 1N72A 4MR3A 4HXKA 4PTBA 4UYHA 5HRWA 5AMFA 4QZSA 4YK0A 3S91A 5ENEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IID A;  5DFD A;  4UYD A;  3U5J A;  5KTU A;  3ONI A;  5HQ5 A;  5KTW A;  5EWV A;  4QC3 A;  5C87 A;  5HCL A;  5ACY A;  3UVW A;  4N4F A;  3P1C A;  4HXP A;  4YYG A;  4IR3 A;  2D82 A;  5CQ8 A;  2DAT A;  3SVF A;  4YBM A;  2RFJ A;  3LQI A;  4A9F A;  3P1D A;  5ETD A;  5H1U A;  4ZC9 A;  4TZ8 A;  5A83 A;  2DVV A;  4CFK A;  4XYA A;  4BHW A;  2YDW A;  4E96 A;  3FKM X;  3S92 A;  5EGU A;  3DAI A;  5J0D A;  2H60 A;  4J1P A;  2LSP B;  3HMH A;  4QBM A;  1E6I A;  4HBW A;  5FH7 A;  3JVM A;  4QSX A;  5D25 A;  4UIZ A;  2R0S A;  3UVD A;  5FE4 A;  3MB3 A;  5HJC A;  5F25 A;  5FFW A;  5DKC A;  5HM0 A;  3QZV A;  4LYW A;  4O76 A;  5D24 A;  5EV9 A;  4LZS A;  4FLP A;  4UIW A;  5LKU A;  1JM4 B;  2WP1 A;  5H85 A;  4A9M A;  5E9M A;  2N9G A;  5IBN A;  1X0J A;  4NXJ A;  5D3P A;  4IR4 A;  5DX4 A;  2YEK A;  2YEL A;  3O33 A;  5FFY A;  4NR7 A;  3LQJ A;  4O78 A;  5EIS A;  5KTX A;  4YYD A;  4Z6I A;  5A5O A;  5CUE A;  4WHU A;  5I86 A;  4NYW A;  4HXM A;  5CUD A;  5FE1 A;  5DY7 A;  5HRX A;  4YYN A;  2DVS A;  4MR6 A;  4LDF A;  3UW9 A;  5JWM A;  4MEP A;  2L5E A;  5F2P A;  5E3G A;  4O7B A;  2I7K A;  4PCE A;  5FB1 A;  2DVQ A;  5CUA A;  4XUB A;  5HQ7 A;  3DWY A;  5I89 A;  4BW1 A;  5DYC A;  5LKX A;  4HXO A;  5A5P A;  5D7X A;  5ETB A;  5CGP A;  4BW4 A;  5ENF A;  5L97 A;  4QYL A;  2OSS A;  4QSV A;  4YH3 A;  4WIV A;  5EIC A;  5A5N A;  4YYI A;  3HME A;  4MR4 A;  5EP7 A;  3O35 A;  5D3J A;  5K29 A;  5EK9 A;  5HEL A;  4QEU A;  5E9V A;  5FB0 A;  4TS8 A;  3I3J A;  5DKD A;  4ALH A;  4NR8 A;  5FG4 A;  3U5P A;  4QEW A;  3LJW A;  4TTE A;  4O7E A;  2E7N A;  3IU6 A;  5A82 A;  4Z6H A;  4QR5 A;  4NRA A;  4QSS A;  4A9J A;  4LC2 A;  4UIV A;  5EWD A;  5I40 A;  5KHM A;  4A9O A;  5D0C A;  4C66 A;  5FE8 A;  5F1L A;  3GG3 A;  4J0R A;  4QSR A;  4PS5 A;  4UIX A;  4CUQ A;  5F5Z A;  5D3H A;  4YYM A;  3U5M A;  5CUC A;  5I83 A;  5FE6 A;  5CU8 A;  5L96 A;  3U5O A;  5CS8 A;  2F6J A;  4BJX A;  5FH6 A;  4O77 A;  5IG6 A;  3SVH A;  4BW2 A;  3Q2E A;  4QYD A;  5DW2 A;  4A9K A;  4CLB A;  5I7X A;  5ENJ A;  4IOO A;  5F3A A;  2RS9 B;  4O75 A;  5EPB A;  4HXN A;  3UV2 A;  4A9N A;  4QR3 A;  2YQD A;  4YC9 A;  4QSW A;  5I7Y A;  5E9L A;  3QZS A;  2KTB B;  4NS5 A;  2YEM A;  5CQ7 A;  5BT5 A;  4YAT A;  3RCW A;  4CUR A;  5F60 A;  5D3R A;  2G4A A;  4HBV A;  3P1F A;  5FBX A;  4NUD A;  4YAB A;  5BT4 A;  5DBM A;  4CUU A;  4F3I A;  4Y03 A;  5I80 A;  5I88 A;  2RNX A;  4YY4 A;  4NRC A;  4NR4 A;  4HXR A;  5D3S A;  3MUK A;  5EU1 A;  5L8U A;  5EPS A;  4J3I A;  4UIT A;  5CUB A;  4C67 A;  5E3D A;  5HFQ A;  5I29 A;  3MUL A;  4LYS A;  5JI8 A;  3LQH A;  5I1Q A;  4X2I A;  3G0L A;  4YAX A;  4CUS A;  3JVK A;  5E9K A;  4TU4 A;  4CUP A;  5H1V A;  4YYH A;  5HEM A;  4UIY A;  5ENB A;  4NR5 A;  5FDZ A;  5EI4 A;  5IGL A;  4TT4 A;  4ZQL A;  4QC1 A;  4NUC A;  5TCM A;  5CRM A;  5EQ1 A;  2E3K A;  5LVQ A;  5EWC A;  4HBY A;  4XY8 A;  4NR6 A;  5CQT A;  5D3L A;  5LKT A;  3U5K A;  4MR5 A;  5IGN A;  5ENH A;  4YH4 A;  4N4H A;  5E9Y A;  5CY9 A;  2MJV B;  5ENG A;  3JVL A;  2OUO A;  4O70 A;  5FE0 A;  4PKL A;  4WHW A;  4TYL A;  1WUG A;  4Q0O A;  4NYX A;  2RI7 A;  5BT3 A;  4YAD A;  2R10 A;  5CTL A;  5DYU A;  5G4R A;  2YYN A;  5FG5 A;  4N4G A;  4QSU A;  2GRC A;  1ZS5 A;  5COI A;  4MEO A;  3UV5 A;  5FH8 A;  5KO4 A;  5EM3 A;  5KU3 A;  3K2J A;  1EQF A;  5FE5 A;  3SVG A;  5DKH A;  5DFB A;  5LJ2 A;  5CFW A;  4YYK A;  5E9I A;  4Q0N A;  5LKZ A;  2E7O A;  4A9I A;  5FFV A;  1JSP B;  2YW5 A;  4KCX A;  4UYE A;  4QSQ A;  5DYA A;  5D26 A;  4O71 A;  2I8N A;  4HBX A;  4N3W A;  2RNW A;  4RVR A;  3MXF A;  4NUE A;  5EWW A;  5LJ0 A;  4PCI A;  5A5S A;  4MEQ A;  5HQ6 A;  4NQN A;  5G4S A;  4YY6 A;  5EVA A;  5FE9 A;  2DWW A;  3O37 A;  1F68 A;  5HRV A;  5A5R A;  4ZW1 A;  4Z93 A;  5L8T A;  3AQA A;  2L85 A;  4TQN A;  5CQ4 A;  4KV1 A;  4NRB A;  4TU6 A;  5L98 A;  5C4Q A;  3D7C A;  4HXS A;  4UIU A;  3MB4 A;  2FSA A;  4NR9 A;  4TZ2 A;  4QST A;  5LVR A;  5II1 A;  3P1E A;  2WP2 A;  5H1T A;  2R0V A;  4QB3 A;  4QUT A;  4LR6 A;  5DW1 A;  4J0S A;  3QZT A;  5II2 A;  4CUT A;  5CPE A;  4IR5 A;  5CUG A;  5F36 A;  4QUU A;  5TB6 A;  5CQ6 A;  4NQM A;  3U5L A;  4QEV A;  5EA1 A;  5L99 A;  4Z1S A;  4LZR A;  5CQA A;  4LZ2 A;  5C7N A;  3Q2F A;  2DKW A;  5EPR A;  5FE2 A;  3LXJ A;  4ALG A;  5IGK A;  4N4I A;  5A7C A;  4LYI A;  4TT6 A;  3UVX A;  3UV4 A;  4PY6 A;  4UYG A;  4UYF A;  4YBT A;  3HMF A;  5FE7 A;  4IOQ A;  5ENC A;  4A9E A;  4QNS A;  4OUF A;  3NXB A;  5A81 A;  2RNY A;  2NXB A;  3AAD A;  4A9H A;  4OGJ A;  4CL9 A;  3U5N A;  4GPJ A;  4BW3 A;  5F62 A;  5CP5 A;  5F61 A;  5C85 A;  2DVR A;  3JVJ A;  3UVY A;  4DON A;  3O34 A;  5CZG A;  5C8G A;  5F63 A;  4QY4 A;  5HEN A;  5LUU A;  5AME A;  2D9E A;  2R0Y A;  4XY9 A;  4MEN A;  5HLS A;  4CFL A;  4NYV A;  4O7F A;  5A85 A;  5D3N A;  4Z1Q A;  4AKN A;  4O7C A;  5D3T A;  5CQ5 A;  5IGM A;  3TLP A;  1WUM A;  4O72 A;  5F1H A;  3ZYU A;  5A5Q A;  5E0R A;  4TT2 A;  5DYX A;  5CQ3 A;  5AD2 A;  5AD3 A;  3IU5 A;  4QR4 A;  5E73 A;  5ENI A;  5E74 A;  4O7A A;  4XUA A;  5LJ1 A;  4LRG A;  2RO1 A;  5C89 A;  4QSP A;  3G0J A;  5EWH A;  5DLZ A;  3MQM A;  2L84 A;  4HXL A;  2F6N A;  5DLX A;  4OGI A;  2OO1 A;  3P5O A;  4IOR A;  4O74 A;  5DFC A;  4YYJ A;  5CRZ A;  5HFR A;  4YBS A;  4A9L A;  5FG6 A;  5E7D A;  3O36 A;  4KV4 A;  4IR6 A;  5FE3 A;  4UYF B;  1N72 A;  4MR3 A;  4HXK A;  4PTB A;  4UYH A;  5HRW A;  5AMF A;  4QZS A;  4YK0 A;  3S91 A;  5ENE A; 
#chains in the Genus database with same CATH topology
 5IID A;  5DFD A;  4UYD A;  1ZKR A;  5KTU A;  3U5J A;  3ONI A;  5HQ5 A;  5KTW A;  5EWV A;  4QC3 A;  5C87 A;  5HCL A;  5ACY A;  3UVW A;  4N4F A;  3P1C A;  4HXP A;  4YYG A;  4IR3 A;  2D82 A;  5CQ8 A;  2DAT A;  3SVF A;  4YBM A;  2RFJ A;  3LQI A;  4AI6 A;  4A9F A;  3P1D A;  5ETD A;  5H1U A;  4ZC9 A;  4TZ8 A;  5A83 A;  2DVV A;  4CFK A;  4XYA A;  4BHW A;  2YDW A;  4E96 A;  3FKM X;  3S92 A;  5EGU A;  3DAI A;  5J0D A;  2H60 A;  4J1P A;  2LSP B;  3HMH A;  4QBM A;  1E6I A;  4HBW A;  5FH7 A;  3JVM A;  4QSX A;  5D25 A;  4UIZ A;  2R0S A;  3UVD A;  5FE4 A;  3MB3 A;  5HJC A;  5F25 A;  5FFW A;  5DKC A;  5HM0 A;  3QZV A;  4LYW A;  4O76 A;  5D24 A;  5EV9 A;  4LZS A;  4FLP A;  4UIW A;  5LKU A;  1JM4 B;  2WP1 A;  5H85 A;  4A9M A;  5E9M A;  2N9G A;  5IBN A;  1X0J A;  4NXJ A;  5D3P A;  4IR4 A;  5DX4 A;  2YEK A;  2YEL A;  3O33 A;  5FFY A;  4NR7 A;  3ERR A;  3LQJ A;  4O78 A;  5EIS A;  5KTX A;  4YYD A;  4Z6I A;  5A5O A;  5CUE A;  4WHU A;  5I86 A;  4NYW A;  4HXM A;  5CUD A;  5FE1 A;  5DY7 A;  5HRX A;  4YYN A;  2DVS A;  4MR6 A;  4LDF A;  3UW9 A;  5JWM A;  4MEP A;  2L5E A;  5F2P A;  5E3G A;  4O7B A;  2I7K A;  4PCE A;  5FB1 A;  2DVQ A;  5CUA A;  4XUB A;  5HQ7 A;  3DWY A;  5I89 A;  4BW1 A;  5DYC A;  5LKX A;  4HXO A;  5A5P A;  5D7X A;  5ETB A;  5CGP A;  4BW4 A;  5ENF A;  5L97 A;  4QYL A;  2OSS A;  4QSV A;  4YH3 A;  4WIV A;  5EIC A;  5A5N A;  4YYI A;  3HME A;  4MR4 A;  5EP7 A;  3O35 A;  5D3J A;  5K29 A;  5EK9 A;  5HEL A;  4AKH A;  4QEU A;  5E9V A;  5FB0 A;  4TS8 A;  3I3J A;  5DKD A;  4ALH A;  2EJN A;  4NR8 A;  5FG4 A;  3U5P A;  4QEW A;  3LJW A;  4TTE A;  4O7E A;  2E7N A;  3IU6 A;  5A82 A;  4Z6H A;  4QR5 A;  4NRA A;  4QSS A;  4A9J A;  4LC2 A;  4UIV A;  5EWD A;  5I40 A;  5KHM A;  4A9O A;  5D0C A;  4C66 A;  5FE8 A;  5F1L A;  3GG3 A;  4J0R A;  4QSR A;  4PS5 A;  4UIX A;  4CUQ A;  5F5Z A;  5D3H A;  4YYM A;  3U5M A;  5CUC A;  5I83 A;  5FE6 A;  5CU8 A;  5L96 A;  3U5O A;  5CS8 A;  2F6J A;  4BJX A;  5FH6 A;  4O77 A;  5IG6 A;  3SVH A;  4BW2 A;  3Q2E A;  4QYD A;  5DW2 A;  4A9K A;  4CLB A;  5I7X A;  5ENJ A;  4IOO A;  5F3A A;  2RS9 B;  4O75 A;  5EPB A;  4HXN A;  3UV2 A;  4A9N A;  4QR3 A;  2YQD A;  4YC9 A;  4QSW A;  5I7Y A;  5E9L A;  3QZS A;  2KTB B;  4NS5 A;  2YEM A;  5CQ7 A;  5BT5 A;  4YAT A;  3RCW A;  4CUR A;  5F60 A;  5D3R A;  1PUO A;  2G4A A;  4HBV A;  3P1F A;  5FBX A;  4NUD A;  4YAB A;  5BT4 A;  5DBM A;  4CUU A;  4F3I A;  4Y03 A;  5I80 A;  5I88 A;  2RNX A;  4YY4 A;  4NRC A;  4NR4 A;  4HXR A;  5D3S A;  3MUK A;  5EU1 A;  5L8U A;  5EPS A;  4J3I A;  4UIT A;  5CUB A;  4C67 A;  5E3D A;  5HFQ A;  5I29 A;  3MUL A;  4LYS A;  5JI8 A;  3LQH A;  5I1Q A;  4X2I A;  3G0L A;  4YAX A;  4CUS A;  3JVK A;  5E9K A;  4TU4 A;  4CUP A;  5H1V A;  4YYH A;  5HEM A;  4UIY A;  5ENB A;  4NR5 A;  5FDZ A;  5EI4 A;  5IGL A;  4TT4 A;  4ZQL A;  4QC1 A;  4NUC A;  5TCM A;  5CRM A;  5EQ1 A;  2E3K A;  5LVQ A;  5EWC A;  4HBY A;  4XY8 A;  4NR6 A;  5CQT A;  5D3L A;  5LKT A;  3U5K A;  3D1B A;  4MR5 A;  5IGN A;  5ENH A;  4YH4 A;  4N4H A;  5E9Y A;  5CY9 A;  2MJV B;  5ENG A;  3JVL A;  2OUO A;  4O70 A;  5FE0 A;  4PKL A;  4WHW A;  4TYL A;  1WUG A;  4Q0O A;  4AKI A;  4NYX A;  2RI7 A;  5BT3 A;  4YAD A;  2R10 A;  5CTL A;  5DYU A;  5G4R A;  2YYN A;  5FG5 A;  4N4G A;  4QSU A;  2GRC A;  1ZS5 A;  5COI A;  4MEO A;  3UV5 A;  5FH8 A;  5KO4 A;  5EM3 A;  5KU3 A;  3K2J A;  1EQF A;  5FE5 A;  3SVG A;  5DKH A;  5DFB A;  5LJ2 A;  3VKH A;  5CFW A;  4YYK A;  5E9I A;  4Q0N A;  5LKZ A;  2E7O A;  4A9I A;  5FFV A;  1JSP B;  2YW5 A;  4KCX A;  4UYE A;  4QSQ A;  5DYA A;  5D26 A;  4O71 A;  2I8N A;  4HBX A;  4N3W A;  2RNW A;  4RVR A;  3MXF A;  4NUE A;  5EWW A;  5LJ0 A;  4PCI A;  5A5S A;  4MEQ A;  5HQ6 A;  4NQN A;  5G4S A;  4YY6 A;  5EVA A;  5FE9 A;  2DWW A;  3O37 A;  1F68 A;  5HRV A;  5A5R A;  4ZW1 A;  4Z93 A;  5L8T A;  3AQA A;  2L85 A;  5CQ4 A;  4TQN A;  4KV1 A;  4NRB A;  4TU6 A;  5L98 A;  5C4Q A;  3D7C A;  4HXS A;  4UIU A;  3MB4 A;  2FSA A;  4NR9 A;  4TZ2 A;  4QST A;  5LVR A;  5II1 A;  3P1E A;  2WP2 A;  5H1T A;  2R0V A;  4QB3 A;  4QUT A;  4LR6 A;  5DW1 A;  4J0S A;  3QZT A;  5II2 A;  4CUT A;  5CPE A;  4IR5 A;  5CUG A;  5F36 A;  4QUU A;  5TB6 A;  5CQ6 A;  4NQM A;  3U5L A;  4QEV A;  5EA1 A;  5L99 A;  4Z1S A;  4LZR A;  5CQA A;  4LZ2 A;  5C7N A;  3Q2F A;  2DKW A;  5EPR A;  5FE2 A;  4AKG A;  3LXJ A;  4ALG A;  5IGK A;  4N4I A;  5A7C A;  4LYI A;  4TT6 A;  3UVX A;  3UV4 A;  4PY6 A;  4UYG A;  4UYF A;  4YBT A;  3HMF A;  5FE7 A;  4IOQ A;  5ENC A;  4A9E A;  4QNS A;  4OUF A;  3NXB A;  5A81 A;  2RNY A;  2NXB A;  3AAD A;  4A9H A;  4OGJ A;  4CL9 A;  3U5N A;  4GPJ A;  4BW3 A;  5F62 A;  5CP5 A;  5F61 A;  5C85 A;  2DVR A;  3JVJ A;  3UVY A;  4DON A;  3O34 A;  5CZG A;  5C8G A;  5F63 A;  4QY4 A;  5HEN A;  5LUU A;  5AME A;  2D9E A;  2R0Y A;  4XY9 A;  4MEN A;  5HLS A;  4CFL A;  4NYV A;  4O7F A;  5A85 A;  5D3N A;  4Z1Q A;  4AKN A;  4O7C A;  5D3T A;  5CQ5 A;  5IGM A;  3TLP A;  1WUM A;  4O72 A;  5F1H A;  3ZYU A;  5A5Q A;  5E0R A;  3D1D A;  4TT2 A;  5DYX A;  5CQ3 A;  5AD2 A;  5AD3 A;  3IU5 A;  4QR4 A;  5E73 A;  5ENI A;  5E74 A;  4O7A A;  4XUA A;  5LJ1 A;  4LRG A;  2RO1 A;  5C89 A;  4QSP A;  3G0J A;  5EWH A;  5DLZ A;  3MQM A;  2L84 A;  4HXL A;  2F6N A;  5DLX A;  4OGI A;  2OO1 A;  3P5O A;  4IOR A;  4O74 A;  5DFC A;  4YYJ A;  5CRZ A;  5HFR A;  4YBS A;  4A9L A;  5FG6 A;  5E7D A;  3VKG A;  3O36 A;  4KV4 A;  4IR6 A;  5FE3 A;  4UYF B;  1N72 A;  4MR3 A;  4HXK A;  4PTB A;  4UYH A;  5HRW A;  5AMF A;  4QZS A;  4YK0 A;  3S91 A;  5ENE A; 
#chains in the Genus database with same CATH homology
 5IID A;  5DFD A;  4UYD A;  3U5J A;  5KTU A;  3ONI A;  5HQ5 A;  5KTW A;  5EWV A;  4QC3 A;  5C87 A;  5HCL A;  5ACY A;  3UVW A;  4N4F A;  3P1C A;  4HXP A;  4YYG A;  4IR3 A;  2D82 A;  5CQ8 A;  2DAT A;  3SVF A;  4YBM A;  2RFJ A;  3LQI A;  4A9F A;  3P1D A;  5ETD A;  5H1U A;  4ZC9 A;  4TZ8 A;  5A83 A;  2DVV A;  4CFK A;  4XYA A;  4BHW A;  2YDW A;  4E96 A;  3FKM X;  3S92 A;  5EGU A;  3DAI A;  5J0D A;  2H60 A;  4J1P A;  2LSP B;  3HMH A;  4QBM A;  1E6I A;  4HBW A;  5FH7 A;  3JVM A;  4QSX A;  5D25 A;  4UIZ A;  2R0S A;  3UVD A;  5FE4 A;  3MB3 A;  5HJC A;  5F25 A;  5FFW A;  5DKC A;  5HM0 A;  3QZV A;  4LYW A;  4O76 A;  5D24 A;  5EV9 A;  4LZS A;  4FLP A;  4UIW A;  5LKU A;  1JM4 B;  2WP1 A;  5H85 A;  4A9M A;  5E9M A;  2N9G A;  5IBN A;  1X0J A;  4NXJ A;  5D3P A;  4IR4 A;  5DX4 A;  2YEK A;  2YEL A;  3O33 A;  5FFY A;  4NR7 A;  3LQJ A;  4O78 A;  5EIS A;  5KTX A;  4YYD A;  4Z6I A;  5A5O A;  5CUE A;  4WHU A;  5I86 A;  4NYW A;  4HXM A;  5CUD A;  5FE1 A;  5DY7 A;  5HRX A;  4YYN A;  2DVS A;  4MR6 A;  4LDF A;  3UW9 A;  5JWM A;  4MEP A;  2L5E A;  5F2P A;  5E3G A;  4O7B A;  2I7K A;  4PCE A;  5FB1 A;  2DVQ A;  5CUA A;  4XUB A;  5HQ7 A;  3DWY A;  5I89 A;  4BW1 A;  5DYC A;  5LKX A;  4HXO A;  5A5P A;  5D7X A;  5ETB A;  5CGP A;  4BW4 A;  5ENF A;  5L97 A;  4QYL A;  2OSS A;  4QSV A;  4YH3 A;  4WIV A;  5EIC A;  5A5N A;  4YYI A;  3HME A;  4MR4 A;  5EP7 A;  3O35 A;  5D3J A;  5K29 A;  5EK9 A;  5HEL A;  4QEU A;  5E9V A;  5FB0 A;  4TS8 A;  3I3J A;  5DKD A;  4ALH A;  4NR8 A;  5FG4 A;  3U5P A;  4QEW A;  3LJW A;  4TTE A;  4O7E A;  2E7N A;  3IU6 A;  5A82 A;  4Z6H A;  4QR5 A;  4NRA A;  4QSS A;  4A9J A;  4LC2 A;  4UIV A;  5EWD A;  5I40 A;  5KHM A;  4A9O A;  5D0C A;  4C66 A;  5FE8 A;  5F1L A;  3GG3 A;  4J0R A;  4QSR A;  4PS5 A;  4UIX A;  4CUQ A;  5F5Z A;  5D3H A;  4YYM A;  3U5M A;  5CUC A;  5I83 A;  5FE6 A;  5CU8 A;  5L96 A;  3U5O A;  5CS8 A;  2F6J A;  4BJX A;  5FH6 A;  4O77 A;  5IG6 A;  3SVH A;  4BW2 A;  3Q2E A;  4QYD A;  5DW2 A;  4A9K A;  4CLB A;  5I7X A;  5ENJ A;  4IOO A;  5F3A A;  2RS9 B;  4O75 A;  5EPB A;  4HXN A;  3UV2 A;  4A9N A;  4QR3 A;  2YQD A;  4YC9 A;  4QSW A;  5I7Y A;  5E9L A;  3QZS A;  2KTB B;  4NS5 A;  2YEM A;  5CQ7 A;  5BT5 A;  4YAT A;  3RCW A;  4CUR A;  5F60 A;  5D3R A;  2G4A A;  4HBV A;  3P1F A;  5FBX A;  4NUD A;  4YAB A;  5BT4 A;  5DBM A;  4CUU A;  4F3I A;  4Y03 A;  5I80 A;  5I88 A;  2RNX A;  4YY4 A;  4NRC A;  4NR4 A;  4HXR A;  5D3S A;  3MUK A;  5EU1 A;  5L8U A;  5EPS A;  4J3I A;  4UIT A;  5CUB A;  4C67 A;  5E3D A;  5HFQ A;  5I29 A;  3MUL A;  4LYS A;  5JI8 A;  3LQH A;  5I1Q A;  4X2I A;  3G0L A;  4YAX A;  4CUS A;  3JVK A;  5E9K A;  4TU4 A;  4CUP A;  5H1V A;  4YYH A;  5HEM A;  4UIY A;  5ENB A;  4NR5 A;  5FDZ A;  5EI4 A;  5IGL A;  4TT4 A;  4ZQL A;  4QC1 A;  4NUC A;  5TCM A;  5CRM A;  5EQ1 A;  2E3K A;  5LVQ A;  5EWC A;  4HBY A;  4XY8 A;  4NR6 A;  5CQT A;  5D3L A;  5LKT A;  3U5K A;  4MR5 A;  5IGN A;  5ENH A;  4YH4 A;  4N4H A;  5E9Y A;  5CY9 A;  2MJV B;  5ENG A;  3JVL A;  2OUO A;  4O70 A;  5FE0 A;  4PKL A;  4WHW A;  4TYL A;  1WUG A;  4Q0O A;  4NYX A;  2RI7 A;  5BT3 A;  4YAD A;  2R10 A;  5CTL A;  5DYU A;  5G4R A;  2YYN A;  5FG5 A;  4N4G A;  4QSU A;  2GRC A;  1ZS5 A;  5COI A;  4MEO A;  3UV5 A;  5FH8 A;  5KO4 A;  5EM3 A;  5KU3 A;  3K2J A;  1EQF A;  5FE5 A;  3SVG A;  5DKH A;  5DFB A;  5LJ2 A;  5CFW A;  4YYK A;  5E9I A;  4Q0N A;  5LKZ A;  2E7O A;  4A9I A;  5FFV A;  1JSP B;  2YW5 A;  4KCX A;  4UYE A;  4QSQ A;  5DYA A;  5D26 A;  4O71 A;  2I8N A;  4HBX A;  4N3W A;  2RNW A;  4RVR A;  3MXF A;  4NUE A;  5EWW A;  5LJ0 A;  4PCI A;  5A5S A;  4MEQ A;  5HQ6 A;  4NQN A;  5G4S A;  4YY6 A;  5EVA A;  5FE9 A;  2DWW A;  3O37 A;  1F68 A;  5HRV A;  5A5R A;  4ZW1 A;  4Z93 A;  5L8T A;  3AQA A;  2L85 A;  4TQN A;  5CQ4 A;  4KV1 A;  4NRB A;  4TU6 A;  5L98 A;  5C4Q A;  3D7C A;  4HXS A;  4UIU A;  3MB4 A;  2FSA A;  4NR9 A;  4TZ2 A;  4QST A;  5LVR A;  5II1 A;  3P1E A;  2WP2 A;  5H1T A;  2R0V A;  4QB3 A;  4QUT A;  4LR6 A;  5DW1 A;  4J0S A;  3QZT A;  5II2 A;  4CUT A;  5CPE A;  4IR5 A;  5CUG A;  5F36 A;  4QUU A;  5TB6 A;  5CQ6 A;  4NQM A;  3U5L A;  4QEV A;  5EA1 A;  5L99 A;  4Z1S A;  4LZR A;  5CQA A;  4LZ2 A;  5C7N A;  3Q2F A;  2DKW A;  5EPR A;  5FE2 A;  3LXJ A;  4ALG A;  5IGK A;  4N4I A;  5A7C A;  4LYI A;  4TT6 A;  3UVX A;  3UV4 A;  4PY6 A;  4UYG A;  4UYF A;  4YBT A;  3HMF A;  5FE7 A;  4IOQ A;  5ENC A;  4A9E A;  4QNS A;  4OUF A;  3NXB A;  5A81 A;  2RNY A;  2NXB A;  3AAD A;  4A9H A;  4OGJ A;  4CL9 A;  3U5N A;  4GPJ A;  4BW3 A;  5F62 A;  5CP5 A;  5F61 A;  5C85 A;  2DVR A;  3JVJ A;  3UVY A;  4DON A;  3O34 A;  5CZG A;  5C8G A;  5F63 A;  4QY4 A;  5HEN A;  5LUU A;  5AME A;  2D9E A;  2R0Y A;  4XY9 A;  4MEN A;  5HLS A;  4CFL A;  4NYV A;  4O7F A;  5A85 A;  5D3N A;  4Z1Q A;  4AKN A;  4O7C A;  5D3T A;  5CQ5 A;  5IGM A;  3TLP A;  1WUM A;  4O72 A;  5F1H A;  3ZYU A;  5A5Q A;  5E0R A;  4TT2 A;  5DYX A;  5CQ3 A;  5AD2 A;  5AD3 A;  3IU5 A;  4QR4 A;  5E73 A;  5ENI A;  5E74 A;  4O7A A;  4XUA A;  5LJ1 A;  4LRG A;  2RO1 A;  5C89 A;  4QSP A;  3G0J A;  5EWH A;  5DLZ A;  3MQM A;  2L84 A;  4HXL A;  2F6N A;  5DLX A;  4OGI A;  2OO1 A;  3P5O A;  4IOR A;  4O74 A;  5DFC A;  4YYJ A;  5CRZ A;  5HFR A;  4YBS A;  4A9L A;  5FG6 A;  5E7D A;  3O36 A;  4KV4 A;  4IR6 A;  5FE3 A;  4UYF B;  1N72 A;  4MR3 A;  4HXK A;  4PTB A;  4UYH A;  5HRW A;  5AMF A;  4QZS A;  4YK0 A;  3S91 A;  5ENE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...