1JM4B

Nmr structure of p/caf bromodomain in complex with hiv-1 tat peptide
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
118
structure length
118
Chain Sequence
GSHMSKEPRDPDQLYSTLKSILQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLKNRYYVSKKLFMADLQRVFTNCKEYNPPESEYYKCANILEKFFFSKIKEAGLIDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords HIV-1 Tat Peptide
publication title Structural basis of lysine-acetylated HIV-1 Tat recognition by PCAF bromodomain
pubmed doi rcsb
source organism Homo sapiens
total genus 28
structure length 118
sequence length 118
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2001-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 1jm4B00
4OGIA 1EQFA 5CY9A 4QY4A 3GG3A 5F3AA 4NUDA 5A81A 3P1FA 5CP5A 5CUGA 1E6IA 3JVJA 5CTLA 4PY6A 3NXBA 2OO1A 4LYWA 2G4AA 5ENJA 4TU4A 4YYKA 2RI7A 4N4HA 4N3WA 3SVFA 4NR8A 4QBMA 4Z6IA 4PCIA 4NYXA 5EI4A 5HQ7A 4UYDA 2E7NA 1WUGA 4Y03A 3S92A 4CUTA 4QEUA 5L99A 2D9EA 4Z1QA 4PCEA 3P1DA 3QZVA 5I29A 4TS8A 5DFBA 4YYNA 4HXPA 5F62A 5E9IA 5FBXA 5DX4A 2LSPB 4LYSA 4HBVA 5DKDA 4CFLA 2OSSA 3UW9A 5F2PA 2E7OA 3FKMX 5E9LA 3S91A 4Z1SA 4PKLA 5D3NA 5FH6A 4YBTA 2GRCA 3MB4A 4O7FA 5CQTA 4QEVA 5I89A 3U5OA 2DVSA 4TZ2A 4CFKA 3UVWA 5II2A 5C7NA 2OUOA 3DAIA 4IR5A 5BT4A 5CUEA 4NUEA 5FH8A 5LKXA 4CUPA 4YY4A 4YYDA 5AD3A 5HEMA 5FE9A 5FG5A 3UVXA 5LVRA 5DYUA 5D3LA 5LKTA 4YC9A 5DLZA 5FB1A 3U5MA 4UYGA 4CLBA 3G0JA 4QC3A 5I83A 4KV1A 4BJXA 5L98A 4Q0OA 2R0YA 4HXNA 4XUAA 4C66A 3JVMA 4QYDA 5LVQA 4LZRA 5DW2A 5K29A 3D7CA 5DFCA 4LC2A 4IR6A 5CRZA 4UIWA 1WUMA 4J1PA 5E9VA 3I3JA 3LQJA 5ENGA 4ZC9A 5HM0A 4CUUA 3K2JA 4WHUA 5C87A 4CURA 5D25A 5D3PA 5BT3A 4IR4A 5EPRA 4UIYA 5DBMA 5I88A 5CQ6A 4LYIA 5L8UA 4GPJA 4UYHA 5EVAA 5CQ4A 4QSRA 2NXBA 4QSXA 4F3IA 5EISA 4YY6A 5D24A 4YH3A 5ENBA 3AADA 2YDWA 5FE1A 4QEWA 5DY7A 5F63A 4BHWA 5JWMA 4A9LA 2F6JA 4IOOA 5COIA 5FE6A 5AMEA 4YBMA 5CQ5A 3SVGA 5DKHA 5CQ3A 4C67A 5FE5A 4A9KA 2R0SA 4QZSA 4KV4A 4QSVA 4MR4A 2KTBB 4MR3A 2YEMA 4UIXA 5D3HA 4N4FA 5FFWA 5FE8A 5CS8A 4A9FA 4HXLA 5HRVA 3O36A 5IIDA 5EP7A 5I80A 4NQNA 4ALHA 2RNXA 3MULA 4LZSA 4IR3A 5ENEA 4NQMA 4LZ2A 5EQ1A 5C4QA 5EGUA 4J0SA 4NRAA 4O75A 4QUTA 5LJ1A 5I7XA 3U5PA 5D26A 4NRBA 3LXJA 4UITA 5EPBA 1X0JA 5JI8A 4NR9A 4XY8A 4QR5A 5CPEA 5KTUA 5BT5A 4OGJA 5I1QA 4YH4A 4A9OA 3IU5A 4RVRA 4XUBA 2DVVA 4Z93A 5F1HA 4BW4A 4YBSA 5C85A 3DWYA 5H1TA 5F36A 3UVDA 3U5NA 4OUFA 5TCMA 4ZQLA 5ACYA 5D0CA 4NR7A 5FE3A 3RCWA 5F60A 5C8GA 2YEKA 5FG4A 3U5JA 5IBNA 5ENIA 5A5PA 4YABA 4ALGA 5E9KA 5HRWA 4TT2A 4UIVA 5EA1A 4WHWA 2DKWA 5HQ6A 4TQNA 5CUCA 4HBXA 4UYFA 3UV5A 4NYWA 4IORA 2WP1A 5A5NA 3MXFA 5E74A 5L8TA 1F68A 5F5ZA 4O77A 4TZ8A 2D82A 5FG6A 4IOQA 4O74A 4E96A 2DWWA 3JVKA 1JM4B 2DVRA 4QSPA 5CUAA 2YYNA 3HMHA 2YW5A 2L85A 3UV2A 4YYMA 5H1UA 5EWWA 3QZSA 4MEOA 3UV4A 4AKNA 4TT6A 5J0DA 5CUBA 3P1CA 5IGKA 5D3RA 5HFQA 4J3IA 5AD2A 4A9HA 3ZYUA 4HXKA 4YADA 4A9NA 4NYVA 4CUSA 4QSSA 4BW3A 4PTBA 4NR6A 5IG6A 4XYAA 2H60A 4QSUA 5I40A 5LUUA 5LJ0A 5HRXA 4QC1A 5EICA 5L97A 3LQHA 4MR6A 4N4GA 3MQMA 4QNSA 5IGLA 5EWVA 4O7CA 4X2IA 5KTXA 5EU1A 2N9GA 2F6NA 3SVHA 3MB3A 4QSTA 3G0LA 4KCXA 3LJWA 4HXRA 4HXSA 3Q2EA 5DYAA 4NR5A 4YYJA 5G4SA 5CQ8A 5CQAA 5EV9A 2FSAA 5H85A 5I7YA 4WIVA 4Z6HA 5ETDA 5IGNA 1JSPB 5AMFA 3HMEA 3Q2FA 4O7EA 4LDFA 4XY9A 5F61A 4CL9A 4FLPA 5LKUA 2YQDA 4O76A 4MEPA 4DONA 5DYXA 5E0RA 4BW2A 4YAXA 3MUKA 5G4RA 5FFVA 3QZTA 3LQIA 4O72A 5E3DA 5CFWA 5HFRA 3AQAA 5FDZA 5DKCA 3IU6A 4O7BA 5D3TA 5CUDA 2I7KA 2YELA 2L5EA 4A9IA 5A85A 4J0RA 4CUQA 2RO1A 4HBWA 4QR3A 4HXMA 5HQ5A 5C89A 3UVYA 5FE2A 3HMFA 5F1LA 3O37A 3P1EA 4HXOA 4NXJA 5CU8A 4LRGA 3U5LA 4YYGA 5LJ2A 4TTEA 2RNYA 5TB6A 4N4IA 1N72A 5E9MA 5CRMA 5I86A 5A5OA 4ZW1A 4QB3A 2RS9B 3ONIA 5HJCA 1ZS5A 5HLSA 4TT4A 4UIZA 5F25A 3P5OA 4A9EA 5KU3A 5EWDA 5DYCA 3O35A 5CGPA 2R0VA 5A5SA 5KHMA 5CQ7A 5FFYA 5II1A 4TU6A 5KTWA 5D3JA 2L84A 2E3KA 4UYEA 5A82A 3TLPA 2MJVB 5DFDA 2RNWA 5FE0A 4YATA 4NR4A 4MEQA 4O78A 4O71A 5E3GA 5DW1A 4TYLA 2DVQA 5E9YA 4O70A 5IGMA 4A9MA 4QR4A 5EM3A 5FE7A 5FE4A 4YYIA 5A83A 5A7CA 3JVLA 5ENCA 5EWHA 5H1VA 5A5QA 5KO4A 3O33A 5ENHA 5FB0A 5DLXA 5EK9A 3O34A 4UYFB 5HELA 4Q0NA 4A9JA 5HCLA 4QSQA 4QYLA 5D3SA 5FH7A 4NRCA 4NS5A 5E7DA 3U5KA 4LR6A 4O7AA 4MR5A 4MENA 4BW1A 5EWCA 2WP2A 5LKZA 5D7XA 4NUCA 5CZGA 2I8NA 4UIUA 5HENA 4HBYA 5ETBA 5L96A 2DATA 5E73A 4YYHA 4PS5A 4QSWA 5A5RA 5ENFA 5EPSA 4QUUA 2R10A 2RFJA 4YK0A
chains in the Genus database with same CATH superfamily
4OGIA 1EQFA 5CY9A 4QY4A 3GG3A 5F3AA 4NUDA 5A81A 3P1FA 5CP5A 5CUGA 1E6IA 3JVJA 5CTLA 4PY6A 3NXBA 2OO1A 4LYWA 2G4AA 5ENJA 4TU4A 4YYKA 2RI7A 4N4HA 4N3WA 3SVFA 4NR8A 4QBMA 4Z6IA 4PCIA 4NYXA 5EI4A 5HQ7A 4UYDA 1WUGA 2E7NA 4Y03A 3S92A 4CUTA 4QEUA 5L99A 2D9EA 4Z1QA 4PCEA 3P1DA 3QZVA 5I29A 4TS8A 5DFBA 4YYNA 4HXPA 5F62A 5E9IA 5FBXA 5DX4A 2LSPB 4LYSA 4HBVA 5DKDA 4CFLA 2OSSA 3UW9A 5F2PA 2E7OA 3FKMX 5E9LA 3S91A 4Z1SA 4PKLA 5D3NA 5FH6A 4YBTA 2GRCA 3MB4A 4O7FA 5CQTA 4QEVA 5I89A 3U5OA 2DVSA 4TZ2A 4CFKA 3UVWA 5II2A 5C7NA 2OUOA 3DAIA 4IR5A 5BT4A 5CUEA 4NUEA 5FH8A 5LKXA 4CUPA 4YY4A 4YYDA 5AD3A 5HEMA 5FE9A 5FG5A 3UVXA 5LVRA 5DYUA 5D3LA 5LKTA 4YC9A 5DLZA 5FB1A 3U5MA 4UYGA 4CLBA 3G0JA 4QC3A 5I83A 4KV1A 4BJXA 5L98A 4AKGA 4Q0OA 2R0YA 4HXNA 4XUAA 4C66A 3JVMA 4QYDA 5LVQA 4LZRA 5DW2A 5K29A 3D7CA 5DFCA 4LC2A 4IR6A 5CRZA 4UIWA 1WUMA 4J1PA 5E9VA 3I3JA 3LQJA 5ENGA 4ZC9A 5HM0A 4CUUA 3K2JA 4WHUA 5C87A 4CURA 5D25A 5D3PA 5BT3A 4IR4A 5EPRA 4UIYA 5DBMA 5I88A 5CQ6A 4LYIA 5L8UA 4GPJA 4UYHA 5EVAA 5CQ4A 4QSRA 2NXBA 4QSXA 4F3IA 5EISA 4YY6A 5D24A 4YH3A 5ENBA 3AADA 2YDWA 5FE1A 4QEWA 5DY7A 5F63A 4BHWA 5JWMA 4A9LA 2F6JA 4IOOA 5COIA 5FE6A 5AMEA 4YBMA 5CQ5A 3SVGA 5DKHA 5CQ3A 4C67A 5FE5A 4A9KA 2R0SA 4QZSA 4KV4A 4QSVA 4MR4A 2KTBB 4MR3A 2YEMA 4UIXA 5D3HA 4N4FA 5FFWA 5FE8A 5CS8A 4A9FA 4HXLA 5HRVA 3O36A 5IIDA 5EP7A 5I80A 4NQNA 4ALHA 2RNXA 3MULA 4LZSA 4IR3A 5ENEA 4NQMA 4LZ2A 5EQ1A 5C4QA 5EGUA 4J0SA 4NRAA 4O75A 4QUTA 5LJ1A 5I7XA 3U5PA 5D26A 4NRBA 3LXJA 4UITA 5EPBA 1X0JA 5JI8A 4NR9A 4XY8A 4QR5A 5CPEA 5KTUA 5BT5A 4OGJA 5I1QA 4YH4A 4A9OA 3IU5A 4RVRA 4XUBA 2DVVA 4Z93A 5F1HA 4BW4A 4YBSA 5C85A 3DWYA 5H1TA 5F36A 3UVDA 3U5NA 4OUFA 5TCMA 4ZQLA 5ACYA 5D0CA 4NR7A 5FE3A 3RCWA 5F60A 5C8GA 2YEKA 5FG4A 3U5JA 5IBNA 3VKGA 5ENIA 5A5PA 4YABA 4ALGA 5E9KA 5HRWA 4TT2A 4UIVA 5EA1A 4WHWA 2DKWA 5HQ6A 4TQNA 5CUCA 4HBXA 4UYFA 3UV5A 4NYWA 4IORA 2WP1A 5A5NA 3MXFA 3VKHA 4AKHA 5E74A 5L8TA 1F68A 5F5ZA 4O77A 4TZ8A 2D82A 5FG6A 4IOQA 4O74A 4E96A 2DWWA 3JVKA 1JM4B 2DVRA 4QSPA 5CUAA 2YYNA 3HMHA 2YW5A 2L85A 3UV2A 4YYMA 5H1UA 5EWWA 3QZSA 4MEOA 3UV4A 4AKNA 4TT6A 5J0DA 5CUBA 3P1CA 5IGKA 5D3RA 5HFQA 4J3IA 5AD2A 4A9HA 3ZYUA 4HXKA 4YADA 4A9NA 4NYVA 4CUSA 4QSSA 4BW3A 4PTBA 4NR6A 5IG6A 4XYAA 2H60A 4QSUA 5I40A 5LUUA 5LJ0A 5HRXA 4QC1A 5EICA 5L97A 3LQHA 4MR6A 4N4GA 3MQMA 4QNSA 5IGLA 5EWVA 4O7CA 4X2IA 5KTXA 4AKIA 5EU1A 2N9GA 2F6NA 3SVHA 3MB3A 4QSTA 3G0LA 4KCXA 3LJWA 4HXRA 4HXSA 3Q2EA 5DYAA 4NR5A 4YYJA 5G4SA 5CQ8A 5CQAA 5EV9A 2FSAA 5H85A 5I7YA 4WIVA 4Z6HA 5ETDA 5IGNA 1JSPB 5AMFA 3HMEA 3Q2FA 4O7EA 4LDFA 4XY9A 5F61A 4CL9A 4FLPA 5LKUA 2YQDA 1ZKRA 4O76A 4MEPA 4DONA 5DYXA 5E0RA 4BW2A 4YAXA 3MUKA 5G4RA 5FFVA 3QZTA 3LQIA 4O72A 5E3DA 5CFWA 5HFRA 3AQAA 5FDZA 5DKCA 3IU6A 4O7BA 5D3TA 5CUDA 2I7KA 2YELA 2L5EA 4A9IA 5A85A 4J0RA 4CUQA 2RO1A 4HBWA 4QR3A 4HXMA 5HQ5A 5C89A 3UVYA 5FE2A 3D1BA 3HMFA 5F1LA 3O37A 3P1EA 4HXOA 4NXJA 5CU8A 4LRGA 3U5LA 4YYGA 5LJ2A 4TTEA 2RNYA 5TB6A 1PUOA 4N4IA 1N72A 5E9MA 5CRMA 5I86A 5A5OA 4ZW1A 4QB3A 2RS9B 3ONIA 5HJCA 1ZS5A 5HLSA 4TT4A 4UIZA 5F25A 3P5OA 4A9EA 5KU3A 5EWDA 5DYCA 3O35A 5CGPA 2R0VA 5A5SA 5KHMA 5CQ7A 5FFYA 5II1A 4TU6A 2EJNA 5KTWA 5D3JA 2L84A 2E3KA 4UYEA 5A82A 3TLPA 2MJVB 5DFDA 2RNWA 5FE0A 4YATA 4NR4A 4MEQA 4O78A 4O71A 5E3GA 5DW1A 4TYLA 2DVQA 5E9YA 4O70A 3D1DA 5IGMA 4A9MA 4QR4A 5EM3A 5FE7A 5FE4A 4YYIA 5A83A 5A7CA 3JVLA 5ENCA 5EWHA 5H1VA 3ERRA 5A5QA 5KO4A 3O33A 5ENHA 5FB0A 5DLXA 5EK9A 3O34A 4UYFB 5HELA 4Q0NA 4A9JA 5HCLA 4QSQA 4QYLA 5D3SA 5FH7A 4NRCA 4NS5A 5E7DA 3U5KA 4LR6A 4O7AA 4MR5A 4MENA 4BW1A 4AI6A 5EWCA 2WP2A 5LKZA 5D7XA 4NUCA 5CZGA 2I8NA 4UIUA 5HENA 4HBYA 5ETBA 5L96A 2DATA 5E73A 4YYHA 4PS5A 4QSWA 5A5RA 5ENFA 5EPSA 4QUUA 2R10A 2RFJA 4YK0A
chains in the Genus database with same CATH topology
4OGIA 1EQFA 5CY9A 4QY4A 3GG3A 5F3AA 4NUDA 5A81A 3P1FA 5CP5A 5CUGA 1E6IA 3JVJA 5CTLA 4PY6A 3NXBA 2OO1A 4LYWA 2G4AA 5ENJA 4TU4A 4YYKA 2RI7A 4N4HA 4N3WA 3SVFA 4NR8A 4QBMA 4Z6IA 4PCIA 4NYXA 5EI4A 5HQ7A 4UYDA 2E7NA 1WUGA 4Y03A 3S92A 4CUTA 4QEUA 5L99A 2D9EA 4Z1QA 4PCEA 3P1DA 3QZVA 5I29A 4TS8A 5DFBA 4YYNA 4HXPA 5F62A 5E9IA 5FBXA 5DX4A 2LSPB 4LYSA 4HBVA 5DKDA 4CFLA 2OSSA 3UW9A 5F2PA 2E7OA 3FKMX 5E9LA 3S91A 4Z1SA 4PKLA 5D3NA 5FH6A 4YBTA 2GRCA 3MB4A 4O7FA 5CQTA 4QEVA 5I89A 3U5OA 2DVSA 4TZ2A 4CFKA 3UVWA 5II2A 5C7NA 2OUOA 3DAIA 4IR5A 5BT4A 5CUEA 4NUEA 5FH8A 5LKXA 4CUPA 4YY4A 4YYDA 5AD3A 5HEMA 5FE9A 5FG5A 3UVXA 5LVRA 5DYUA 5D3LA 5LKTA 4YC9A 5DLZA 5FB1A 3U5MA 4UYGA 4CLBA 3G0JA 4QC3A 5I83A 4KV1A 4BJXA 5L98A 4Q0OA 2R0YA 4HXNA 4XUAA 4C66A 3JVMA 4QYDA 5LVQA 4LZRA 5DW2A 5K29A 3D7CA 5DFCA 4LC2A 4IR6A 5CRZA 4UIWA 1WUMA 4J1PA 5E9VA 3I3JA 3LQJA 5ENGA 4ZC9A 5HM0A 4CUUA 3K2JA 4WHUA 5C87A 4CURA 5D25A 5D3PA 5BT3A 4IR4A 5EPRA 4UIYA 5DBMA 5I88A 5CQ6A 4LYIA 5L8UA 4GPJA 4UYHA 5EVAA 5CQ4A 4QSRA 2NXBA 4QSXA 4F3IA 5EISA 4YY6A 5D24A 4YH3A 5ENBA 3AADA 2YDWA 5FE1A 4QEWA 5DY7A 5F63A 4BHWA 5JWMA 4A9LA 2F6JA 4IOOA 5COIA 5FE6A 5AMEA 4YBMA 5CQ5A 3SVGA 5DKHA 5CQ3A 4C67A 5FE5A 4A9KA 2R0SA 4QZSA 4KV4A 4QSVA 4MR4A 2KTBB 4MR3A 2YEMA 4UIXA 5D3HA 4N4FA 5FFWA 5FE8A 5CS8A 4A9FA 4HXLA 5HRVA 3O36A 5IIDA 5EP7A 5I80A 4NQNA 4ALHA 2RNXA 3MULA 4LZSA 4IR3A 5ENEA 4NQMA 4LZ2A 5EQ1A 5C4QA 5EGUA 4J0SA 4NRAA 4O75A 4QUTA 5LJ1A 5I7XA 3U5PA 5D26A 4NRBA 3LXJA 4UITA 5EPBA 1X0JA 5JI8A 4NR9A 4XY8A 4QR5A 5CPEA 5KTUA 5BT5A 4OGJA 5I1QA 4YH4A 4A9OA 3IU5A 4RVRA 4XUBA 2DVVA 4Z93A 5F1HA 4BW4A 4YBSA 5C85A 3DWYA 5H1TA 5F36A 3UVDA 3U5NA 4OUFA 5TCMA 4ZQLA 5ACYA 5D0CA 4NR7A 5FE3A 3RCWA 5F60A 5C8GA 2YEKA 5FG4A 3U5JA 5IBNA 5ENIA 5A5PA 4YABA 4ALGA 5E9KA 5HRWA 4TT2A 4UIVA 5EA1A 4WHWA 2DKWA 5HQ6A 4TQNA 5CUCA 4HBXA 4UYFA 3UV5A 4NYWA 4IORA 2WP1A 5A5NA 3MXFA 5E74A 5L8TA 1F68A 5F5ZA 4O77A 4TZ8A 2D82A 5FG6A 4IOQA 4O74A 4E96A 2DWWA 3JVKA 1JM4B 2DVRA 4QSPA 5CUAA 2YYNA 3HMHA 2YW5A 2L85A 3UV2A 4YYMA 5H1UA 5EWWA 3QZSA 4MEOA 3UV4A 4AKNA 4TT6A 5J0DA 5CUBA 3P1CA 5IGKA 5D3RA 5HFQA 4J3IA 5AD2A 4A9HA 3ZYUA 4HXKA 4YADA 4A9NA 4NYVA 4CUSA 4QSSA 4BW3A 4PTBA 4NR6A 5IG6A 4XYAA 2H60A 4QSUA 5I40A 5LUUA 5LJ0A 5HRXA 4QC1A 5EICA 5L97A 3LQHA 4MR6A 4N4GA 3MQMA 4QNSA 5IGLA 5EWVA 4O7CA 4X2IA 5KTXA 5EU1A 2N9GA 2F6NA 3SVHA 3MB3A 4QSTA 3G0LA 4KCXA 3LJWA 4HXRA 4HXSA 3Q2EA 5DYAA 4NR5A 4YYJA 5G4SA 5CQ8A 5CQAA 5EV9A 2FSAA 5H85A 5I7YA 4WIVA 4Z6HA 5ETDA 5IGNA 1JSPB 5AMFA 3HMEA 3Q2FA 4O7EA 4LDFA 4XY9A 5F61A 4CL9A 4FLPA 5LKUA 2YQDA 4O76A 4MEPA 4DONA 5DYXA 5E0RA 4BW2A 4YAXA 3MUKA 5G4RA 5FFVA 3QZTA 3LQIA 4O72A 5E3DA 5CFWA 5HFRA 3AQAA 5FDZA 5DKCA 3IU6A 4O7BA 5D3TA 5CUDA 2I7KA 2YELA 2L5EA 4A9IA 5A85A 4J0RA 4CUQA 2RO1A 4HBWA 4QR3A 4HXMA 5HQ5A 5C89A 3UVYA 5FE2A 3HMFA 5F1LA 3O37A 3P1EA 4HXOA 4NXJA 5CU8A 4LRGA 3U5LA 4YYGA 5LJ2A 4TTEA 2RNYA 5TB6A 4N4IA 1N72A 5E9MA 5CRMA 5I86A 5A5OA 4ZW1A 4QB3A 2RS9B 3ONIA 5HJCA 1ZS5A 5HLSA 4TT4A 4UIZA 5F25A 3P5OA 4A9EA 5KU3A 5EWDA 5DYCA 3O35A 5CGPA 2R0VA 5A5SA 5KHMA 5CQ7A 5FFYA 5II1A 4TU6A 5KTWA 5D3JA 2L84A 2E3KA 4UYEA 5A82A 3TLPA 2MJVB 5DFDA 2RNWA 5FE0A 4YATA 4NR4A 4MEQA 4O78A 4O71A 5E3GA 5DW1A 4TYLA 2DVQA 5E9YA 4O70A 5IGMA 4A9MA 4QR4A 5EM3A 5FE7A 5FE4A 4YYIA 5A83A 5A7CA 3JVLA 5ENCA 5EWHA 5H1VA 5A5QA 5KO4A 3O33A 5ENHA 5FB0A 5DLXA 5EK9A 3O34A 4UYFB 5HELA 4Q0NA 4A9JA 5HCLA 4QSQA 4QYLA 5D3SA 5FH7A 4NRCA 4NS5A 5E7DA 3U5KA 4LR6A 4O7AA 4MR5A 4MENA 4BW1A 5EWCA 2WP2A 5LKZA 5D7XA 4NUCA 5CZGA 2I8NA 4UIUA 5HENA 4HBYA 5ETBA 5L96A 2DATA 5E73A 4YYHA 4PS5A 4QSWA 5A5RA 5ENFA 5EPSA 4QUUA 2R10A 2RFJA 4YK0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OGI A;  1EQF A;  5CY9 A;  4QY4 A;  3GG3 A;  5F3A A;  4NUD A;  5A81 A;  3P1F A;  5CP5 A;  5CUG A;  1E6I A;  3JVJ A;  5CTL A;  4PY6 A;  3NXB A;  2OO1 A;  4LYW A;  2G4A A;  5ENJ A;  4TU4 A;  4YYK A;  2RI7 A;  4N4H A;  4N3W A;  3SVF A;  4NR8 A;  4QBM A;  4Z6I A;  4PCI A;  4NYX A;  5EI4 A;  5HQ7 A;  4UYD A;  2E7N A;  1WUG A;  4Y03 A;  3S92 A;  4CUT A;  4QEU A;  5L99 A;  2D9E A;  4Z1Q A;  4PCE A;  3P1D A;  3QZV A;  5I29 A;  4TS8 A;  5DFB A;  4YYN A;  4HXP A;  5F62 A;  5E9I A;  5FBX A;  5DX4 A;  2LSP B;  4LYS A;  4HBV A;  5DKD A;  4CFL A;  2OSS A;  3UW9 A;  5F2P A;  2E7O A;  3FKM X;  5E9L A;  3S91 A;  4Z1S A;  4PKL A;  5D3N A;  5FH6 A;  4YBT A;  2GRC A;  3MB4 A;  4O7F A;  5CQT A;  4QEV A;  5I89 A;  3U5O A;  2DVS A;  4TZ2 A;  4CFK A;  3UVW A;  5II2 A;  5C7N A;  2OUO A;  3DAI A;  4IR5 A;  5BT4 A;  5CUE A;  4NUE A;  5FH8 A;  5LKX A;  4CUP A;  4YY4 A;  4YYD A;  5AD3 A;  5HEM A;  5FE9 A;  5FG5 A;  3UVX A;  5LVR A;  5DYU A;  5D3L A;  5LKT A;  4YC9 A;  5DLZ A;  5FB1 A;  3U5M A;  4UYG A;  4CLB A;  3G0J A;  4QC3 A;  5I83 A;  4KV1 A;  4BJX A;  5L98 A;  4Q0O A;  2R0Y A;  4HXN A;  4XUA A;  4C66 A;  3JVM A;  4QYD A;  5LVQ A;  4LZR A;  5DW2 A;  5K29 A;  3D7C A;  5DFC A;  4LC2 A;  4IR6 A;  5CRZ A;  4UIW A;  1WUM A;  4J1P A;  5E9V A;  3I3J A;  3LQJ A;  5ENG A;  4ZC9 A;  5HM0 A;  4CUU A;  3K2J A;  4WHU A;  5C87 A;  4CUR A;  5D25 A;  5D3P A;  5BT3 A;  4IR4 A;  5EPR A;  4UIY A;  5DBM A;  5I88 A;  5CQ6 A;  4LYI A;  5L8U A;  4GPJ A;  4UYH A;  5EVA A;  5CQ4 A;  4QSR A;  2NXB A;  4QSX A;  4F3I A;  5EIS A;  4YY6 A;  5D24 A;  4YH3 A;  5ENB A;  3AAD A;  2YDW A;  5FE1 A;  4QEW A;  5DY7 A;  5F63 A;  4BHW A;  5JWM A;  4A9L A;  2F6J A;  4IOO A;  5COI A;  5FE6 A;  5AME A;  4YBM A;  5CQ5 A;  3SVG A;  5DKH A;  5CQ3 A;  4C67 A;  5FE5 A;  4A9K A;  2R0S A;  4QZS A;  4KV4 A;  4QSV A;  4MR4 A;  2KTB B;  4MR3 A;  2YEM A;  4UIX A;  5D3H A;  4N4F A;  5FFW A;  5FE8 A;  5CS8 A;  4A9F A;  4HXL A;  5HRV A;  3O36 A;  5IID A;  5EP7 A;  5I80 A;  4NQN A;  4ALH A;  2RNX A;  3MUL A;  4LZS A;  4IR3 A;  5ENE A;  4NQM A;  4LZ2 A;  5EQ1 A;  5C4Q A;  5EGU A;  4J0S A;  4NRA A;  4O75 A;  4QUT A;  5LJ1 A;  5I7X A;  3U5P A;  5D26 A;  4NRB A;  3LXJ A;  4UIT A;  5EPB A;  1X0J A;  5JI8 A;  4NR9 A;  4XY8 A;  4QR5 A;  5CPE A;  5KTU A;  5BT5 A;  4OGJ A;  5I1Q A;  4YH4 A;  4A9O A;  3IU5 A;  4RVR A;  4XUB A;  2DVV A;  4Z93 A;  5F1H A;  4BW4 A;  4YBS A;  5C85 A;  3DWY A;  5H1T A;  5F36 A;  3UVD A;  3U5N A;  4OUF A;  5TCM A;  4ZQL A;  5ACY A;  5D0C A;  4NR7 A;  5FE3 A;  3RCW A;  5F60 A;  5C8G A;  2YEK A;  5FG4 A;  3U5J A;  5IBN A;  5ENI A;  5A5P A;  4YAB A;  4ALG A;  5E9K A;  5HRW A;  4TT2 A;  4UIV A;  5EA1 A;  4WHW A;  2DKW A;  5HQ6 A;  4TQN A;  5CUC A;  4HBX A;  4UYF A;  3UV5 A;  4NYW A;  4IOR A;  2WP1 A;  5A5N A;  3MXF A;  5E74 A;  5L8T A;  1F68 A;  5F5Z A;  4O77 A;  4TZ8 A;  2D82 A;  5FG6 A;  4IOQ A;  4O74 A;  4E96 A;  2DWW A;  3JVK A;  1JM4 B;  2DVR A;  4QSP A;  5CUA A;  2YYN A;  3HMH A;  2YW5 A;  2L85 A;  3UV2 A;  4YYM A;  5H1U A;  5EWW A;  3QZS A;  4MEO A;  3UV4 A;  4AKN A;  4TT6 A;  5J0D A;  5CUB A;  3P1C A;  5IGK A;  5D3R A;  5HFQ A;  4J3I A;  5AD2 A;  4A9H A;  3ZYU A;  4HXK A;  4YAD A;  4A9N A;  4NYV A;  4CUS A;  4QSS A;  4BW3 A;  4PTB A;  4NR6 A;  5IG6 A;  4XYA A;  2H60 A;  4QSU A;  5I40 A;  5LUU A;  5LJ0 A;  5HRX A;  4QC1 A;  5EIC A;  5L97 A;  3LQH A;  4MR6 A;  4N4G A;  3MQM A;  4QNS A;  5IGL A;  5EWV A;  4O7C A;  4X2I A;  5KTX A;  5EU1 A;  2N9G A;  2F6N A;  3SVH A;  3MB3 A;  4QST A;  3G0L A;  4KCX A;  3LJW A;  4HXR A;  4HXS A;  3Q2E A;  5DYA A;  4NR5 A;  4YYJ A;  5G4S A;  5CQ8 A;  5CQA A;  5EV9 A;  2FSA A;  5H85 A;  5I7Y A;  4WIV A;  4Z6H A;  5ETD A;  5IGN A;  1JSP B;  5AMF A;  3HME A;  3Q2F A;  4O7E A;  4LDF A;  4XY9 A;  5F61 A;  4CL9 A;  4FLP A;  5LKU A;  2YQD A;  4O76 A;  4MEP A;  4DON A;  5DYX A;  5E0R A;  4BW2 A;  4YAX A;  3MUK A;  5G4R A;  5FFV A;  3QZT A;  3LQI A;  4O72 A;  5E3D A;  5CFW A;  5HFR A;  3AQA A;  5FDZ A;  5DKC A;  3IU6 A;  4O7B A;  5D3T A;  5CUD A;  2I7K A;  2YEL A;  2L5E A;  4A9I A;  5A85 A;  4J0R A;  4CUQ A;  2RO1 A;  4HBW A;  4QR3 A;  4HXM A;  5HQ5 A;  5C89 A;  3UVY A;  5FE2 A;  3HMF A;  5F1L A;  3O37 A;  3P1E A;  4HXO A;  4NXJ A;  5CU8 A;  4LRG A;  3U5L A;  4YYG A;  5LJ2 A;  4TTE A;  2RNY A;  5TB6 A;  4N4I A;  1N72 A;  5E9M A;  5CRM A;  5I86 A;  5A5O A;  4ZW1 A;  4QB3 A;  2RS9 B;  3ONI A;  5HJC A;  1ZS5 A;  5HLS A;  4TT4 A;  4UIZ A;  5F25 A;  3P5O A;  4A9E A;  5KU3 A;  5EWD A;  5DYC A;  3O35 A;  5CGP A;  2R0V A;  5A5S A;  5KHM A;  5CQ7 A;  5FFY A;  5II1 A;  4TU6 A;  5KTW A;  5D3J A;  2L84 A;  2E3K A;  4UYE A;  5A82 A;  3TLP A;  2MJV B;  5DFD A;  2RNW A;  5FE0 A;  4YAT A;  4NR4 A;  4MEQ A;  4O78 A;  4O71 A;  5E3G A;  5DW1 A;  4TYL A;  2DVQ A;  5E9Y A;  4O70 A;  5IGM A;  4A9M A;  4QR4 A;  5EM3 A;  5FE7 A;  5FE4 A;  4YYI A;  5A83 A;  5A7C A;  3JVL A;  5ENC A;  5EWH A;  5H1V A;  5A5Q A;  5KO4 A;  3O33 A;  5ENH A;  5FB0 A;  5DLX A;  5EK9 A;  3O34 A;  4UYF B;  5HEL A;  4Q0N A;  4A9J A;  5HCL A;  4QSQ A;  4QYL A;  5D3S A;  5FH7 A;  4NRC A;  4NS5 A;  5E7D A;  3U5K A;  4LR6 A;  4O7A A;  4MR5 A;  4MEN A;  4BW1 A;  5EWC A;  2WP2 A;  5LKZ A;  5D7X A;  4NUC A;  5CZG A;  2I8N A;  4UIU A;  5HEN A;  4HBY A;  5ETB A;  5L96 A;  2DAT A;  5E73 A;  4YYH A;  4PS5 A;  4QSW A;  5A5R A;  5ENF A;  5EPS A;  4QUU A;  2R10 A;  2RFJ A;  4YK0 A; 
#chains in the Genus database with same CATH topology
 4OGI A;  1EQF A;  5CY9 A;  4QY4 A;  3GG3 A;  5F3A A;  4NUD A;  5A81 A;  3P1F A;  5CP5 A;  5CUG A;  1E6I A;  3JVJ A;  5CTL A;  4PY6 A;  3NXB A;  2OO1 A;  4LYW A;  2G4A A;  5ENJ A;  4TU4 A;  4YYK A;  2RI7 A;  4N4H A;  4N3W A;  3SVF A;  4NR8 A;  4QBM A;  4Z6I A;  4PCI A;  4NYX A;  5EI4 A;  5HQ7 A;  4UYD A;  1WUG A;  2E7N A;  4Y03 A;  3S92 A;  4CUT A;  4QEU A;  5L99 A;  2D9E A;  4Z1Q A;  4PCE A;  3P1D A;  3QZV A;  5I29 A;  4TS8 A;  5DFB A;  4YYN A;  4HXP A;  5F62 A;  5E9I A;  5FBX A;  5DX4 A;  2LSP B;  4LYS A;  4HBV A;  5DKD A;  4CFL A;  2OSS A;  3UW9 A;  5F2P A;  2E7O A;  3FKM X;  5E9L A;  3S91 A;  4Z1S A;  4PKL A;  5D3N A;  5FH6 A;  4YBT A;  2GRC A;  3MB4 A;  4O7F A;  5CQT A;  4QEV A;  5I89 A;  3U5O A;  2DVS A;  4TZ2 A;  4CFK A;  3UVW A;  5II2 A;  5C7N A;  2OUO A;  3DAI A;  4IR5 A;  5BT4 A;  5CUE A;  4NUE A;  5FH8 A;  5LKX A;  4CUP A;  4YY4 A;  4YYD A;  5AD3 A;  5HEM A;  5FE9 A;  5FG5 A;  3UVX A;  5LVR A;  5DYU A;  5D3L A;  5LKT A;  4YC9 A;  5DLZ A;  5FB1 A;  3U5M A;  4UYG A;  4CLB A;  3G0J A;  4QC3 A;  5I83 A;  4KV1 A;  4BJX A;  5L98 A;  4AKG A;  4Q0O A;  2R0Y A;  4HXN A;  4XUA A;  4C66 A;  3JVM A;  4QYD A;  5LVQ A;  4LZR A;  5DW2 A;  5K29 A;  3D7C A;  5DFC A;  4LC2 A;  4IR6 A;  5CRZ A;  4UIW A;  1WUM A;  4J1P A;  5E9V A;  3I3J A;  3LQJ A;  5ENG A;  4ZC9 A;  5HM0 A;  4CUU A;  3K2J A;  4WHU A;  5C87 A;  4CUR A;  5D25 A;  5D3P A;  5BT3 A;  4IR4 A;  5EPR A;  4UIY A;  5DBM A;  5I88 A;  5CQ6 A;  4LYI A;  5L8U A;  4GPJ A;  4UYH A;  5EVA A;  5CQ4 A;  4QSR A;  2NXB A;  4QSX A;  4F3I A;  5EIS A;  4YY6 A;  5D24 A;  4YH3 A;  5ENB A;  3AAD A;  2YDW A;  5FE1 A;  4QEW A;  5DY7 A;  5F63 A;  4BHW A;  5JWM A;  4A9L A;  2F6J A;  4IOO A;  5COI A;  5FE6 A;  5AME A;  4YBM A;  5CQ5 A;  3SVG A;  5DKH A;  5CQ3 A;  4C67 A;  5FE5 A;  4A9K A;  2R0S A;  4QZS A;  4KV4 A;  4QSV A;  4MR4 A;  2KTB B;  4MR3 A;  2YEM A;  4UIX A;  5D3H A;  4N4F A;  5FFW A;  5FE8 A;  5CS8 A;  4A9F A;  4HXL A;  5HRV A;  3O36 A;  5IID A;  5EP7 A;  5I80 A;  4NQN A;  4ALH A;  2RNX A;  3MUL A;  4LZS A;  4IR3 A;  5ENE A;  4NQM A;  4LZ2 A;  5EQ1 A;  5C4Q A;  5EGU A;  4J0S A;  4NRA A;  4O75 A;  4QUT A;  5LJ1 A;  5I7X A;  3U5P A;  5D26 A;  4NRB A;  3LXJ A;  4UIT A;  5EPB A;  1X0J A;  5JI8 A;  4NR9 A;  4XY8 A;  4QR5 A;  5CPE A;  5KTU A;  5BT5 A;  4OGJ A;  5I1Q A;  4YH4 A;  4A9O A;  3IU5 A;  4RVR A;  4XUB A;  2DVV A;  4Z93 A;  5F1H A;  4BW4 A;  4YBS A;  5C85 A;  3DWY A;  5H1T A;  5F36 A;  3UVD A;  3U5N A;  4OUF A;  5TCM A;  4ZQL A;  5ACY A;  5D0C A;  4NR7 A;  5FE3 A;  3RCW A;  5F60 A;  5C8G A;  2YEK A;  5FG4 A;  3U5J A;  5IBN A;  3VKG A;  5ENI A;  5A5P A;  4YAB A;  4ALG A;  5E9K A;  5HRW A;  4TT2 A;  4UIV A;  5EA1 A;  4WHW A;  2DKW A;  5HQ6 A;  4TQN A;  5CUC A;  4HBX A;  4UYF A;  3UV5 A;  4NYW A;  4IOR A;  2WP1 A;  5A5N A;  3MXF A;  3VKH A;  4AKH A;  5E74 A;  5L8T A;  1F68 A;  5F5Z A;  4O77 A;  4TZ8 A;  2D82 A;  5FG6 A;  4IOQ A;  4O74 A;  4E96 A;  2DWW A;  3JVK A;  1JM4 B;  2DVR A;  4QSP A;  5CUA A;  2YYN A;  3HMH A;  2YW5 A;  2L85 A;  3UV2 A;  4YYM A;  5H1U A;  5EWW A;  3QZS A;  4MEO A;  3UV4 A;  4AKN A;  4TT6 A;  5J0D A;  5CUB A;  3P1C A;  5IGK A;  5D3R A;  5HFQ A;  4J3I A;  5AD2 A;  4A9H A;  3ZYU A;  4HXK A;  4YAD A;  4A9N A;  4NYV A;  4CUS A;  4QSS A;  4BW3 A;  4PTB A;  4NR6 A;  5IG6 A;  4XYA A;  2H60 A;  4QSU A;  5I40 A;  5LUU A;  5LJ0 A;  5HRX A;  4QC1 A;  5EIC A;  5L97 A;  3LQH A;  4MR6 A;  4N4G A;  3MQM A;  4QNS A;  5IGL A;  5EWV A;  4O7C A;  4X2I A;  5KTX A;  4AKI A;  5EU1 A;  2N9G A;  2F6N A;  3SVH A;  3MB3 A;  4QST A;  3G0L A;  4KCX A;  3LJW A;  4HXR A;  4HXS A;  3Q2E A;  5DYA A;  4NR5 A;  4YYJ A;  5G4S A;  5CQ8 A;  5CQA A;  5EV9 A;  2FSA A;  5H85 A;  5I7Y A;  4WIV A;  4Z6H A;  5ETD A;  5IGN A;  1JSP B;  5AMF A;  3HME A;  3Q2F A;  4O7E A;  4LDF A;  4XY9 A;  5F61 A;  4CL9 A;  4FLP A;  5LKU A;  2YQD A;  1ZKR A;  4O76 A;  4MEP A;  4DON A;  5DYX A;  5E0R A;  4BW2 A;  4YAX A;  3MUK A;  5G4R A;  5FFV A;  3QZT A;  3LQI A;  4O72 A;  5E3D A;  5CFW A;  5HFR A;  3AQA A;  5FDZ A;  5DKC A;  3IU6 A;  4O7B A;  5D3T A;  5CUD A;  2I7K A;  2YEL A;  2L5E A;  4A9I A;  5A85 A;  4J0R A;  4CUQ A;  2RO1 A;  4HBW A;  4QR3 A;  4HXM A;  5HQ5 A;  5C89 A;  3UVY A;  5FE2 A;  3D1B A;  3HMF A;  5F1L A;  3O37 A;  3P1E A;  4HXO A;  4NXJ A;  5CU8 A;  4LRG A;  3U5L A;  4YYG A;  5LJ2 A;  4TTE A;  2RNY A;  5TB6 A;  1PUO A;  4N4I A;  1N72 A;  5E9M A;  5CRM A;  5I86 A;  5A5O A;  4ZW1 A;  4QB3 A;  2RS9 B;  3ONI A;  5HJC A;  1ZS5 A;  5HLS A;  4TT4 A;  4UIZ A;  5F25 A;  3P5O A;  4A9E A;  5KU3 A;  5EWD A;  5DYC A;  3O35 A;  5CGP A;  2R0V A;  5A5S A;  5KHM A;  5CQ7 A;  5FFY A;  5II1 A;  4TU6 A;  2EJN A;  5KTW A;  5D3J A;  2L84 A;  2E3K A;  4UYE A;  5A82 A;  3TLP A;  2MJV B;  5DFD A;  2RNW A;  5FE0 A;  4YAT A;  4NR4 A;  4MEQ A;  4O78 A;  4O71 A;  5E3G A;  5DW1 A;  4TYL A;  2DVQ A;  5E9Y A;  4O70 A;  3D1D A;  5IGM A;  4A9M A;  4QR4 A;  5EM3 A;  5FE7 A;  5FE4 A;  4YYI A;  5A83 A;  5A7C A;  3JVL A;  5ENC A;  5EWH A;  5H1V A;  3ERR A;  5A5Q A;  5KO4 A;  3O33 A;  5ENH A;  5FB0 A;  5DLX A;  5EK9 A;  3O34 A;  4UYF B;  5HEL A;  4Q0N A;  4A9J A;  5HCL A;  4QSQ A;  4QYL A;  5D3S A;  5FH7 A;  4NRC A;  4NS5 A;  5E7D A;  3U5K A;  4LR6 A;  4O7A A;  4MR5 A;  4MEN A;  4BW1 A;  4AI6 A;  5EWC A;  2WP2 A;  5LKZ A;  5D7X A;  4NUC A;  5CZG A;  2I8N A;  4UIU A;  5HEN A;  4HBY A;  5ETB A;  5L96 A;  2DAT A;  5E73 A;  4YYH A;  4PS5 A;  4QSW A;  5A5R A;  5ENF A;  5EPS A;  4QUU A;  2R10 A;  2RFJ A;  4YK0 A; 
#chains in the Genus database with same CATH homology
 4OGI A;  1EQF A;  5CY9 A;  4QY4 A;  3GG3 A;  5F3A A;  4NUD A;  5A81 A;  3P1F A;  5CP5 A;  5CUG A;  1E6I A;  3JVJ A;  5CTL A;  4PY6 A;  3NXB A;  2OO1 A;  4LYW A;  2G4A A;  5ENJ A;  4TU4 A;  4YYK A;  2RI7 A;  4N4H A;  4N3W A;  3SVF A;  4NR8 A;  4QBM A;  4Z6I A;  4PCI A;  4NYX A;  5EI4 A;  5HQ7 A;  4UYD A;  2E7N A;  1WUG A;  4Y03 A;  3S92 A;  4CUT A;  4QEU A;  5L99 A;  2D9E A;  4Z1Q A;  4PCE A;  3P1D A;  3QZV A;  5I29 A;  4TS8 A;  5DFB A;  4YYN A;  4HXP A;  5F62 A;  5E9I A;  5FBX A;  5DX4 A;  2LSP B;  4LYS A;  4HBV A;  5DKD A;  4CFL A;  2OSS A;  3UW9 A;  5F2P A;  2E7O A;  3FKM X;  5E9L A;  3S91 A;  4Z1S A;  4PKL A;  5D3N A;  5FH6 A;  4YBT A;  2GRC A;  3MB4 A;  4O7F A;  5CQT A;  4QEV A;  5I89 A;  3U5O A;  2DVS A;  4TZ2 A;  4CFK A;  3UVW A;  5II2 A;  5C7N A;  2OUO A;  3DAI A;  4IR5 A;  5BT4 A;  5CUE A;  4NUE A;  5FH8 A;  5LKX A;  4CUP A;  4YY4 A;  4YYD A;  5AD3 A;  5HEM A;  5FE9 A;  5FG5 A;  3UVX A;  5LVR A;  5DYU A;  5D3L A;  5LKT A;  4YC9 A;  5DLZ A;  5FB1 A;  3U5M A;  4UYG A;  4CLB A;  3G0J A;  4QC3 A;  5I83 A;  4KV1 A;  4BJX A;  5L98 A;  4Q0O A;  2R0Y A;  4HXN A;  4XUA A;  4C66 A;  3JVM A;  4QYD A;  5LVQ A;  4LZR A;  5DW2 A;  5K29 A;  3D7C A;  5DFC A;  4LC2 A;  4IR6 A;  5CRZ A;  4UIW A;  1WUM A;  4J1P A;  5E9V A;  3I3J A;  3LQJ A;  5ENG A;  4ZC9 A;  5HM0 A;  4CUU A;  3K2J A;  4WHU A;  5C87 A;  4CUR A;  5D25 A;  5D3P A;  5BT3 A;  4IR4 A;  5EPR A;  4UIY A;  5DBM A;  5I88 A;  5CQ6 A;  4LYI A;  5L8U A;  4GPJ A;  4UYH A;  5EVA A;  5CQ4 A;  4QSR A;  2NXB A;  4QSX A;  4F3I A;  5EIS A;  4YY6 A;  5D24 A;  4YH3 A;  5ENB A;  3AAD A;  2YDW A;  5FE1 A;  4QEW A;  5DY7 A;  5F63 A;  4BHW A;  5JWM A;  4A9L A;  2F6J A;  4IOO A;  5COI A;  5FE6 A;  5AME A;  4YBM A;  5CQ5 A;  3SVG A;  5DKH A;  5CQ3 A;  4C67 A;  5FE5 A;  4A9K A;  2R0S A;  4QZS A;  4KV4 A;  4QSV A;  4MR4 A;  2KTB B;  4MR3 A;  2YEM A;  4UIX A;  5D3H A;  4N4F A;  5FFW A;  5FE8 A;  5CS8 A;  4A9F A;  4HXL A;  5HRV A;  3O36 A;  5IID A;  5EP7 A;  5I80 A;  4NQN A;  4ALH A;  2RNX A;  3MUL A;  4LZS A;  4IR3 A;  5ENE A;  4NQM A;  4LZ2 A;  5EQ1 A;  5C4Q A;  5EGU A;  4J0S A;  4NRA A;  4O75 A;  4QUT A;  5LJ1 A;  5I7X A;  3U5P A;  5D26 A;  4NRB A;  3LXJ A;  4UIT A;  5EPB A;  1X0J A;  5JI8 A;  4NR9 A;  4XY8 A;  4QR5 A;  5CPE A;  5KTU A;  5BT5 A;  4OGJ A;  5I1Q A;  4YH4 A;  4A9O A;  3IU5 A;  4RVR A;  4XUB A;  2DVV A;  4Z93 A;  5F1H A;  4BW4 A;  4YBS A;  5C85 A;  3DWY A;  5H1T A;  5F36 A;  3UVD A;  3U5N A;  4OUF A;  5TCM A;  4ZQL A;  5ACY A;  5D0C A;  4NR7 A;  5FE3 A;  3RCW A;  5F60 A;  5C8G A;  2YEK A;  5FG4 A;  3U5J A;  5IBN A;  5ENI A;  5A5P A;  4YAB A;  4ALG A;  5E9K A;  5HRW A;  4TT2 A;  4UIV A;  5EA1 A;  4WHW A;  2DKW A;  5HQ6 A;  4TQN A;  5CUC A;  4HBX A;  4UYF A;  3UV5 A;  4NYW A;  4IOR A;  2WP1 A;  5A5N A;  3MXF A;  5E74 A;  5L8T A;  1F68 A;  5F5Z A;  4O77 A;  4TZ8 A;  2D82 A;  5FG6 A;  4IOQ A;  4O74 A;  4E96 A;  2DWW A;  3JVK A;  1JM4 B;  2DVR A;  4QSP A;  5CUA A;  2YYN A;  3HMH A;  2YW5 A;  2L85 A;  3UV2 A;  4YYM A;  5H1U A;  5EWW A;  3QZS A;  4MEO A;  3UV4 A;  4AKN A;  4TT6 A;  5J0D A;  5CUB A;  3P1C A;  5IGK A;  5D3R A;  5HFQ A;  4J3I A;  5AD2 A;  4A9H A;  3ZYU A;  4HXK A;  4YAD A;  4A9N A;  4NYV A;  4CUS A;  4QSS A;  4BW3 A;  4PTB A;  4NR6 A;  5IG6 A;  4XYA A;  2H60 A;  4QSU A;  5I40 A;  5LUU A;  5LJ0 A;  5HRX A;  4QC1 A;  5EIC A;  5L97 A;  3LQH A;  4MR6 A;  4N4G A;  3MQM A;  4QNS A;  5IGL A;  5EWV A;  4O7C A;  4X2I A;  5KTX A;  5EU1 A;  2N9G A;  2F6N A;  3SVH A;  3MB3 A;  4QST A;  3G0L A;  4KCX A;  3LJW A;  4HXR A;  4HXS A;  3Q2E A;  5DYA A;  4NR5 A;  4YYJ A;  5G4S A;  5CQ8 A;  5CQA A;  5EV9 A;  2FSA A;  5H85 A;  5I7Y A;  4WIV A;  4Z6H A;  5ETD A;  5IGN A;  1JSP B;  5AMF A;  3HME A;  3Q2F A;  4O7E A;  4LDF A;  4XY9 A;  5F61 A;  4CL9 A;  4FLP A;  5LKU A;  2YQD A;  4O76 A;  4MEP A;  4DON A;  5DYX A;  5E0R A;  4BW2 A;  4YAX A;  3MUK A;  5G4R A;  5FFV A;  3QZT A;  3LQI A;  4O72 A;  5E3D A;  5CFW A;  5HFR A;  3AQA A;  5FDZ A;  5DKC A;  3IU6 A;  4O7B A;  5D3T A;  5CUD A;  2I7K A;  2YEL A;  2L5E A;  4A9I A;  5A85 A;  4J0R A;  4CUQ A;  2RO1 A;  4HBW A;  4QR3 A;  4HXM A;  5HQ5 A;  5C89 A;  3UVY A;  5FE2 A;  3HMF A;  5F1L A;  3O37 A;  3P1E A;  4HXO A;  4NXJ A;  5CU8 A;  4LRG A;  3U5L A;  4YYG A;  5LJ2 A;  4TTE A;  2RNY A;  5TB6 A;  4N4I A;  1N72 A;  5E9M A;  5CRM A;  5I86 A;  5A5O A;  4ZW1 A;  4QB3 A;  2RS9 B;  3ONI A;  5HJC A;  1ZS5 A;  5HLS A;  4TT4 A;  4UIZ A;  5F25 A;  3P5O A;  4A9E A;  5KU3 A;  5EWD A;  5DYC A;  3O35 A;  5CGP A;  2R0V A;  5A5S A;  5KHM A;  5CQ7 A;  5FFY A;  5II1 A;  4TU6 A;  5KTW A;  5D3J A;  2L84 A;  2E3K A;  4UYE A;  5A82 A;  3TLP A;  2MJV B;  5DFD A;  2RNW A;  5FE0 A;  4YAT A;  4NR4 A;  4MEQ A;  4O78 A;  4O71 A;  5E3G A;  5DW1 A;  4TYL A;  2DVQ A;  5E9Y A;  4O70 A;  5IGM A;  4A9M A;  4QR4 A;  5EM3 A;  5FE7 A;  5FE4 A;  4YYI A;  5A83 A;  5A7C A;  3JVL A;  5ENC A;  5EWH A;  5H1V A;  5A5Q A;  5KO4 A;  3O33 A;  5ENH A;  5FB0 A;  5DLX A;  5EK9 A;  3O34 A;  4UYF B;  5HEL A;  4Q0N A;  4A9J A;  5HCL A;  4QSQ A;  4QYL A;  5D3S A;  5FH7 A;  4NRC A;  4NS5 A;  5E7D A;  3U5K A;  4LR6 A;  4O7A A;  4MR5 A;  4MEN A;  4BW1 A;  5EWC A;  2WP2 A;  5LKZ A;  5D7X A;  4NUC A;  5CZG A;  2I8N A;  4UIU A;  5HEN A;  4HBY A;  5ETB A;  5L96 A;  2DAT A;  5E73 A;  4YYH A;  4PS5 A;  4QSW A;  5A5R A;  5ENF A;  5EPS A;  4QUU A;  2R10 A;  2RFJ A;  4YK0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...