4A9KA

Bromodomain of human crebbp with n-(4-hydroxyphenyl)acetamide
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
115
structure length
115
Chain Sequence
KIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords CREB-BINDING PROTEIN
publication title Fragment-Based Discovery of Bromodomain Inhibitors Part 1: Inhibitor Binding Modes and Implications for Lead Discovery.
pubmed doi rcsb
source organism Homo sapiens
total genus 39
structure length 115
sequence length 115
chains with identical sequence B
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2011-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4a9kA00
5JWMA 5L99A 4O75A 5I89A 4O76A 5DY7A 5F60A 5L98A 3D7CA 2YEMA 2R10A 4PTBA 5CUAA 3U5LA 5ENJA 2DVVA 3MUKA 5EWHA 2I7KA 5IGNA 4WHUA 4QC1A 3SVFA 4HBXA 4A9IA 4YH3A 3DAIA 5HQ5A 5E3GA 1F68A 4RVRA 4QSPA 5AMFA 5D3RA 4LZSA 5CQ3A 4YYKA 5E9IA 4PCIA 4PY6A 5DYCA 5IBNA 5F62A 4O7AA 3U5PA 3QZVA 3MB4A 4O72A 5CPEA 1EQFA 4NR5A 4F3IA 4HBYA 5I83A 5FFWA 4NR8A 3HMFA 4MR4A 4NYWA 5E0RA 5EWDA 3Q2EA 4A9OA 5F1LA 4LYWA 4GPJA 4CUTA 5EI4A 4A9FA 5EP7A 5LJ2A 2N9GA 5D3LA 5F63A 4NS5A 2L5EA 3P1FA 5DW1A 4O7EA 4YYIA 4QEUA 5EA1A 3P1DA 4YY4A 1WUGA 5I7XA 5LVRA 4NR4A 5I88A 5HEMA 5EK9A 5DKDA 4TU6A 2FSAA 4XUBA 4MEPA 2YQDA 3JVKA 3UV5A 5ACYA 5HLSA 5LKXA 3MXFA 5CRMA 4OUFA 5L97A 5A5SA 5BT4A 2L85A 4CFLA 5DBMA 2L84A 5CUCA 4TTEA 3GG3A 5D24A 5FFVA 5EU1A 4IR4A 5LJ0A 5C8GA 5L96A 4XYAA 1X0JA 4QSSA 4MR6A 4QR3A 2D9EA 4J0RA 5AD2A 4ALHA 4IOOA 4TYLA 4O7BA 4C67A 5J0DA 4QUUA 4IR5A 1JSPB 5HFRA 2F6NA 5H85A 3U5OA 5EPBA 5F2PA 5CP5A 2D82A 5A5NA 2DVQA 4MEQA 4NXJA 5C85A 2E3KA 4NR7A 5DFDA 4ZQLA 5FB0A 5LKZA 5FBXA 5F1HA 5FE6A 5HQ7A 5LVQA 3Q2FA 3MULA 5CUBA 4QY4A 4UIVA 3SVHA 2WP1A 5DKHA 4CL9A 4QR4A 5C89A 5FG5A 3U5NA 2YW5A 5A5QA 4BHWA 5HELA 2R0VA 5IGKA 5E9VA 5L8TA 5D7XA 1ZS5A 1WUMA 5DLXA 5A5RA 5DKCA 4YBTA 2RNYA 5EWCA 4O71A 5H1VA 3NXBA 5D3JA 2E7NA 4CUSA 2OO1A 3QZTA 5IGLA 5EM3A 4LDFA 5G4RA 4HXOA 4QSWA 5TCMA 4BJXA 4UYFB 4IOQA 3JVMA 5C4QA 5FE9A 1N72A 5CZGA 5ETBA 3UVXA 3G0JA 4O74A 5EWVA 5ENEA 5D3TA 5IGMA 5EGUA 5II2A 5ENCA 4YY6A 2WP2A 5HM0A 2DATA 4UIWA 4E96A 4CUPA 4YH4A 3P1EA 4UIUA 4NRCA 2MJVB 4UYDA 5DW2A 5G4SA 4LZRA 5EVAA 4BW3A 4BW1A 4PKLA 4J1PA 5EV9A 5A5PA 4OGIA 5E7DA 4N4HA 5EPRA 3LQHA 3QZSA 3FKMX 3U5MA 5FE0A 5CUEA 4A9HA 4AKNA 5II1A 5C7NA 2DWWA 4QSRA 3HMHA 3MQMA 5D26A 2DVRA 3MB3A 5EICA 5EPSA 4IR6A 4A9NA 4LYIA 4PCEA 4IORA 5LJ1A 4YBSA 5I7YA 4UITA 5H1TA 4KCXA 2RFJA 4N4GA 4O78A 5F5ZA 2DVSA 2YYNA 5A82A 4YABA 5DLZA 4A9EA 4KV1A 4YYHA 5CY9A 4NYXA 2RI7A 4QYDA 3LQJA 4Z93A 5DYXA 4QC3A 4YYMA 2I8NA 4TU4A 5KTUA 4C66A 3K2JA 4YATA 5CQ7A 4BW2A 4N3WA 5BT5A 2OUOA 3ZYUA 2RNWA 4TT4A 4YC9A 5CGPA 4O77A 5HJCA 4NQMA 4UIZA 5H1UA 4Z1QA 5FH8A 5I40A 5HENA 3P5OA 4BW4A 4Z1SA 4UYFA 3O36A 5TB6A 2LSPB 5A85A 5DFBA 5CQ6A 5DYAA 5D3SA 3IU6A 4UYHA 4UIYA 4ZW1A 4WHWA 5KHMA 4HBWA 5E74A 5KTXA 3O37A 5EWWA 5FH7A 5E3DA 5COIA 4YAXA 5ENIA 4YK0A 5ENGA 5A5OA 5FE7A 5F25A 4NR9A 4YYGA 5I86A 5EQ1A 4O70A 5I29A 4A9JA 4NRAA 4HXPA 4CURA 5KO4A 3UVWA 3O35A 4NUEA 4OGJA 5D3HA 3P1CA 4NUCA 3IU5A 5CUDA 5FG6A 4YBMA 5CU8A 3LXJA 5HRWA 4QNSA 4TZ2A 5AD3A 3O33A 4NUDA 5CS8A 3UVDA 4A9MA 5HQ6A 5IIDA 2G4AA 5FG4A 3LJWA 2DKWA 4QUTA 5F36A 5E9MA 4QYLA 5DYUA 5CQ8A 4J0SA 4TQNA 2YEKA 4MEOA 3LQIA 5IG6A 3S92A 4TT6A 3UV4A 4PS5A 4HXRA 4UIXA 5CTLA 4N4FA 3ONIA 4A9LA 4HXMA 4KV4A 4X2IA 5HRVA 4ALGA 5HCLA 4MR3A 4CFKA 5CFWA 4HBVA 5D0CA 4HXKA 3TLPA 5A7CA 5CQ5A 5D3PA 4ZC9A 5ENHA 4QSTA 3UW9A 2R0SA 2H60A 4NRBA 4XUAA 5DX4A 5L8UA 4QSUA 3O34A 5E9LA 5A83A 5LKTA 5CQ4A 3HMEA 4O7CA 5FE3A 5FE5A 5KTWA 4CUUA 4FLPA 5CQTA 4UYEA 5HRXA 1JM4B 2R0YA 5EISA 4YADA 5FE2A 4WIVA 3I3JA 5ENBA 5A81A 2YELA 3JVJA 4HXLA 4CUQA 5ETDA 4QZSA 3U5JA 2OSSA 4Z6HA 4YYDA 4HXNA 5FFYA 5C87A 1E6IA 5CUGA 4UYGA 4TZ8A 5CQAA 5D25A 4QSVA 2KTBB 3AADA 4QBMA 2YDWA 5KU3A 3DWYA 5K29A 5JI8A 5AMEA 4NYVA 5ENFA 4LZ2A 4N4IA 3UV2A 5FH6A 4DONA 5FB1A 4HXSA 4QR5A 3S91A 4MENA 4QSQA 4Y03A 5F3AA 5CRZA 5HFQA 3UVYA 4LC2A 3G0LA 5LUUA 4QEWA 5E9KA 4YYNA 5FE1A 5E73A 4YYJA 5FE4A 5E9YA 2RNXA 4Q0OA 4MR5A 4CLBA 2RO1A 2GRCA 5DFCA 4NR6A 3SVGA 2F6JA 4IR3A 2E7OA 5I80A 4Z6IA 3RCWA 5D3NA 4QEVA 4XY9A 4Q0NA 2RS9B 3JVLA 4J3IA 4NQNA 4QB3A 5LKUA 2NXBA 3AQAA 4A9KA 5I1QA 4TT2A 4LR6A 4QSXA 4TS8A 3U5KA 4O7FA 5FE8A 5FDZA 4LYSA 5F61A 4LRGA 4XY8A 5BT3A
chains in the Genus database with same CATH superfamily
5JWMA 5L99A 4O75A 5I89A 4O76A 5DY7A 5F60A 5L98A 3D7CA 2YEMA 3VKGA 2R10A 4PTBA 5CUAA 3U5LA 5ENJA 2DVVA 3MUKA 5EWHA 2I7KA 5IGNA 4WHUA 4QC1A 3SVFA 4HBXA 4A9IA 4YH3A 3DAIA 5HQ5A 5E3GA 1F68A 4RVRA 4QSPA 5AMFA 5D3RA 4LZSA 5CQ3A 4YYKA 5E9IA 4PCIA 4PY6A 5DYCA 5IBNA 5F62A 4O7AA 3U5PA 3QZVA 3MB4A 4O72A 5CPEA 1EQFA 4NR5A 4F3IA 4HBYA 5I83A 5FFWA 4NR8A 3HMFA 4MR4A 4NYWA 5E0RA 5EWDA 3Q2EA 4A9OA 1PUOA 5F1LA 4LYWA 4GPJA 4CUTA 5EI4A 4A9FA 5EP7A 5LJ2A 2N9GA 5D3LA 5F63A 4NS5A 2L5EA 3P1FA 5DW1A 4O7EA 4YYIA 4QEUA 5EA1A 3ERRA 3P1DA 4YY4A 1WUGA 5I7XA 5LVRA 4NR4A 5I88A 5HEMA 5EK9A 5DKDA 4TU6A 2FSAA 4XUBA 4MEPA 2YQDA 3JVKA 3UV5A 5ACYA 5HLSA 5LKXA 3MXFA 5CRMA 4OUFA 5L97A 5A5SA 5BT4A 2L85A 4CFLA 5DBMA 2L84A 5CUCA 4TTEA 3GG3A 5D24A 5FFVA 5EU1A 4IR4A 5LJ0A 5C8GA 5L96A 4XYAA 1X0JA 4QSSA 4MR6A 4QR3A 2D9EA 4J0RA 5AD2A 4ALHA 4IOOA 4TYLA 4O7BA 4C67A 5J0DA 4QUUA 4IR5A 1JSPB 5HFRA 2F6NA 5H85A 3U5OA 5EPBA 5F2PA 5CP5A 2D82A 5A5NA 2DVQA 4MEQA 4NXJA 5C85A 2E3KA 4NR7A 5DFDA 4ZQLA 5FB0A 5LKZA 5FBXA 5F1HA 5FE6A 5HQ7A 5LVQA 3Q2FA 3MULA 5CUBA 4QY4A 4UIVA 3SVHA 2WP1A 5DKHA 4CL9A 4QR4A 5C89A 5FG5A 3U5NA 2YW5A 5A5QA 4BHWA 5HELA 3D1BA 2R0VA 5IGKA 5E9VA 5L8TA 5D7XA 1ZS5A 1WUMA 5DLXA 5A5RA 5DKCA 4YBTA 2RNYA 5EWCA 4O71A 5H1VA 3NXBA 5D3JA 2E7NA 4CUSA 2OO1A 3QZTA 5IGLA 5EM3A 4LDFA 5G4RA 4HXOA 4QSWA 5TCMA 4BJXA 4AKIA 4UYFB 4IOQA 3JVMA 5C4QA 5FE9A 1N72A 5CZGA 5ETBA 3UVXA 3G0JA 4O74A 5EWVA 5ENEA 5D3TA 5IGMA 5EGUA 5II2A 5ENCA 4YY6A 2WP2A 5HM0A 2DATA 4UIWA 4E96A 4CUPA 4YH4A 3P1EA 4UIUA 4NRCA 2MJVB 4UYDA 5DW2A 5G4SA 4LZRA 5EVAA 4BW3A 4BW1A 4PKLA 4J1PA 5EV9A 5A5PA 4OGIA 5E7DA 4N4HA 5EPRA 3LQHA 3QZSA 3FKMX 3U5MA 5FE0A 5CUEA 4A9HA 4AKNA 5II1A 5C7NA 2DWWA 4QSRA 3HMHA 3MQMA 5D26A 2DVRA 3MB3A 5EICA 5EPSA 4IR6A 4A9NA 4LYIA 4PCEA 4IORA 5LJ1A 4YBSA 5I7YA 4UITA 5H1TA 4KCXA 2RFJA 4N4GA 4O78A 5F5ZA 2DVSA 2YYNA 5A82A 4YABA 5DLZA 4A9EA 4KV1A 4YYHA 5CY9A 4NYXA 2RI7A 4QYDA 3LQJA 4Z93A 5DYXA 4QC3A 4YYMA 2I8NA 4TU4A 5KTUA 4C66A 3K2JA 4YATA 5CQ7A 4BW2A 4N3WA 5BT5A 2OUOA 3ZYUA 2RNWA 4TT4A 4YC9A 3D1DA 5CGPA 4O77A 5HJCA 4NQMA 4UIZA 5H1UA 4Z1QA 5FH8A 5I40A 5HENA 3P5OA 4BW4A 4Z1SA 4UYFA 3O36A 5TB6A 2LSPB 5A85A 5DFBA 5CQ6A 5DYAA 5D3SA 3IU6A 4UYHA 4UIYA 4ZW1A 4WHWA 5KHMA 4HBWA 5E74A 5KTXA 3O37A 5EWWA 5FH7A 5E3DA 5COIA 4YAXA 5ENIA 4YK0A 5ENGA 5A5OA 5FE7A 5F25A 4NR9A 4YYGA 5I86A 5EQ1A 4O70A 5I29A 4A9JA 4NRAA 4HXPA 4CURA 5KO4A 3UVWA 3O35A 4NUEA 4OGJA 5D3HA 3P1CA 4NUCA 3IU5A 2EJNA 5CUDA 5FG6A 4YBMA 5CU8A 3LXJA 5HRWA 4QNSA 4TZ2A 5AD3A 3O33A 4NUDA 5CS8A 3UVDA 4A9MA 5HQ6A 5IIDA 2G4AA 5FG4A 3LJWA 2DKWA 4QUTA 5F36A 5E9MA 4QYLA 5DYUA 5CQ8A 4J0SA 4TQNA 2YEKA 4MEOA 4AI6A 3LQIA 5IG6A 3S92A 4TT6A 3UV4A 3VKHA 4PS5A 4HXRA 4UIXA 5CTLA 4N4FA 3ONIA 4A9LA 4HXMA 4KV4A 4X2IA 5HRVA 4ALGA 5HCLA 4MR3A 4CFKA 4AKHA 5CFWA 4HBVA 5D0CA 4HXKA 3TLPA 5A7CA 5CQ5A 5D3PA 4AKGA 4ZC9A 5ENHA 4QSTA 3UW9A 2R0SA 2H60A 4NRBA 4XUAA 5DX4A 5L8UA 4QSUA 3O34A 5E9LA 5A83A 5LKTA 5CQ4A 3HMEA 4O7CA 5FE3A 5FE5A 5KTWA 4CUUA 4FLPA 5CQTA 4UYEA 5HRXA 1JM4B 2R0YA 5EISA 4YADA 5FE2A 4WIVA 3I3JA 5ENBA 5A81A 2YELA 3JVJA 4HXLA 4CUQA 5ETDA 4QZSA 3U5JA 2OSSA 4Z6HA 4YYDA 4HXNA 5FFYA 5C87A 1E6IA 5CUGA 4UYGA 4TZ8A 5CQAA 5D25A 4QSVA 2KTBB 3AADA 4QBMA 2YDWA 5KU3A 3DWYA 5K29A 5JI8A 5AMEA 4NYVA 5ENFA 4LZ2A 1ZKRA 4N4IA 3UV2A 5FH6A 4DONA 5FB1A 4HXSA 4QR5A 3S91A 4MENA 4QSQA 4Y03A 5F3AA 5CRZA 5HFQA 3UVYA 4LC2A 3G0LA 5LUUA 4QEWA 5E9KA 4YYNA 5FE1A 5E73A 4YYJA 5FE4A 5E9YA 2RNXA 4Q0OA 4MR5A 4CLBA 2RO1A 2GRCA 5DFCA 4NR6A 3SVGA 2F6JA 4IR3A 2E7OA 5I80A 4Z6IA 3RCWA 5D3NA 4QEVA 4XY9A 4Q0NA 2RS9B 3JVLA 4J3IA 4NQNA 4QB3A 5LKUA 2NXBA 3AQAA 4A9KA 5I1QA 4TT2A 4LR6A 4QSXA 4TS8A 3U5KA 4O7FA 5FE8A 5FDZA 4LYSA 5F61A 4LRGA 4XY8A 5BT3A
chains in the Genus database with same CATH topology
5JWMA 5L99A 4O75A 5I89A 4O76A 5DY7A 5F60A 5L98A 3D7CA 2YEMA 2R10A 4PTBA 5CUAA 3U5LA 5ENJA 2DVVA 3MUKA 5EWHA 2I7KA 5IGNA 4WHUA 4QC1A 3SVFA 4HBXA 4A9IA 4YH3A 3DAIA 5HQ5A 5E3GA 1F68A 4RVRA 4QSPA 5AMFA 5D3RA 4LZSA 5CQ3A 4YYKA 5E9IA 4PCIA 4PY6A 5DYCA 5IBNA 5F62A 4O7AA 3U5PA 3QZVA 3MB4A 4O72A 5CPEA 1EQFA 4NR5A 4F3IA 4HBYA 5I83A 5FFWA 4NR8A 3HMFA 4MR4A 4NYWA 5E0RA 5EWDA 3Q2EA 4A9OA 5F1LA 4LYWA 4GPJA 4CUTA 5EI4A 4A9FA 5EP7A 5LJ2A 2N9GA 5D3LA 5F63A 4NS5A 2L5EA 3P1FA 5DW1A 4O7EA 4YYIA 4QEUA 5EA1A 3P1DA 4YY4A 1WUGA 5I7XA 5LVRA 4NR4A 5I88A 5HEMA 5EK9A 5DKDA 4TU6A 2FSAA 4XUBA 4MEPA 2YQDA 3JVKA 3UV5A 5ACYA 5HLSA 5LKXA 3MXFA 5CRMA 4OUFA 5L97A 5A5SA 5BT4A 2L85A 4CFLA 5DBMA 2L84A 5CUCA 4TTEA 3GG3A 5D24A 5FFVA 5EU1A 4IR4A 5LJ0A 5C8GA 5L96A 4XYAA 1X0JA 4QSSA 4MR6A 4QR3A 2D9EA 4J0RA 5AD2A 4ALHA 4IOOA 4TYLA 4O7BA 4C67A 5J0DA 4QUUA 4IR5A 1JSPB 5HFRA 2F6NA 5H85A 3U5OA 5EPBA 5F2PA 5CP5A 2D82A 5A5NA 2DVQA 4MEQA 4NXJA 5C85A 2E3KA 4NR7A 5DFDA 4ZQLA 5FB0A 5LKZA 5FBXA 5F1HA 5FE6A 5HQ7A 5LVQA 3Q2FA 3MULA 5CUBA 4QY4A 4UIVA 3SVHA 2WP1A 5DKHA 4CL9A 4QR4A 5C89A 5FG5A 3U5NA 2YW5A 5A5QA 4BHWA 5HELA 2R0VA 5IGKA 5E9VA 5L8TA 5D7XA 1ZS5A 1WUMA 5DLXA 5A5RA 5DKCA 4YBTA 2RNYA 5EWCA 4O71A 5H1VA 3NXBA 5D3JA 2E7NA 4CUSA 2OO1A 3QZTA 5IGLA 5EM3A 4LDFA 5G4RA 4HXOA 4QSWA 5TCMA 4BJXA 4UYFB 4IOQA 3JVMA 5C4QA 5FE9A 1N72A 5CZGA 5ETBA 3UVXA 3G0JA 4O74A 5EWVA 5ENEA 5D3TA 5IGMA 5EGUA 5II2A 5ENCA 4YY6A 2WP2A 5HM0A 2DATA 4UIWA 4E96A 4CUPA 4YH4A 3P1EA 4UIUA 4NRCA 2MJVB 4UYDA 5DW2A 5G4SA 4LZRA 5EVAA 4BW3A 4BW1A 4PKLA 4J1PA 5EV9A 5A5PA 4OGIA 5E7DA 4N4HA 5EPRA 3LQHA 3QZSA 3FKMX 3U5MA 5FE0A 5CUEA 4A9HA 4AKNA 5II1A 5C7NA 2DWWA 4QSRA 3HMHA 3MQMA 5D26A 2DVRA 3MB3A 5EICA 5EPSA 4IR6A 4A9NA 4LYIA 4PCEA 4IORA 5LJ1A 4YBSA 5I7YA 4UITA 5H1TA 4KCXA 2RFJA 4N4GA 4O78A 5F5ZA 2DVSA 2YYNA 5A82A 4YABA 5DLZA 4A9EA 4KV1A 4YYHA 5CY9A 4NYXA 2RI7A 4QYDA 3LQJA 4Z93A 5DYXA 4QC3A 4YYMA 2I8NA 4TU4A 5KTUA 4C66A 3K2JA 4YATA 5CQ7A 4BW2A 4N3WA 5BT5A 2OUOA 3ZYUA 2RNWA 4TT4A 4YC9A 5CGPA 4O77A 5HJCA 4NQMA 4UIZA 5H1UA 4Z1QA 5FH8A 5I40A 5HENA 3P5OA 4BW4A 4Z1SA 4UYFA 3O36A 5TB6A 2LSPB 5A85A 5DFBA 5CQ6A 5DYAA 5D3SA 3IU6A 4UYHA 4UIYA 4ZW1A 4WHWA 5KHMA 4HBWA 5E74A 5KTXA 3O37A 5EWWA 5FH7A 5E3DA 5COIA 4YAXA 5ENIA 4YK0A 5ENGA 5A5OA 5FE7A 5F25A 4NR9A 4YYGA 5I86A 5EQ1A 4O70A 5I29A 4A9JA 4NRAA 4HXPA 4CURA 5KO4A 3UVWA 3O35A 4NUEA 4OGJA 5D3HA 3P1CA 4NUCA 3IU5A 5CUDA 5FG6A 4YBMA 5CU8A 3LXJA 5HRWA 4QNSA 4TZ2A 5AD3A 3O33A 4NUDA 5CS8A 3UVDA 4A9MA 5HQ6A 5IIDA 2G4AA 5FG4A 3LJWA 2DKWA 4QUTA 5F36A 5E9MA 4QYLA 5DYUA 5CQ8A 4J0SA 4TQNA 2YEKA 4MEOA 3LQIA 5IG6A 3S92A 4TT6A 3UV4A 4PS5A 4HXRA 4UIXA 5CTLA 4N4FA 3ONIA 4A9LA 4HXMA 4KV4A 4X2IA 5HRVA 4ALGA 5HCLA 4MR3A 4CFKA 5CFWA 4HBVA 5D0CA 4HXKA 3TLPA 5A7CA 5CQ5A 5D3PA 4ZC9A 5ENHA 4QSTA 3UW9A 2R0SA 2H60A 4NRBA 4XUAA 5DX4A 5L8UA 4QSUA 3O34A 5E9LA 5A83A 5LKTA 5CQ4A 3HMEA 4O7CA 5FE3A 5FE5A 5KTWA 4CUUA 4FLPA 5CQTA 4UYEA 5HRXA 1JM4B 2R0YA 5EISA 4YADA 5FE2A 4WIVA 3I3JA 5ENBA 5A81A 2YELA 3JVJA 4HXLA 4CUQA 5ETDA 4QZSA 3U5JA 2OSSA 4Z6HA 4YYDA 4HXNA 5FFYA 5C87A 1E6IA 5CUGA 4UYGA 4TZ8A 5CQAA 5D25A 4QSVA 2KTBB 3AADA 4QBMA 2YDWA 5KU3A 3DWYA 5K29A 5JI8A 5AMEA 4NYVA 5ENFA 4LZ2A 4N4IA 3UV2A 5FH6A 4DONA 5FB1A 4HXSA 4QR5A 3S91A 4MENA 4QSQA 4Y03A 5F3AA 5CRZA 5HFQA 3UVYA 4LC2A 3G0LA 5LUUA 4QEWA 5E9KA 4YYNA 5FE1A 5E73A 4YYJA 5FE4A 5E9YA 2RNXA 4Q0OA 4MR5A 4CLBA 2RO1A 2GRCA 5DFCA 4NR6A 3SVGA 2F6JA 4IR3A 2E7OA 5I80A 4Z6IA 3RCWA 5D3NA 4QEVA 4XY9A 4Q0NA 2RS9B 3JVLA 4J3IA 4NQNA 4QB3A 5LKUA 2NXBA 3AQAA 4A9KA 5I1QA 4TT2A 4LR6A 4QSXA 4TS8A 3U5KA 4O7FA 5FE8A 5FDZA 4LYSA 5F61A 4LRGA 4XY8A 5BT3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JWM A;  5L99 A;  4O75 A;  5I89 A;  4O76 A;  5DY7 A;  5F60 A;  5L98 A;  3D7C A;  2YEM A;  2R10 A;  4PTB A;  5CUA A;  3U5L A;  5ENJ A;  2DVV A;  3MUK A;  5EWH A;  2I7K A;  5IGN A;  4WHU A;  4QC1 A;  3SVF A;  4HBX A;  4A9I A;  4YH3 A;  3DAI A;  5HQ5 A;  5E3G A;  1F68 A;  4RVR A;  4QSP A;  5AMF A;  5D3R A;  4LZS A;  5CQ3 A;  4YYK A;  5E9I A;  4PCI A;  4PY6 A;  5DYC A;  5IBN A;  5F62 A;  4O7A A;  3U5P A;  3QZV A;  3MB4 A;  4O72 A;  5CPE A;  1EQF A;  4NR5 A;  4F3I A;  4HBY A;  5I83 A;  5FFW A;  4NR8 A;  3HMF A;  4MR4 A;  4NYW A;  5E0R A;  5EWD A;  3Q2E A;  4A9O A;  5F1L A;  4LYW A;  4GPJ A;  4CUT A;  5EI4 A;  4A9F A;  5EP7 A;  5LJ2 A;  2N9G A;  5D3L A;  5F63 A;  4NS5 A;  2L5E A;  3P1F A;  5DW1 A;  4O7E A;  4YYI A;  4QEU A;  5EA1 A;  3P1D A;  4YY4 A;  1WUG A;  5I7X A;  5LVR A;  4NR4 A;  5I88 A;  5HEM A;  5EK9 A;  5DKD A;  4TU6 A;  2FSA A;  4XUB A;  4MEP A;  2YQD A;  3JVK A;  3UV5 A;  5ACY A;  5HLS A;  5LKX A;  3MXF A;  5CRM A;  4OUF A;  5L97 A;  5A5S A;  5BT4 A;  2L85 A;  4CFL A;  5DBM A;  2L84 A;  5CUC A;  4TTE A;  3GG3 A;  5D24 A;  5FFV A;  5EU1 A;  4IR4 A;  5LJ0 A;  5C8G A;  5L96 A;  4XYA A;  1X0J A;  4QSS A;  4MR6 A;  4QR3 A;  2D9E A;  4J0R A;  5AD2 A;  4ALH A;  4IOO A;  4TYL A;  4O7B A;  4C67 A;  5J0D A;  4QUU A;  4IR5 A;  1JSP B;  5HFR A;  2F6N A;  5H85 A;  3U5O A;  5EPB A;  5F2P A;  5CP5 A;  2D82 A;  5A5N A;  2DVQ A;  4MEQ A;  4NXJ A;  5C85 A;  2E3K A;  4NR7 A;  5DFD A;  4ZQL A;  5FB0 A;  5LKZ A;  5FBX A;  5F1H A;  5FE6 A;  5HQ7 A;  5LVQ A;  3Q2F A;  3MUL A;  5CUB A;  4QY4 A;  4UIV A;  3SVH A;  2WP1 A;  5DKH A;  4CL9 A;  4QR4 A;  5C89 A;  5FG5 A;  3U5N A;  2YW5 A;  5A5Q A;  4BHW A;  5HEL A;  2R0V A;  5IGK A;  5E9V A;  5L8T A;  5D7X A;  1ZS5 A;  1WUM A;  5DLX A;  5A5R A;  5DKC A;  4YBT A;  2RNY A;  5EWC A;  4O71 A;  5H1V A;  3NXB A;  5D3J A;  2E7N A;  4CUS A;  2OO1 A;  3QZT A;  5IGL A;  5EM3 A;  4LDF A;  5G4R A;  4HXO A;  4QSW A;  5TCM A;  4BJX A;  4UYF B;  4IOQ A;  3JVM A;  5C4Q A;  5FE9 A;  1N72 A;  5CZG A;  5ETB A;  3UVX A;  3G0J A;  4O74 A;  5EWV A;  5ENE A;  5D3T A;  5IGM A;  5EGU A;  5II2 A;  5ENC A;  4YY6 A;  2WP2 A;  5HM0 A;  2DAT A;  4UIW A;  4E96 A;  4CUP A;  4YH4 A;  3P1E A;  4UIU A;  4NRC A;  2MJV B;  4UYD A;  5DW2 A;  5G4S A;  4LZR A;  5EVA A;  4BW3 A;  4BW1 A;  4PKL A;  4J1P A;  5EV9 A;  5A5P A;  4OGI A;  5E7D A;  4N4H A;  5EPR A;  3LQH A;  3QZS A;  3FKM X;  3U5M A;  5FE0 A;  5CUE A;  4A9H A;  4AKN A;  5II1 A;  5C7N A;  2DWW A;  4QSR A;  3HMH A;  3MQM A;  5D26 A;  2DVR A;  3MB3 A;  5EIC A;  5EPS A;  4IR6 A;  4A9N A;  4LYI A;  4PCE A;  4IOR A;  5LJ1 A;  4YBS A;  5I7Y A;  4UIT A;  5H1T A;  4KCX A;  2RFJ A;  4N4G A;  4O78 A;  5F5Z A;  2DVS A;  2YYN A;  5A82 A;  4YAB A;  5DLZ A;  4A9E A;  4KV1 A;  4YYH A;  5CY9 A;  4NYX A;  2RI7 A;  4QYD A;  3LQJ A;  4Z93 A;  5DYX A;  4QC3 A;  4YYM A;  2I8N A;  4TU4 A;  5KTU A;  4C66 A;  3K2J A;  4YAT A;  5CQ7 A;  4BW2 A;  4N3W A;  5BT5 A;  2OUO A;  3ZYU A;  2RNW A;  4TT4 A;  4YC9 A;  5CGP A;  4O77 A;  5HJC A;  4NQM A;  4UIZ A;  5H1U A;  4Z1Q A;  5FH8 A;  5I40 A;  5HEN A;  3P5O A;  4BW4 A;  4Z1S A;  4UYF A;  3O36 A;  5TB6 A;  2LSP B;  5A85 A;  5DFB A;  5CQ6 A;  5DYA A;  5D3S A;  3IU6 A;  4UYH A;  4UIY A;  4ZW1 A;  4WHW A;  5KHM A;  4HBW A;  5E74 A;  5KTX A;  3O37 A;  5EWW A;  5FH7 A;  5E3D A;  5COI A;  4YAX A;  5ENI A;  4YK0 A;  5ENG A;  5A5O A;  5FE7 A;  5F25 A;  4NR9 A;  4YYG A;  5I86 A;  5EQ1 A;  4O70 A;  5I29 A;  4A9J A;  4NRA A;  4HXP A;  4CUR A;  5KO4 A;  3UVW A;  3O35 A;  4NUE A;  4OGJ A;  5D3H A;  3P1C A;  4NUC A;  3IU5 A;  5CUD A;  5FG6 A;  4YBM A;  5CU8 A;  3LXJ A;  5HRW A;  4QNS A;  4TZ2 A;  5AD3 A;  3O33 A;  4NUD A;  5CS8 A;  3UVD A;  4A9M A;  5HQ6 A;  5IID A;  2G4A A;  5FG4 A;  3LJW A;  2DKW A;  4QUT A;  5F36 A;  5E9M A;  4QYL A;  5DYU A;  5CQ8 A;  4J0S A;  4TQN A;  2YEK A;  4MEO A;  3LQI A;  5IG6 A;  3S92 A;  4TT6 A;  3UV4 A;  4PS5 A;  4HXR A;  4UIX A;  5CTL A;  4N4F A;  3ONI A;  4A9L A;  4HXM A;  4KV4 A;  4X2I A;  5HRV A;  4ALG A;  5HCL A;  4MR3 A;  4CFK A;  5CFW A;  4HBV A;  5D0C A;  4HXK A;  3TLP A;  5A7C A;  5CQ5 A;  5D3P A;  4ZC9 A;  5ENH A;  4QST A;  3UW9 A;  2R0S A;  2H60 A;  4NRB A;  4XUA A;  5DX4 A;  5L8U A;  4QSU A;  3O34 A;  5E9L A;  5A83 A;  5LKT A;  5CQ4 A;  3HME A;  4O7C A;  5FE3 A;  5FE5 A;  5KTW A;  4CUU A;  4FLP A;  5CQT A;  4UYE A;  5HRX A;  1JM4 B;  2R0Y A;  5EIS A;  4YAD A;  5FE2 A;  4WIV A;  3I3J A;  5ENB A;  5A81 A;  2YEL A;  3JVJ A;  4HXL A;  4CUQ A;  5ETD A;  4QZS A;  3U5J A;  2OSS A;  4Z6H A;  4YYD A;  4HXN A;  5FFY A;  5C87 A;  1E6I A;  5CUG A;  4UYG A;  4TZ8 A;  5CQA A;  5D25 A;  4QSV A;  2KTB B;  3AAD A;  4QBM A;  2YDW A;  5KU3 A;  3DWY A;  5K29 A;  5JI8 A;  5AME A;  4NYV A;  5ENF A;  4LZ2 A;  4N4I A;  3UV2 A;  5FH6 A;  4DON A;  5FB1 A;  4HXS A;  4QR5 A;  3S91 A;  4MEN A;  4QSQ A;  4Y03 A;  5F3A A;  5CRZ A;  5HFQ A;  3UVY A;  4LC2 A;  3G0L A;  5LUU A;  4QEW A;  5E9K A;  4YYN A;  5FE1 A;  5E73 A;  4YYJ A;  5FE4 A;  5E9Y A;  2RNX A;  4Q0O A;  4MR5 A;  4CLB A;  2RO1 A;  2GRC A;  5DFC A;  4NR6 A;  3SVG A;  2F6J A;  4IR3 A;  2E7O A;  5I80 A;  4Z6I A;  3RCW A;  5D3N A;  4QEV A;  4XY9 A;  4Q0N A;  2RS9 B;  3JVL A;  4J3I A;  4NQN A;  4QB3 A;  5LKU A;  2NXB A;  3AQA A;  4A9K A;  5I1Q A;  4TT2 A;  4LR6 A;  4QSX A;  4TS8 A;  3U5K A;  4O7F A;  5FE8 A;  5FDZ A;  4LYS A;  5F61 A;  4LRG A;  4XY8 A;  5BT3 A; 
#chains in the Genus database with same CATH topology
 5JWM A;  5L99 A;  4O75 A;  5I89 A;  4O76 A;  5DY7 A;  5F60 A;  5L98 A;  3D7C A;  2YEM A;  3VKG A;  2R10 A;  4PTB A;  5CUA A;  3U5L A;  5ENJ A;  2DVV A;  3MUK A;  5EWH A;  2I7K A;  5IGN A;  4WHU A;  4QC1 A;  3SVF A;  4HBX A;  4A9I A;  4YH3 A;  3DAI A;  5HQ5 A;  5E3G A;  1F68 A;  4RVR A;  4QSP A;  5AMF A;  5D3R A;  4LZS A;  5CQ3 A;  4YYK A;  5E9I A;  4PCI A;  4PY6 A;  5DYC A;  5IBN A;  5F62 A;  4O7A A;  3U5P A;  3QZV A;  3MB4 A;  4O72 A;  5CPE A;  1EQF A;  4NR5 A;  4F3I A;  4HBY A;  5I83 A;  5FFW A;  4NR8 A;  3HMF A;  4MR4 A;  4NYW A;  5E0R A;  5EWD A;  3Q2E A;  4A9O A;  1PUO A;  5F1L A;  4LYW A;  4GPJ A;  4CUT A;  5EI4 A;  4A9F A;  5EP7 A;  5LJ2 A;  2N9G A;  5D3L A;  5F63 A;  4NS5 A;  2L5E A;  3P1F A;  5DW1 A;  4O7E A;  4YYI A;  4QEU A;  5EA1 A;  3ERR A;  3P1D A;  4YY4 A;  1WUG A;  5I7X A;  5LVR A;  4NR4 A;  5I88 A;  5HEM A;  5EK9 A;  5DKD A;  4TU6 A;  2FSA A;  4XUB A;  4MEP A;  2YQD A;  3JVK A;  3UV5 A;  5ACY A;  5HLS A;  5LKX A;  3MXF A;  5CRM A;  4OUF A;  5L97 A;  5A5S A;  5BT4 A;  2L85 A;  4CFL A;  5DBM A;  2L84 A;  5CUC A;  4TTE A;  3GG3 A;  5D24 A;  5FFV A;  5EU1 A;  4IR4 A;  5LJ0 A;  5C8G A;  5L96 A;  4XYA A;  1X0J A;  4QSS A;  4MR6 A;  4QR3 A;  2D9E A;  4J0R A;  5AD2 A;  4ALH A;  4IOO A;  4TYL A;  4O7B A;  4C67 A;  5J0D A;  4QUU A;  4IR5 A;  1JSP B;  5HFR A;  2F6N A;  5H85 A;  3U5O A;  5EPB A;  5F2P A;  5CP5 A;  2D82 A;  5A5N A;  2DVQ A;  4MEQ A;  4NXJ A;  5C85 A;  2E3K A;  4NR7 A;  5DFD A;  4ZQL A;  5FB0 A;  5LKZ A;  5FBX A;  5F1H A;  5FE6 A;  5HQ7 A;  5LVQ A;  3Q2F A;  3MUL A;  5CUB A;  4QY4 A;  4UIV A;  3SVH A;  2WP1 A;  5DKH A;  4CL9 A;  4QR4 A;  5C89 A;  5FG5 A;  3U5N A;  2YW5 A;  5A5Q A;  4BHW A;  5HEL A;  3D1B A;  2R0V A;  5IGK A;  5E9V A;  5L8T A;  5D7X A;  1ZS5 A;  1WUM A;  5DLX A;  5A5R A;  5DKC A;  4YBT A;  2RNY A;  5EWC A;  4O71 A;  5H1V A;  3NXB A;  5D3J A;  2E7N A;  4CUS A;  2OO1 A;  3QZT A;  5IGL A;  5EM3 A;  4LDF A;  5G4R A;  4HXO A;  4QSW A;  5TCM A;  4BJX A;  4AKI A;  4UYF B;  4IOQ A;  3JVM A;  5C4Q A;  5FE9 A;  1N72 A;  5CZG A;  5ETB A;  3UVX A;  3G0J A;  4O74 A;  5EWV A;  5ENE A;  5D3T A;  5IGM A;  5EGU A;  5II2 A;  5ENC A;  4YY6 A;  2WP2 A;  5HM0 A;  2DAT A;  4UIW A;  4E96 A;  4CUP A;  4YH4 A;  3P1E A;  4UIU A;  4NRC A;  2MJV B;  4UYD A;  5DW2 A;  5G4S A;  4LZR A;  5EVA A;  4BW3 A;  4BW1 A;  4PKL A;  4J1P A;  5EV9 A;  5A5P A;  4OGI A;  5E7D A;  4N4H A;  5EPR A;  3LQH A;  3QZS A;  3FKM X;  3U5M A;  5FE0 A;  5CUE A;  4A9H A;  4AKN A;  5II1 A;  5C7N A;  2DWW A;  4QSR A;  3HMH A;  3MQM A;  5D26 A;  2DVR A;  3MB3 A;  5EIC A;  5EPS A;  4IR6 A;  4A9N A;  4LYI A;  4PCE A;  4IOR A;  5LJ1 A;  4YBS A;  5I7Y A;  4UIT A;  5H1T A;  4KCX A;  2RFJ A;  4N4G A;  4O78 A;  5F5Z A;  2DVS A;  2YYN A;  5A82 A;  4YAB A;  5DLZ A;  4A9E A;  4KV1 A;  4YYH A;  5CY9 A;  4NYX A;  2RI7 A;  4QYD A;  3LQJ A;  4Z93 A;  5DYX A;  4QC3 A;  4YYM A;  2I8N A;  4TU4 A;  5KTU A;  4C66 A;  3K2J A;  4YAT A;  5CQ7 A;  4BW2 A;  4N3W A;  5BT5 A;  2OUO A;  3ZYU A;  2RNW A;  4TT4 A;  4YC9 A;  3D1D A;  5CGP A;  4O77 A;  5HJC A;  4NQM A;  4UIZ A;  5H1U A;  4Z1Q A;  5FH8 A;  5I40 A;  5HEN A;  3P5O A;  4BW4 A;  4Z1S A;  4UYF A;  3O36 A;  5TB6 A;  2LSP B;  5A85 A;  5DFB A;  5CQ6 A;  5DYA A;  5D3S A;  3IU6 A;  4UYH A;  4UIY A;  4ZW1 A;  4WHW A;  5KHM A;  4HBW A;  5E74 A;  5KTX A;  3O37 A;  5EWW A;  5FH7 A;  5E3D A;  5COI A;  4YAX A;  5ENI A;  4YK0 A;  5ENG A;  5A5O A;  5FE7 A;  5F25 A;  4NR9 A;  4YYG A;  5I86 A;  5EQ1 A;  4O70 A;  5I29 A;  4A9J A;  4NRA A;  4HXP A;  4CUR A;  5KO4 A;  3UVW A;  3O35 A;  4NUE A;  4OGJ A;  5D3H A;  3P1C A;  4NUC A;  3IU5 A;  2EJN A;  5CUD A;  5FG6 A;  4YBM A;  5CU8 A;  3LXJ A;  5HRW A;  4QNS A;  4TZ2 A;  5AD3 A;  3O33 A;  4NUD A;  5CS8 A;  3UVD A;  4A9M A;  5HQ6 A;  5IID A;  2G4A A;  5FG4 A;  3LJW A;  2DKW A;  4QUT A;  5F36 A;  5E9M A;  4QYL A;  5DYU A;  5CQ8 A;  4J0S A;  4TQN A;  2YEK A;  4MEO A;  4AI6 A;  3LQI A;  5IG6 A;  3S92 A;  4TT6 A;  3UV4 A;  3VKH A;  4PS5 A;  4HXR A;  4UIX A;  5CTL A;  4N4F A;  3ONI A;  4A9L A;  4HXM A;  4KV4 A;  4X2I A;  5HRV A;  4ALG A;  5HCL A;  4MR3 A;  4CFK A;  4AKH A;  5CFW A;  4HBV A;  5D0C A;  4HXK A;  3TLP A;  5A7C A;  5CQ5 A;  5D3P A;  4AKG A;  4ZC9 A;  5ENH A;  4QST A;  3UW9 A;  2R0S A;  2H60 A;  4NRB A;  4XUA A;  5DX4 A;  5L8U A;  4QSU A;  3O34 A;  5E9L A;  5A83 A;  5LKT A;  5CQ4 A;  3HME A;  4O7C A;  5FE3 A;  5FE5 A;  5KTW A;  4CUU A;  4FLP A;  5CQT A;  4UYE A;  5HRX A;  1JM4 B;  2R0Y A;  5EIS A;  4YAD A;  5FE2 A;  4WIV A;  3I3J A;  5ENB A;  5A81 A;  2YEL A;  3JVJ A;  4HXL A;  4CUQ A;  5ETD A;  4QZS A;  3U5J A;  2OSS A;  4Z6H A;  4YYD A;  4HXN A;  5FFY A;  5C87 A;  1E6I A;  5CUG A;  4UYG A;  4TZ8 A;  5CQA A;  5D25 A;  4QSV A;  2KTB B;  3AAD A;  4QBM A;  2YDW A;  5KU3 A;  3DWY A;  5K29 A;  5JI8 A;  5AME A;  4NYV A;  5ENF A;  4LZ2 A;  1ZKR A;  4N4I A;  3UV2 A;  5FH6 A;  4DON A;  5FB1 A;  4HXS A;  4QR5 A;  3S91 A;  4MEN A;  4QSQ A;  4Y03 A;  5F3A A;  5CRZ A;  5HFQ A;  3UVY A;  4LC2 A;  3G0L A;  5LUU A;  4QEW A;  5E9K A;  4YYN A;  5FE1 A;  5E73 A;  4YYJ A;  5FE4 A;  5E9Y A;  2RNX A;  4Q0O A;  4MR5 A;  4CLB A;  2RO1 A;  2GRC A;  5DFC A;  4NR6 A;  3SVG A;  2F6J A;  4IR3 A;  2E7O A;  5I80 A;  4Z6I A;  3RCW A;  5D3N A;  4QEV A;  4XY9 A;  4Q0N A;  2RS9 B;  3JVL A;  4J3I A;  4NQN A;  4QB3 A;  5LKU A;  2NXB A;  3AQA A;  4A9K A;  5I1Q A;  4TT2 A;  4LR6 A;  4QSX A;  4TS8 A;  3U5K A;  4O7F A;  5FE8 A;  5FDZ A;  4LYS A;  5F61 A;  4LRG A;  4XY8 A;  5BT3 A; 
#chains in the Genus database with same CATH homology
 5JWM A;  5L99 A;  4O75 A;  5I89 A;  4O76 A;  5DY7 A;  5F60 A;  5L98 A;  3D7C A;  2YEM A;  2R10 A;  4PTB A;  5CUA A;  3U5L A;  5ENJ A;  2DVV A;  3MUK A;  5EWH A;  2I7K A;  5IGN A;  4WHU A;  4QC1 A;  3SVF A;  4HBX A;  4A9I A;  4YH3 A;  3DAI A;  5HQ5 A;  5E3G A;  1F68 A;  4RVR A;  4QSP A;  5AMF A;  5D3R A;  4LZS A;  5CQ3 A;  4YYK A;  5E9I A;  4PCI A;  4PY6 A;  5DYC A;  5IBN A;  5F62 A;  4O7A A;  3U5P A;  3QZV A;  3MB4 A;  4O72 A;  5CPE A;  1EQF A;  4NR5 A;  4F3I A;  4HBY A;  5I83 A;  5FFW A;  4NR8 A;  3HMF A;  4MR4 A;  4NYW A;  5E0R A;  5EWD A;  3Q2E A;  4A9O A;  5F1L A;  4LYW A;  4GPJ A;  4CUT A;  5EI4 A;  4A9F A;  5EP7 A;  5LJ2 A;  2N9G A;  5D3L A;  5F63 A;  4NS5 A;  2L5E A;  3P1F A;  5DW1 A;  4O7E A;  4YYI A;  4QEU A;  5EA1 A;  3P1D A;  4YY4 A;  1WUG A;  5I7X A;  5LVR A;  4NR4 A;  5I88 A;  5HEM A;  5EK9 A;  5DKD A;  4TU6 A;  2FSA A;  4XUB A;  4MEP A;  2YQD A;  3JVK A;  3UV5 A;  5ACY A;  5HLS A;  5LKX A;  3MXF A;  5CRM A;  4OUF A;  5L97 A;  5A5S A;  5BT4 A;  2L85 A;  4CFL A;  5DBM A;  2L84 A;  5CUC A;  4TTE A;  3GG3 A;  5D24 A;  5FFV A;  5EU1 A;  4IR4 A;  5LJ0 A;  5C8G A;  5L96 A;  4XYA A;  1X0J A;  4QSS A;  4MR6 A;  4QR3 A;  2D9E A;  4J0R A;  5AD2 A;  4ALH A;  4IOO A;  4TYL A;  4O7B A;  4C67 A;  5J0D A;  4QUU A;  4IR5 A;  1JSP B;  5HFR A;  2F6N A;  5H85 A;  3U5O A;  5EPB A;  5F2P A;  5CP5 A;  2D82 A;  5A5N A;  2DVQ A;  4MEQ A;  4NXJ A;  5C85 A;  2E3K A;  4NR7 A;  5DFD A;  4ZQL A;  5FB0 A;  5LKZ A;  5FBX A;  5F1H A;  5FE6 A;  5HQ7 A;  5LVQ A;  3Q2F A;  3MUL A;  5CUB A;  4QY4 A;  4UIV A;  3SVH A;  2WP1 A;  5DKH A;  4CL9 A;  4QR4 A;  5C89 A;  5FG5 A;  3U5N A;  2YW5 A;  5A5Q A;  4BHW A;  5HEL A;  2R0V A;  5IGK A;  5E9V A;  5L8T A;  5D7X A;  1ZS5 A;  1WUM A;  5DLX A;  5A5R A;  5DKC A;  4YBT A;  2RNY A;  5EWC A;  4O71 A;  5H1V A;  3NXB A;  5D3J A;  2E7N A;  4CUS A;  2OO1 A;  3QZT A;  5IGL A;  5EM3 A;  4LDF A;  5G4R A;  4HXO A;  4QSW A;  5TCM A;  4BJX A;  4UYF B;  4IOQ A;  3JVM A;  5C4Q A;  5FE9 A;  1N72 A;  5CZG A;  5ETB A;  3UVX A;  3G0J A;  4O74 A;  5EWV A;  5ENE A;  5D3T A;  5IGM A;  5EGU A;  5II2 A;  5ENC A;  4YY6 A;  2WP2 A;  5HM0 A;  2DAT A;  4UIW A;  4E96 A;  4CUP A;  4YH4 A;  3P1E A;  4UIU A;  4NRC A;  2MJV B;  4UYD A;  5DW2 A;  5G4S A;  4LZR A;  5EVA A;  4BW3 A;  4BW1 A;  4PKL A;  4J1P A;  5EV9 A;  5A5P A;  4OGI A;  5E7D A;  4N4H A;  5EPR A;  3LQH A;  3QZS A;  3FKM X;  3U5M A;  5FE0 A;  5CUE A;  4A9H A;  4AKN A;  5II1 A;  5C7N A;  2DWW A;  4QSR A;  3HMH A;  3MQM A;  5D26 A;  2DVR A;  3MB3 A;  5EIC A;  5EPS A;  4IR6 A;  4A9N A;  4LYI A;  4PCE A;  4IOR A;  5LJ1 A;  4YBS A;  5I7Y A;  4UIT A;  5H1T A;  4KCX A;  2RFJ A;  4N4G A;  4O78 A;  5F5Z A;  2DVS A;  2YYN A;  5A82 A;  4YAB A;  5DLZ A;  4A9E A;  4KV1 A;  4YYH A;  5CY9 A;  4NYX A;  2RI7 A;  4QYD A;  3LQJ A;  4Z93 A;  5DYX A;  4QC3 A;  4YYM A;  2I8N A;  4TU4 A;  5KTU A;  4C66 A;  3K2J A;  4YAT A;  5CQ7 A;  4BW2 A;  4N3W A;  5BT5 A;  2OUO A;  3ZYU A;  2RNW A;  4TT4 A;  4YC9 A;  5CGP A;  4O77 A;  5HJC A;  4NQM A;  4UIZ A;  5H1U A;  4Z1Q A;  5FH8 A;  5I40 A;  5HEN A;  3P5O A;  4BW4 A;  4Z1S A;  4UYF A;  3O36 A;  5TB6 A;  2LSP B;  5A85 A;  5DFB A;  5CQ6 A;  5DYA A;  5D3S A;  3IU6 A;  4UYH A;  4UIY A;  4ZW1 A;  4WHW A;  5KHM A;  4HBW A;  5E74 A;  5KTX A;  3O37 A;  5EWW A;  5FH7 A;  5E3D A;  5COI A;  4YAX A;  5ENI A;  4YK0 A;  5ENG A;  5A5O A;  5FE7 A;  5F25 A;  4NR9 A;  4YYG A;  5I86 A;  5EQ1 A;  4O70 A;  5I29 A;  4A9J A;  4NRA A;  4HXP A;  4CUR A;  5KO4 A;  3UVW A;  3O35 A;  4NUE A;  4OGJ A;  5D3H A;  3P1C A;  4NUC A;  3IU5 A;  5CUD A;  5FG6 A;  4YBM A;  5CU8 A;  3LXJ A;  5HRW A;  4QNS A;  4TZ2 A;  5AD3 A;  3O33 A;  4NUD A;  5CS8 A;  3UVD A;  4A9M A;  5HQ6 A;  5IID A;  2G4A A;  5FG4 A;  3LJW A;  2DKW A;  4QUT A;  5F36 A;  5E9M A;  4QYL A;  5DYU A;  5CQ8 A;  4J0S A;  4TQN A;  2YEK A;  4MEO A;  3LQI A;  5IG6 A;  3S92 A;  4TT6 A;  3UV4 A;  4PS5 A;  4HXR A;  4UIX A;  5CTL A;  4N4F A;  3ONI A;  4A9L A;  4HXM A;  4KV4 A;  4X2I A;  5HRV A;  4ALG A;  5HCL A;  4MR3 A;  4CFK A;  5CFW A;  4HBV A;  5D0C A;  4HXK A;  3TLP A;  5A7C A;  5CQ5 A;  5D3P A;  4ZC9 A;  5ENH A;  4QST A;  3UW9 A;  2R0S A;  2H60 A;  4NRB A;  4XUA A;  5DX4 A;  5L8U A;  4QSU A;  3O34 A;  5E9L A;  5A83 A;  5LKT A;  5CQ4 A;  3HME A;  4O7C A;  5FE3 A;  5FE5 A;  5KTW A;  4CUU A;  4FLP A;  5CQT A;  4UYE A;  5HRX A;  1JM4 B;  2R0Y A;  5EIS A;  4YAD A;  5FE2 A;  4WIV A;  3I3J A;  5ENB A;  5A81 A;  2YEL A;  3JVJ A;  4HXL A;  4CUQ A;  5ETD A;  4QZS A;  3U5J A;  2OSS A;  4Z6H A;  4YYD A;  4HXN A;  5FFY A;  5C87 A;  1E6I A;  5CUG A;  4UYG A;  4TZ8 A;  5CQA A;  5D25 A;  4QSV A;  2KTB B;  3AAD A;  4QBM A;  2YDW A;  5KU3 A;  3DWY A;  5K29 A;  5JI8 A;  5AME A;  4NYV A;  5ENF A;  4LZ2 A;  4N4I A;  3UV2 A;  5FH6 A;  4DON A;  5FB1 A;  4HXS A;  4QR5 A;  3S91 A;  4MEN A;  4QSQ A;  4Y03 A;  5F3A A;  5CRZ A;  5HFQ A;  3UVY A;  4LC2 A;  3G0L A;  5LUU A;  4QEW A;  5E9K A;  4YYN A;  5FE1 A;  5E73 A;  4YYJ A;  5FE4 A;  5E9Y A;  2RNX A;  4Q0O A;  4MR5 A;  4CLB A;  2RO1 A;  2GRC A;  5DFC A;  4NR6 A;  3SVG A;  2F6J A;  4IR3 A;  2E7O A;  5I80 A;  4Z6I A;  3RCW A;  5D3N A;  4QEV A;  4XY9 A;  4Q0N A;  2RS9 B;  3JVL A;  4J3I A;  4NQN A;  4QB3 A;  5LKU A;  2NXB A;  3AQA A;  4A9K A;  5I1Q A;  4TT2 A;  4LR6 A;  4QSX A;  4TS8 A;  3U5K A;  4O7F A;  5FE8 A;  5FDZ A;  4LYS A;  5F61 A;  4LRG A;  4XY8 A;  5BT3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...