3DAIA

Crystal structure of the bromodomain of the human atad2
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
130
structure length
130
Chain Sequence
SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICSNALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ATPase family AAA domain-containing protein 2
publication title Histone recognition and large-scale structural analysis of the human bromodomain family.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 52
structure length 130
sequence length 130
ec nomenclature ec 3.6.1.3: Adenosinetriphosphatase.
pdb deposition date 2008-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3daiA00
5CQ4A 2YELA 2R0VA 5CQ6A 4HBYA 4CUTA 5I1QA 3MULA 3P1CA 3UVDA 4YYDA 2L85A 4YYJA 4IR5A 5CTLA 5F2PA 3HMFA 3S92A 4Z93A 4HXMA 5CP5A 4A9HA 2RNWA 4UITA 1E6IA 4LR6A 4MR5A 5HQ7A 2OSSA 4IR6A 5CY9A 4YBMA 5J0DA 4NQNA 3U5NA 3U5JA 5I89A 4LYWA 1WUGA 4LC2A 4KV1A 4NR8A 2L5EA 4CFKA 5E9MA 4A9FA 3UV4A 4O75A 5FE9A 3QZVA 2R0YA 4CUPA 3P1DA 4NXJA 2MJVB 2YYNA 5FH8A 5IGLA 5L99A 5H85A 5L8UA 3G0JA 3UVWA 2G4AA 3Q2FA 5D3HA 5LJ2A 5I83A 4YK0A 2DVRA 5LKUA 3MXFA 2DVSA 4HXKA 4LYSA 5D26A 4ZC9A 4E96A 4XYAA 5LKZA 3TLPA 2RFJA 5D3NA 5EA1A 5CQTA 5EP7A 4QNSA 4QR5A 4YYIA 4O7EA 3GG3A 4NRCA 4Y03A 4O71A 4UYDA 5A7CA 5D3PA 4Z1SA 5CUAA 3JVLA 4GPJA 5LJ1A 5ENBA 5FE3A 5L96A 5COIA 5LKTA 4BW1A 2RNYA 4A9EA 4RVRA 2L84A 4YATA 4QSTA 4HBXA 4O7CA 5E9IA 5IGKA 1WUMA 4IOQA 4QYLA 5F60A 1EQFA 5IG6A 5DBMA 3IU5A 1F68A 5CFWA 4Q0NA 5LVRA 5KHMA 4QZSA 5C85A 5A81A 5CUCA 5C89A 2WP1A 4NYXA 5II2A 4NQMA 4O7BA 4TTEA 4O78A 5E74A 5FB0A 4BW3A 5I80A 3LQHA 4QSVA 5F61A 2E7OA 3O35A 4LZ2A 5LKXA 4OGJA 5F25A 5A5SA 4YH3A 3O34A 5KTXA 4HXPA 5FFVA 4XUBA 4UYEA 2WP2A 5DW1A 3D7CA 4QSUA 4O70A 5EWWA 5JWMA 5G4RA 5A5NA 5I7YA 3UVXA 5CU8A 4PKLA 5EM3A 5AD2A 5ENFA 5AMFA 4C66A 3LXJA 4YY6A 4UYFB 2KTBB 5KTWA 5E73A 4NYVA 5IGNA 5HFRA 4UIYA 4UYFA 5HFQA 3RCWA 5FG5A 5LVQA 5HM0A 5FBXA 4YBSA 4IORA 4QUTA 4TS8A 5F1HA 4IOOA 5D25A 4Q0OA 4NRAA 5F5ZA 5ACYA 5EWCA 4QEUA 4YAXA 3I3JA 3HMEA 4PY6A 5C8GA 4O74A 5FDZA 5E9YA 2R0SA 4KCXA 4UIZA 4NR5A 5CUEA 5F1LA 5FE4A 5HRVA 5F63A 5G4SA 5DKDA 5FE7A 5CUGA 2OO1A 4J0SA 4A9NA 1N72A 4BW4A 5K29A 3O33A 3ZYUA 4TT4A 3HMHA 5L97A 4IR3A 3FKMX 2FSAA 5H1UA 4CUSA 5D3TA 3MQMA 5D3JA 4UIXA 3AADA 5H1VA 2DKWA 5E3GA 4CURA 5AMEA 5D0CA 5FG6A 5DY7A 3P1FA 5DFBA 4TYLA 5L8TA 5E3DA 5ETBA 5HEMA 5C7NA 4UYHA 3ONIA 3O37A 4HBWA 4MEOA 5E9VA 5E7DA 4TT2A 4UIVA 4C67A 4CUUA 4A9IA 5KO4A 4N4IA 4UIWA 4TU4A 4QYDA 4NR4A 5E0RA 4PTBA 5FH6A 4UIUA 4NYWA 4PCEA 3O36A 5TCMA 4OGIA 4MENA 4ALHA 4QUUA 5ENJA 4N3WA 2DWWA 4YBTA 4QC3A 4YYMA 4O72A 3QZSA 5CUDA 5D3RA 5IIDA 4BW2A 4BJXA 2F6NA 5FE5A 5FG4A 5DFDA 4QSRA 4YADA 4QSPA 5EI4A 5DKCA 3UVYA 3G0LA 5HQ6A 5JI8A 4A9MA 4HXRA 5I7XA 5A5OA 2YEMA 5HRXA 3UV2A 5L98A 4QSQA 2RI7A 4NS5A 4KV4A 4HBVA 3QZTA 5KU3A 4HXNA 2D9EA 4NRBA 5IBNA 4YYGA 4LRGA 3LJWA 3JVMA 5HLSA 5FE2A 5CZGA 5I29A 5EQ1A 5FE6A 4CL9A 5F62A 5EICA 5LJ0A 5D3LA 5A5QA 4NUDA 5C4QA 5D24A 5FFYA 4HXLA 4QSSA 4QSXA 5EISA 4PS5A 5BT5A 4YH4A 2D82A 2GRCA 5FE8A 5EPRA 5FFWA 3DWYA 5KTUA 5ENHA 3U5OA 1ZS5A 5CRZA 5DLXA 3SVFA 3IU6A 4A9KA 4ALGA 5EK9A 5AD3A 4XUAA 4J1PA 3UV5A 5DYCA 2DATA 4QBMA 4YC9A 4CLBA 5CPEA 5CQ5A 5D3SA 4QEVA 5D7XA 5DX4A 3DAIA 4ZQLA 3NXBA 5CUBA 3P5OA 4X2IA 4BHWA 5LUUA 4MR3A 4FLPA 2DVVA 5EGUA 1JM4B 4J3IA 5DYUA 5IGMA 2N9GA 4WHWA 5A82A 1JSPB 5DYAA 4LZSA 4Z1QA 2I7KA 5CQ3A 4J0RA 2H60A 4O77A 4TQNA 4YY4A 3LQJA 5I40A 3JVJA 5CQAA 5HELA 5DYXA 4O7FA 5EWDA 5FB1A 4QY4A 5ENEA 1X0JA 4UYGA 2RS9B 4O76A 5CS8A 2YDWA 5ENGA 3MB3A 4MEQA 4WIVA 3AQAA 5CGPA 3MB4A 5FE1A 5F36A 5EPBA 4O7AA 5I88A 4OUFA 3U5KA 4HXOA 2RO1A 5FH7A 2I8NA 2NXBA 5CRMA 4LZRA 5A83A 3S91A 4XY8A 5C87A 5DKHA 5HJCA 5E9KA 3SVGA 4TZ2A 2RNXA 4CFLA 5E9LA 5BT4A 5DW2A 5EVAA 5II1A 5F3AA 4ZW1A 3LQIA 4WHUA 4PCIA 3SVHA 3P1EA 5CQ7A 4QSWA 5HCLA 5TB6A 4YYKA 4HXSA 5EWHA 4NR9A 2LSPB 2YW5A 4A9JA 3Q2EA 2E7NA 5EV9A 5DFCA 4CUQA 4MEPA 5FE0A 5A5RA 4YABA 4N4GA 5BT3A 4LYIA 3K2JA 4NUCA 4TZ8A 4TU6A 5ETDA 5A5PA 4N4FA 3U5LA 4F3IA 4A9LA 2R10A 4NR7A 3UW9A 4YYNA 4QR4A 2YQDA 5DLZA 4QR3A 5EPSA 5CQ8A 5HENA 4MR4A 4AKNA 4DONA 4XY9A 4TT6A 4QC1A 5HQ5A 2E3KA 3JVKA 3U5PA 5ENIA 5EWVA 4LDFA 4NR6A 4Z6IA 4MR6A 5H1TA 4Z6HA 3MUKA 2DVQA 5I86A 4A9OA 2YEKA 4N4HA 5EU1A 2OUOA 2F6JA 4QEWA 4IR4A 4NUEA 5HRWA 4YYHA 5A85A 3U5MA 4QB3A 5ENCA
chains in the Genus database with same CATH superfamily
5CQ4A 2YELA 2R0VA 5CQ6A 4HBYA 4CUTA 1PUOA 5I1QA 3MULA 3P1CA 3UVDA 4YYDA 2L85A 4YYJA 4IR5A 5CTLA 5F2PA 3HMFA 3S92A 4Z93A 4HXMA 5CP5A 4A9HA 2RNWA 4UITA 1E6IA 4LR6A 4MR5A 5HQ7A 2OSSA 4IR6A 5CY9A 4YBMA 5J0DA 4NQNA 3U5NA 3U5JA 5I89A 4LYWA 1WUGA 4LC2A 4KV1A 4NR8A 2L5EA 4AKGA 4CFKA 5E9MA 4A9FA 3UV4A 4O75A 5FE9A 3QZVA 2R0YA 4CUPA 3P1DA 4NXJA 2MJVB 2YYNA 5FH8A 5IGLA 5L99A 5H85A 5L8UA 3G0JA 3UVWA 3D1BA 2G4AA 3Q2FA 5D3HA 5LJ2A 5I83A 4YK0A 2DVRA 5LKUA 3MXFA 2DVSA 3VKHA 4HXKA 4LYSA 5D26A 4ZC9A 4E96A 4XYAA 5LKZA 3TLPA 2RFJA 5D3NA 5EA1A 5CQTA 5EP7A 4QNSA 4QR5A 4YYIA 4O7EA 3GG3A 1ZKRA 4NRCA 4Y03A 4O71A 4UYDA 5A7CA 5D3PA 4Z1SA 5CUAA 3JVLA 4GPJA 5LJ1A 5ENBA 5FE3A 5L96A 3ERRA 5COIA 5LKTA 4BW1A 2RNYA 4A9EA 4RVRA 2L84A 4YATA 4QSTA 4HBXA 4O7CA 5E9IA 5IGKA 1WUMA 4IOQA 4QYLA 5F60A 1EQFA 5IG6A 5DBMA 3IU5A 1F68A 5CFWA 4Q0NA 5LVRA 5KHMA 4QZSA 5C85A 5A81A 5CUCA 5C89A 2WP1A 4NYXA 5II2A 4NQMA 4O7BA 4TTEA 4O78A 5E74A 5FB0A 4BW3A 5I80A 3LQHA 4QSVA 5F61A 2E7OA 3O35A 4LZ2A 5LKXA 4OGJA 5F25A 5A5SA 4YH3A 3O34A 5KTXA 4HXPA 5FFVA 4XUBA 4UYEA 2WP2A 5DW1A 3D7CA 4QSUA 4O70A 5EWWA 5JWMA 5G4RA 5A5NA 5I7YA 3UVXA 5CU8A 4PKLA 5EM3A 5AD2A 5ENFA 5AMFA 4C66A 3LXJA 4YY6A 4UYFB 2KTBB 5KTWA 5E73A 4NYVA 5IGNA 2EJNA 5HFRA 4UIYA 4UYFA 5HFQA 3RCWA 5FG5A 5LVQA 5HM0A 5FBXA 4YBSA 4IORA 4QUTA 4TS8A 5F1HA 4IOOA 5D25A 4Q0OA 4NRAA 5F5ZA 5ACYA 5EWCA 4QEUA 4YAXA 3I3JA 3HMEA 4PY6A 5C8GA 4O74A 5FDZA 5E9YA 2R0SA 4KCXA 4UIZA 4NR5A 5CUEA 5F1LA 5FE4A 5HRVA 5F63A 5G4SA 5DKDA 5FE7A 5CUGA 2OO1A 4J0SA 4A9NA 1N72A 4BW4A 5K29A 3O33A 3ZYUA 4AKIA 4TT4A 3HMHA 5L97A 4IR3A 3FKMX 2FSAA 5H1UA 4CUSA 5D3TA 3MQMA 5D3JA 4UIXA 3AADA 5H1VA 2DKWA 5E3GA 4CURA 5AMEA 5D0CA 5FG6A 5DY7A 3P1FA 5DFBA 4TYLA 5L8TA 5E3DA 5ETBA 5HEMA 5C7NA 4UYHA 3ONIA 3O37A 4HBWA 4MEOA 5E9VA 5E7DA 4TT2A 4UIVA 4C67A 4CUUA 4A9IA 5KO4A 4N4IA 4UIWA 4TU4A 4QYDA 4NR4A 5E0RA 4PTBA 5FH6A 4UIUA 4NYWA 4PCEA 3O36A 5TCMA 4OGIA 4MENA 4AI6A 4ALHA 4QUUA 5ENJA 4N3WA 2DWWA 4YBTA 4QC3A 4YYMA 4O72A 3QZSA 5CUDA 5D3RA 5IIDA 4BW2A 4BJXA 2F6NA 5FE5A 4AKHA 5FG4A 5DFDA 4QSRA 4YADA 4QSPA 5EI4A 5DKCA 3UVYA 3G0LA 5HQ6A 5JI8A 4A9MA 4HXRA 5I7XA 5A5OA 2YEMA 5HRXA 3UV2A 5L98A 4QSQA 2RI7A 4NS5A 4KV4A 3VKGA 4HBVA 3QZTA 5KU3A 4HXNA 2D9EA 4NRBA 5IBNA 4YYGA 4LRGA 3LJWA 3JVMA 5HLSA 5FE2A 5CZGA 5I29A 5EQ1A 5FE6A 4CL9A 5F62A 5EICA 5LJ0A 5D3LA 5A5QA 4NUDA 5C4QA 5D24A 5FFYA 4HXLA 4QSSA 4QSXA 5EISA 4PS5A 5BT5A 4YH4A 2D82A 2GRCA 5FE8A 5EPRA 5FFWA 3DWYA 5KTUA 5ENHA 3U5OA 1ZS5A 5CRZA 5DLXA 3SVFA 3IU6A 4A9KA 4ALGA 5EK9A 5AD3A 4XUAA 4J1PA 3UV5A 5DYCA 2DATA 4QBMA 4YC9A 4CLBA 5CPEA 5CQ5A 5D3SA 4QEVA 5D7XA 5DX4A 3DAIA 4ZQLA 3NXBA 5CUBA 3P5OA 4X2IA 4BHWA 5LUUA 4MR3A 4FLPA 2DVVA 5EGUA 1JM4B 4J3IA 5DYUA 5IGMA 2N9GA 4WHWA 5A82A 1JSPB 5DYAA 4LZSA 4Z1QA 2I7KA 5CQ3A 4J0RA 2H60A 4O77A 4TQNA 4YY4A 3LQJA 5I40A 3JVJA 5CQAA 5HELA 5DYXA 4O7FA 5EWDA 5FB1A 4QY4A 5ENEA 1X0JA 4UYGA 2RS9B 4O76A 5CS8A 2YDWA 5ENGA 3MB3A 4MEQA 4WIVA 3AQAA 5CGPA 3MB4A 5FE1A 5F36A 5EPBA 4O7AA 5I88A 4OUFA 3U5KA 4HXOA 2RO1A 5FH7A 2I8NA 2NXBA 5CRMA 4LZRA 5A83A 3S91A 4XY8A 5C87A 5DKHA 5HJCA 5E9KA 3SVGA 4TZ2A 2RNXA 4CFLA 5E9LA 5BT4A 5DW2A 5EVAA 5II1A 5F3AA 4ZW1A 3LQIA 4WHUA 4PCIA 3SVHA 3P1EA 5CQ7A 3D1DA 4QSWA 5HCLA 5TB6A 4YYKA 4HXSA 5EWHA 4NR9A 2LSPB 2YW5A 4A9JA 3Q2EA 2E7NA 5EV9A 5DFCA 4CUQA 4MEPA 5FE0A 5A5RA 4YABA 4N4GA 5BT3A 4LYIA 3K2JA 4NUCA 4TZ8A 4TU6A 5ETDA 5A5PA 4N4FA 3U5LA 4F3IA 4A9LA 2R10A 4NR7A 3UW9A 4YYNA 4QR4A 2YQDA 5DLZA 4QR3A 5EPSA 5CQ8A 5HENA 4MR4A 4AKNA 4DONA 4XY9A 4TT6A 4QC1A 5HQ5A 2E3KA 3JVKA 3U5PA 5ENIA 5EWVA 4LDFA 4NR6A 4Z6IA 4MR6A 5H1TA 4Z6HA 3MUKA 2DVQA 5I86A 4A9OA 2YEKA 4N4HA 5EU1A 2OUOA 2F6JA 4QEWA 4IR4A 4NUEA 5HRWA 4YYHA 5A85A 3U5MA 4QB3A 5ENCA
chains in the Genus database with same CATH topology
5CQ4A 2YELA 2R0VA 5CQ6A 4HBYA 4CUTA 5I1QA 3MULA 3P1CA 3UVDA 4YYDA 2L85A 4YYJA 4IR5A 5CTLA 5F2PA 3HMFA 3S92A 4Z93A 4HXMA 5CP5A 4A9HA 2RNWA 4UITA 1E6IA 4LR6A 4MR5A 5HQ7A 2OSSA 4IR6A 5CY9A 4YBMA 5J0DA 4NQNA 3U5NA 3U5JA 5I89A 4LYWA 1WUGA 4LC2A 4KV1A 4NR8A 2L5EA 4CFKA 5E9MA 4A9FA 3UV4A 4O75A 5FE9A 3QZVA 2R0YA 4CUPA 3P1DA 4NXJA 2MJVB 2YYNA 5FH8A 5IGLA 5L99A 5H85A 5L8UA 3G0JA 3UVWA 2G4AA 3Q2FA 5D3HA 5LJ2A 5I83A 4YK0A 2DVRA 5LKUA 3MXFA 2DVSA 4HXKA 4LYSA 5D26A 4ZC9A 4E96A 4XYAA 5LKZA 3TLPA 2RFJA 5D3NA 5EA1A 5CQTA 5EP7A 4QNSA 4QR5A 4YYIA 4O7EA 3GG3A 4NRCA 4Y03A 4O71A 4UYDA 5A7CA 5D3PA 4Z1SA 5CUAA 3JVLA 4GPJA 5LJ1A 5ENBA 5FE3A 5L96A 5COIA 5LKTA 4BW1A 2RNYA 4A9EA 4RVRA 2L84A 4YATA 4QSTA 4HBXA 4O7CA 5E9IA 5IGKA 1WUMA 4IOQA 4QYLA 5F60A 1EQFA 5IG6A 5DBMA 3IU5A 1F68A 5CFWA 4Q0NA 5LVRA 5KHMA 4QZSA 5C85A 5A81A 5CUCA 5C89A 2WP1A 4NYXA 5II2A 4NQMA 4O7BA 4TTEA 4O78A 5E74A 5FB0A 4BW3A 5I80A 3LQHA 4QSVA 5F61A 2E7OA 3O35A 4LZ2A 5LKXA 4OGJA 5F25A 5A5SA 4YH3A 3O34A 5KTXA 4HXPA 5FFVA 4XUBA 4UYEA 2WP2A 5DW1A 3D7CA 4QSUA 4O70A 5EWWA 5JWMA 5G4RA 5A5NA 5I7YA 3UVXA 5CU8A 4PKLA 5EM3A 5AD2A 5ENFA 5AMFA 4C66A 3LXJA 4YY6A 4UYFB 2KTBB 5KTWA 5E73A 4NYVA 5IGNA 5HFRA 4UIYA 4UYFA 5HFQA 3RCWA 5FG5A 5LVQA 5HM0A 5FBXA 4YBSA 4IORA 4QUTA 4TS8A 5F1HA 4IOOA 5D25A 4Q0OA 4NRAA 5F5ZA 5ACYA 5EWCA 4QEUA 4YAXA 3I3JA 3HMEA 4PY6A 5C8GA 4O74A 5FDZA 5E9YA 2R0SA 4KCXA 4UIZA 4NR5A 5CUEA 5F1LA 5FE4A 5HRVA 5F63A 5G4SA 5DKDA 5FE7A 5CUGA 2OO1A 4J0SA 4A9NA 1N72A 4BW4A 5K29A 3O33A 3ZYUA 4TT4A 3HMHA 5L97A 4IR3A 3FKMX 2FSAA 5H1UA 4CUSA 5D3TA 3MQMA 5D3JA 4UIXA 3AADA 5H1VA 2DKWA 5E3GA 4CURA 5AMEA 5D0CA 5FG6A 5DY7A 3P1FA 5DFBA 4TYLA 5L8TA 5E3DA 5ETBA 5HEMA 5C7NA 4UYHA 3ONIA 3O37A 4HBWA 4MEOA 5E9VA 5E7DA 4TT2A 4UIVA 4C67A 4CUUA 4A9IA 5KO4A 4N4IA 4UIWA 4TU4A 4QYDA 4NR4A 5E0RA 4PTBA 5FH6A 4UIUA 4NYWA 4PCEA 3O36A 5TCMA 4OGIA 4MENA 4ALHA 4QUUA 5ENJA 4N3WA 2DWWA 4YBTA 4QC3A 4YYMA 4O72A 3QZSA 5CUDA 5D3RA 5IIDA 4BW2A 4BJXA 2F6NA 5FE5A 5FG4A 5DFDA 4QSRA 4YADA 4QSPA 5EI4A 5DKCA 3UVYA 3G0LA 5HQ6A 5JI8A 4A9MA 4HXRA 5I7XA 5A5OA 2YEMA 5HRXA 3UV2A 5L98A 4QSQA 2RI7A 4NS5A 4KV4A 4HBVA 3QZTA 5KU3A 4HXNA 2D9EA 4NRBA 5IBNA 4YYGA 4LRGA 3LJWA 3JVMA 5HLSA 5FE2A 5CZGA 5I29A 5EQ1A 5FE6A 4CL9A 5F62A 5EICA 5LJ0A 5D3LA 5A5QA 4NUDA 5C4QA 5D24A 5FFYA 4HXLA 4QSSA 4QSXA 5EISA 4PS5A 5BT5A 4YH4A 2D82A 2GRCA 5FE8A 5EPRA 5FFWA 3DWYA 5KTUA 5ENHA 3U5OA 1ZS5A 5CRZA 5DLXA 3SVFA 3IU6A 4A9KA 4ALGA 5EK9A 5AD3A 4XUAA 4J1PA 3UV5A 5DYCA 2DATA 4QBMA 4YC9A 4CLBA 5CPEA 5CQ5A 5D3SA 4QEVA 5D7XA 5DX4A 3DAIA 4ZQLA 3NXBA 5CUBA 3P5OA 4X2IA 4BHWA 5LUUA 4MR3A 4FLPA 2DVVA 5EGUA 1JM4B 4J3IA 5DYUA 5IGMA 2N9GA 4WHWA 5A82A 1JSPB 5DYAA 4LZSA 4Z1QA 2I7KA 5CQ3A 4J0RA 2H60A 4O77A 4TQNA 4YY4A 3LQJA 5I40A 3JVJA 5CQAA 5HELA 5DYXA 4O7FA 5EWDA 5FB1A 4QY4A 5ENEA 1X0JA 4UYGA 2RS9B 4O76A 5CS8A 2YDWA 5ENGA 3MB3A 4MEQA 4WIVA 3AQAA 5CGPA 3MB4A 5FE1A 5F36A 5EPBA 4O7AA 5I88A 4OUFA 3U5KA 4HXOA 2RO1A 5FH7A 2I8NA 2NXBA 5CRMA 4LZRA 5A83A 3S91A 4XY8A 5C87A 5DKHA 5HJCA 5E9KA 3SVGA 4TZ2A 2RNXA 4CFLA 5E9LA 5BT4A 5DW2A 5EVAA 5II1A 5F3AA 4ZW1A 3LQIA 4WHUA 4PCIA 3SVHA 3P1EA 5CQ7A 4QSWA 5HCLA 5TB6A 4YYKA 4HXSA 5EWHA 4NR9A 2LSPB 2YW5A 4A9JA 3Q2EA 2E7NA 5EV9A 5DFCA 4CUQA 4MEPA 5FE0A 5A5RA 4YABA 4N4GA 5BT3A 4LYIA 3K2JA 4NUCA 4TZ8A 4TU6A 5ETDA 5A5PA 4N4FA 3U5LA 4F3IA 4A9LA 2R10A 4NR7A 3UW9A 4YYNA 4QR4A 2YQDA 5DLZA 4QR3A 5EPSA 5CQ8A 5HENA 4MR4A 4AKNA 4DONA 4XY9A 4TT6A 4QC1A 5HQ5A 2E3KA 3JVKA 3U5PA 5ENIA 5EWVA 4LDFA 4NR6A 4Z6IA 4MR6A 5H1TA 4Z6HA 3MUKA 2DVQA 5I86A 4A9OA 2YEKA 4N4HA 5EU1A 2OUOA 2F6JA 4QEWA 4IR4A 4NUEA 5HRWA 4YYHA 5A85A 3U5MA 4QB3A 5ENCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CQ4 A;  2YEL A;  2R0V A;  5CQ6 A;  4HBY A;  4CUT A;  5I1Q A;  3MUL A;  3P1C A;  3UVD A;  4YYD A;  2L85 A;  4YYJ A;  4IR5 A;  5CTL A;  5F2P A;  3HMF A;  3S92 A;  4Z93 A;  4HXM A;  5CP5 A;  4A9H A;  2RNW A;  4UIT A;  1E6I A;  4LR6 A;  4MR5 A;  5HQ7 A;  2OSS A;  4IR6 A;  5CY9 A;  4YBM A;  5J0D A;  4NQN A;  3U5N A;  3U5J A;  5I89 A;  4LYW A;  1WUG A;  4LC2 A;  4KV1 A;  4NR8 A;  2L5E A;  4CFK A;  5E9M A;  4A9F A;  3UV4 A;  4O75 A;  5FE9 A;  3QZV A;  2R0Y A;  4CUP A;  3P1D A;  4NXJ A;  2MJV B;  2YYN A;  5FH8 A;  5IGL A;  5L99 A;  5H85 A;  5L8U A;  3G0J A;  3UVW A;  2G4A A;  3Q2F A;  5D3H A;  5LJ2 A;  5I83 A;  4YK0 A;  2DVR A;  5LKU A;  3MXF A;  2DVS A;  4HXK A;  4LYS A;  5D26 A;  4ZC9 A;  4E96 A;  4XYA A;  5LKZ A;  3TLP A;  2RFJ A;  5D3N A;  5EA1 A;  5CQT A;  5EP7 A;  4QNS A;  4QR5 A;  4YYI A;  4O7E A;  3GG3 A;  4NRC A;  4Y03 A;  4O71 A;  4UYD A;  5A7C A;  5D3P A;  4Z1S A;  5CUA A;  3JVL A;  4GPJ A;  5LJ1 A;  5ENB A;  5FE3 A;  5L96 A;  5COI A;  5LKT A;  4BW1 A;  2RNY A;  4A9E A;  4RVR A;  2L84 A;  4YAT A;  4QST A;  4HBX A;  4O7C A;  5E9I A;  5IGK A;  1WUM A;  4IOQ A;  4QYL A;  5F60 A;  1EQF A;  5IG6 A;  5DBM A;  3IU5 A;  1F68 A;  5CFW A;  4Q0N A;  5LVR A;  5KHM A;  4QZS A;  5C85 A;  5A81 A;  5CUC A;  5C89 A;  2WP1 A;  4NYX A;  5II2 A;  4NQM A;  4O7B A;  4TTE A;  4O78 A;  5E74 A;  5FB0 A;  4BW3 A;  5I80 A;  3LQH A;  4QSV A;  5F61 A;  2E7O A;  3O35 A;  4LZ2 A;  5LKX A;  4OGJ A;  5F25 A;  5A5S A;  4YH3 A;  3O34 A;  5KTX A;  4HXP A;  5FFV A;  4XUB A;  4UYE A;  2WP2 A;  5DW1 A;  3D7C A;  4QSU A;  4O70 A;  5EWW A;  5JWM A;  5G4R A;  5A5N A;  5I7Y A;  3UVX A;  5CU8 A;  4PKL A;  5EM3 A;  5AD2 A;  5ENF A;  5AMF A;  4C66 A;  3LXJ A;  4YY6 A;  4UYF B;  2KTB B;  5KTW A;  5E73 A;  4NYV A;  5IGN A;  5HFR A;  4UIY A;  4UYF A;  5HFQ A;  3RCW A;  5FG5 A;  5LVQ A;  5HM0 A;  5FBX A;  4YBS A;  4IOR A;  4QUT A;  4TS8 A;  5F1H A;  4IOO A;  5D25 A;  4Q0O A;  4NRA A;  5F5Z A;  5ACY A;  5EWC A;  4QEU A;  4YAX A;  3I3J A;  3HME A;  4PY6 A;  5C8G A;  4O74 A;  5FDZ A;  5E9Y A;  2R0S A;  4KCX A;  4UIZ A;  4NR5 A;  5CUE A;  5F1L A;  5FE4 A;  5HRV A;  5F63 A;  5G4S A;  5DKD A;  5FE7 A;  5CUG A;  2OO1 A;  4J0S A;  4A9N A;  1N72 A;  4BW4 A;  5K29 A;  3O33 A;  3ZYU A;  4TT4 A;  3HMH A;  5L97 A;  4IR3 A;  3FKM X;  2FSA A;  5H1U A;  4CUS A;  5D3T A;  3MQM A;  5D3J A;  4UIX A;  3AAD A;  5H1V A;  2DKW A;  5E3G A;  4CUR A;  5AME A;  5D0C A;  5FG6 A;  5DY7 A;  3P1F A;  5DFB A;  4TYL A;  5L8T A;  5E3D A;  5ETB A;  5HEM A;  5C7N A;  4UYH A;  3ONI A;  3O37 A;  4HBW A;  4MEO A;  5E9V A;  5E7D A;  4TT2 A;  4UIV A;  4C67 A;  4CUU A;  4A9I A;  5KO4 A;  4N4I A;  4UIW A;  4TU4 A;  4QYD A;  4NR4 A;  5E0R A;  4PTB A;  5FH6 A;  4UIU A;  4NYW A;  4PCE A;  3O36 A;  5TCM A;  4OGI A;  4MEN A;  4ALH A;  4QUU A;  5ENJ A;  4N3W A;  2DWW A;  4YBT A;  4QC3 A;  4YYM A;  4O72 A;  3QZS A;  5CUD A;  5D3R A;  5IID A;  4BW2 A;  4BJX A;  2F6N A;  5FE5 A;  5FG4 A;  5DFD A;  4QSR A;  4YAD A;  4QSP A;  5EI4 A;  5DKC A;  3UVY A;  3G0L A;  5HQ6 A;  5JI8 A;  4A9M A;  4HXR A;  5I7X A;  5A5O A;  2YEM A;  5HRX A;  3UV2 A;  5L98 A;  4QSQ A;  2RI7 A;  4NS5 A;  4KV4 A;  4HBV A;  3QZT A;  5KU3 A;  4HXN A;  2D9E A;  4NRB A;  5IBN A;  4YYG A;  4LRG A;  3LJW A;  3JVM A;  5HLS A;  5FE2 A;  5CZG A;  5I29 A;  5EQ1 A;  5FE6 A;  4CL9 A;  5F62 A;  5EIC A;  5LJ0 A;  5D3L A;  5A5Q A;  4NUD A;  5C4Q A;  5D24 A;  5FFY A;  4HXL A;  4QSS A;  4QSX A;  5EIS A;  4PS5 A;  5BT5 A;  4YH4 A;  2D82 A;  2GRC A;  5FE8 A;  5EPR A;  5FFW A;  3DWY A;  5KTU A;  5ENH A;  3U5O A;  1ZS5 A;  5CRZ A;  5DLX A;  3SVF A;  3IU6 A;  4A9K A;  4ALG A;  5EK9 A;  5AD3 A;  4XUA A;  4J1P A;  3UV5 A;  5DYC A;  2DAT A;  4QBM A;  4YC9 A;  4CLB A;  5CPE A;  5CQ5 A;  5D3S A;  4QEV A;  5D7X A;  5DX4 A;  3DAI A;  4ZQL A;  3NXB A;  5CUB A;  3P5O A;  4X2I A;  4BHW A;  5LUU A;  4MR3 A;  4FLP A;  2DVV A;  5EGU A;  1JM4 B;  4J3I A;  5DYU A;  5IGM A;  2N9G A;  4WHW A;  5A82 A;  1JSP B;  5DYA A;  4LZS A;  4Z1Q A;  2I7K A;  5CQ3 A;  4J0R A;  2H60 A;  4O77 A;  4TQN A;  4YY4 A;  3LQJ A;  5I40 A;  3JVJ A;  5CQA A;  5HEL A;  5DYX A;  4O7F A;  5EWD A;  5FB1 A;  4QY4 A;  5ENE A;  1X0J A;  4UYG A;  2RS9 B;  4O76 A;  5CS8 A;  2YDW A;  5ENG A;  3MB3 A;  4MEQ A;  4WIV A;  3AQA A;  5CGP A;  3MB4 A;  5FE1 A;  5F36 A;  5EPB A;  4O7A A;  5I88 A;  4OUF A;  3U5K A;  4HXO A;  2RO1 A;  5FH7 A;  2I8N A;  2NXB A;  5CRM A;  4LZR A;  5A83 A;  3S91 A;  4XY8 A;  5C87 A;  5DKH A;  5HJC A;  5E9K A;  3SVG A;  4TZ2 A;  2RNX A;  4CFL A;  5E9L A;  5BT4 A;  5DW2 A;  5EVA A;  5II1 A;  5F3A A;  4ZW1 A;  3LQI A;  4WHU A;  4PCI A;  3SVH A;  3P1E A;  5CQ7 A;  4QSW A;  5HCL A;  5TB6 A;  4YYK A;  4HXS A;  5EWH A;  4NR9 A;  2LSP B;  2YW5 A;  4A9J A;  3Q2E A;  2E7N A;  5EV9 A;  5DFC A;  4CUQ A;  4MEP A;  5FE0 A;  5A5R A;  4YAB A;  4N4G A;  5BT3 A;  4LYI A;  3K2J A;  4NUC A;  4TZ8 A;  4TU6 A;  5ETD A;  5A5P A;  4N4F A;  3U5L A;  4F3I A;  4A9L A;  2R10 A;  4NR7 A;  3UW9 A;  4YYN A;  4QR4 A;  2YQD A;  5DLZ A;  4QR3 A;  5EPS A;  5CQ8 A;  5HEN A;  4MR4 A;  4AKN A;  4DON A;  4XY9 A;  4TT6 A;  4QC1 A;  5HQ5 A;  2E3K A;  3JVK A;  3U5P A;  5ENI A;  5EWV A;  4LDF A;  4NR6 A;  4Z6I A;  4MR6 A;  5H1T A;  4Z6H A;  3MUK A;  2DVQ A;  5I86 A;  4A9O A;  2YEK A;  4N4H A;  5EU1 A;  2OUO A;  2F6J A;  4QEW A;  4IR4 A;  4NUE A;  5HRW A;  4YYH A;  5A85 A;  3U5M A;  4QB3 A;  5ENC A; 
#chains in the Genus database with same CATH topology
 5CQ4 A;  2YEL A;  2R0V A;  5CQ6 A;  4HBY A;  4CUT A;  1PUO A;  5I1Q A;  3MUL A;  3P1C A;  3UVD A;  4YYD A;  2L85 A;  4YYJ A;  4IR5 A;  5CTL A;  5F2P A;  3HMF A;  3S92 A;  4Z93 A;  4HXM A;  5CP5 A;  4A9H A;  2RNW A;  4UIT A;  1E6I A;  4LR6 A;  4MR5 A;  5HQ7 A;  2OSS A;  4IR6 A;  5CY9 A;  4YBM A;  5J0D A;  4NQN A;  3U5N A;  3U5J A;  5I89 A;  4LYW A;  1WUG A;  4LC2 A;  4KV1 A;  4NR8 A;  2L5E A;  4AKG A;  4CFK A;  5E9M A;  4A9F A;  3UV4 A;  4O75 A;  5FE9 A;  3QZV A;  2R0Y A;  4CUP A;  3P1D A;  4NXJ A;  2MJV B;  2YYN A;  5FH8 A;  5IGL A;  5L99 A;  5H85 A;  5L8U A;  3G0J A;  3UVW A;  3D1B A;  2G4A A;  3Q2F A;  5D3H A;  5LJ2 A;  5I83 A;  4YK0 A;  2DVR A;  5LKU A;  3MXF A;  2DVS A;  3VKH A;  4HXK A;  4LYS A;  5D26 A;  4ZC9 A;  4E96 A;  4XYA A;  5LKZ A;  3TLP A;  2RFJ A;  5D3N A;  5EA1 A;  5CQT A;  5EP7 A;  4QNS A;  4QR5 A;  4YYI A;  4O7E A;  3GG3 A;  1ZKR A;  4NRC A;  4Y03 A;  4O71 A;  4UYD A;  5A7C A;  5D3P A;  4Z1S A;  5CUA A;  3JVL A;  4GPJ A;  5LJ1 A;  5ENB A;  5FE3 A;  5L96 A;  3ERR A;  5COI A;  5LKT A;  4BW1 A;  2RNY A;  4A9E A;  4RVR A;  2L84 A;  4YAT A;  4QST A;  4HBX A;  4O7C A;  5E9I A;  5IGK A;  1WUM A;  4IOQ A;  4QYL A;  5F60 A;  1EQF A;  5IG6 A;  5DBM A;  3IU5 A;  1F68 A;  5CFW A;  4Q0N A;  5LVR A;  5KHM A;  4QZS A;  5C85 A;  5A81 A;  5CUC A;  5C89 A;  2WP1 A;  4NYX A;  5II2 A;  4NQM A;  4O7B A;  4TTE A;  4O78 A;  5E74 A;  5FB0 A;  4BW3 A;  5I80 A;  3LQH A;  4QSV A;  5F61 A;  2E7O A;  3O35 A;  4LZ2 A;  5LKX A;  4OGJ A;  5F25 A;  5A5S A;  4YH3 A;  3O34 A;  5KTX A;  4HXP A;  5FFV A;  4XUB A;  4UYE A;  2WP2 A;  5DW1 A;  3D7C A;  4QSU A;  4O70 A;  5EWW A;  5JWM A;  5G4R A;  5A5N A;  5I7Y A;  3UVX A;  5CU8 A;  4PKL A;  5EM3 A;  5AD2 A;  5ENF A;  5AMF A;  4C66 A;  3LXJ A;  4YY6 A;  4UYF B;  2KTB B;  5KTW A;  5E73 A;  4NYV A;  5IGN A;  2EJN A;  5HFR A;  4UIY A;  4UYF A;  5HFQ A;  3RCW A;  5FG5 A;  5LVQ A;  5HM0 A;  5FBX A;  4YBS A;  4IOR A;  4QUT A;  4TS8 A;  5F1H A;  4IOO A;  5D25 A;  4Q0O A;  4NRA A;  5F5Z A;  5ACY A;  5EWC A;  4QEU A;  4YAX A;  3I3J A;  3HME A;  4PY6 A;  5C8G A;  4O74 A;  5FDZ A;  5E9Y A;  2R0S A;  4KCX A;  4UIZ A;  4NR5 A;  5CUE A;  5F1L A;  5FE4 A;  5HRV A;  5F63 A;  5G4S A;  5DKD A;  5FE7 A;  5CUG A;  2OO1 A;  4J0S A;  4A9N A;  1N72 A;  4BW4 A;  5K29 A;  3O33 A;  3ZYU A;  4AKI A;  4TT4 A;  3HMH A;  5L97 A;  4IR3 A;  3FKM X;  2FSA A;  5H1U A;  4CUS A;  5D3T A;  3MQM A;  5D3J A;  4UIX A;  3AAD A;  5H1V A;  2DKW A;  5E3G A;  4CUR A;  5AME A;  5D0C A;  5FG6 A;  5DY7 A;  3P1F A;  5DFB A;  4TYL A;  5L8T A;  5E3D A;  5ETB A;  5HEM A;  5C7N A;  4UYH A;  3ONI A;  3O37 A;  4HBW A;  4MEO A;  5E9V A;  5E7D A;  4TT2 A;  4UIV A;  4C67 A;  4CUU A;  4A9I A;  5KO4 A;  4N4I A;  4UIW A;  4TU4 A;  4QYD A;  4NR4 A;  5E0R A;  4PTB A;  5FH6 A;  4UIU A;  4NYW A;  4PCE A;  3O36 A;  5TCM A;  4OGI A;  4MEN A;  4AI6 A;  4ALH A;  4QUU A;  5ENJ A;  4N3W A;  2DWW A;  4YBT A;  4QC3 A;  4YYM A;  4O72 A;  3QZS A;  5CUD A;  5D3R A;  5IID A;  4BW2 A;  4BJX A;  2F6N A;  5FE5 A;  4AKH A;  5FG4 A;  5DFD A;  4QSR A;  4YAD A;  4QSP A;  5EI4 A;  5DKC A;  3UVY A;  3G0L A;  5HQ6 A;  5JI8 A;  4A9M A;  4HXR A;  5I7X A;  5A5O A;  2YEM A;  5HRX A;  3UV2 A;  5L98 A;  4QSQ A;  2RI7 A;  4NS5 A;  4KV4 A;  3VKG A;  4HBV A;  3QZT A;  5KU3 A;  4HXN A;  2D9E A;  4NRB A;  5IBN A;  4YYG A;  4LRG A;  3LJW A;  3JVM A;  5HLS A;  5FE2 A;  5CZG A;  5I29 A;  5EQ1 A;  5FE6 A;  4CL9 A;  5F62 A;  5EIC A;  5LJ0 A;  5D3L A;  5A5Q A;  4NUD A;  5C4Q A;  5D24 A;  5FFY A;  4HXL A;  4QSS A;  4QSX A;  5EIS A;  4PS5 A;  5BT5 A;  4YH4 A;  2D82 A;  2GRC A;  5FE8 A;  5EPR A;  5FFW A;  3DWY A;  5KTU A;  5ENH A;  3U5O A;  1ZS5 A;  5CRZ A;  5DLX A;  3SVF A;  3IU6 A;  4A9K A;  4ALG A;  5EK9 A;  5AD3 A;  4XUA A;  4J1P A;  3UV5 A;  5DYC A;  2DAT A;  4QBM A;  4YC9 A;  4CLB A;  5CPE A;  5CQ5 A;  5D3S A;  4QEV A;  5D7X A;  5DX4 A;  3DAI A;  4ZQL A;  3NXB A;  5CUB A;  3P5O A;  4X2I A;  4BHW A;  5LUU A;  4MR3 A;  4FLP A;  2DVV A;  5EGU A;  1JM4 B;  4J3I A;  5DYU A;  5IGM A;  2N9G A;  4WHW A;  5A82 A;  1JSP B;  5DYA A;  4LZS A;  4Z1Q A;  2I7K A;  5CQ3 A;  4J0R A;  2H60 A;  4O77 A;  4TQN A;  4YY4 A;  3LQJ A;  5I40 A;  3JVJ A;  5CQA A;  5HEL A;  5DYX A;  4O7F A;  5EWD A;  5FB1 A;  4QY4 A;  5ENE A;  1X0J A;  4UYG A;  2RS9 B;  4O76 A;  5CS8 A;  2YDW A;  5ENG A;  3MB3 A;  4MEQ A;  4WIV A;  3AQA A;  5CGP A;  3MB4 A;  5FE1 A;  5F36 A;  5EPB A;  4O7A A;  5I88 A;  4OUF A;  3U5K A;  4HXO A;  2RO1 A;  5FH7 A;  2I8N A;  2NXB A;  5CRM A;  4LZR A;  5A83 A;  3S91 A;  4XY8 A;  5C87 A;  5DKH A;  5HJC A;  5E9K A;  3SVG A;  4TZ2 A;  2RNX A;  4CFL A;  5E9L A;  5BT4 A;  5DW2 A;  5EVA A;  5II1 A;  5F3A A;  4ZW1 A;  3LQI A;  4WHU A;  4PCI A;  3SVH A;  3P1E A;  5CQ7 A;  3D1D A;  4QSW A;  5HCL A;  5TB6 A;  4YYK A;  4HXS A;  5EWH A;  4NR9 A;  2LSP B;  2YW5 A;  4A9J A;  3Q2E A;  2E7N A;  5EV9 A;  5DFC A;  4CUQ A;  4MEP A;  5FE0 A;  5A5R A;  4YAB A;  4N4G A;  5BT3 A;  4LYI A;  3K2J A;  4NUC A;  4TZ8 A;  4TU6 A;  5ETD A;  5A5P A;  4N4F A;  3U5L A;  4F3I A;  4A9L A;  2R10 A;  4NR7 A;  3UW9 A;  4YYN A;  4QR4 A;  2YQD A;  5DLZ A;  4QR3 A;  5EPS A;  5CQ8 A;  5HEN A;  4MR4 A;  4AKN A;  4DON A;  4XY9 A;  4TT6 A;  4QC1 A;  5HQ5 A;  2E3K A;  3JVK A;  3U5P A;  5ENI A;  5EWV A;  4LDF A;  4NR6 A;  4Z6I A;  4MR6 A;  5H1T A;  4Z6H A;  3MUK A;  2DVQ A;  5I86 A;  4A9O A;  2YEK A;  4N4H A;  5EU1 A;  2OUO A;  2F6J A;  4QEW A;  4IR4 A;  4NUE A;  5HRW A;  4YYH A;  5A85 A;  3U5M A;  4QB3 A;  5ENC A; 
#chains in the Genus database with same CATH homology
 5CQ4 A;  2YEL A;  2R0V A;  5CQ6 A;  4HBY A;  4CUT A;  5I1Q A;  3MUL A;  3P1C A;  3UVD A;  4YYD A;  2L85 A;  4YYJ A;  4IR5 A;  5CTL A;  5F2P A;  3HMF A;  3S92 A;  4Z93 A;  4HXM A;  5CP5 A;  4A9H A;  2RNW A;  4UIT A;  1E6I A;  4LR6 A;  4MR5 A;  5HQ7 A;  2OSS A;  4IR6 A;  5CY9 A;  4YBM A;  5J0D A;  4NQN A;  3U5N A;  3U5J A;  5I89 A;  4LYW A;  1WUG A;  4LC2 A;  4KV1 A;  4NR8 A;  2L5E A;  4CFK A;  5E9M A;  4A9F A;  3UV4 A;  4O75 A;  5FE9 A;  3QZV A;  2R0Y A;  4CUP A;  3P1D A;  4NXJ A;  2MJV B;  2YYN A;  5FH8 A;  5IGL A;  5L99 A;  5H85 A;  5L8U A;  3G0J A;  3UVW A;  2G4A A;  3Q2F A;  5D3H A;  5LJ2 A;  5I83 A;  4YK0 A;  2DVR A;  5LKU A;  3MXF A;  2DVS A;  4HXK A;  4LYS A;  5D26 A;  4ZC9 A;  4E96 A;  4XYA A;  5LKZ A;  3TLP A;  2RFJ A;  5D3N A;  5EA1 A;  5CQT A;  5EP7 A;  4QNS A;  4QR5 A;  4YYI A;  4O7E A;  3GG3 A;  4NRC A;  4Y03 A;  4O71 A;  4UYD A;  5A7C A;  5D3P A;  4Z1S A;  5CUA A;  3JVL A;  4GPJ A;  5LJ1 A;  5ENB A;  5FE3 A;  5L96 A;  5COI A;  5LKT A;  4BW1 A;  2RNY A;  4A9E A;  4RVR A;  2L84 A;  4YAT A;  4QST A;  4HBX A;  4O7C A;  5E9I A;  5IGK A;  1WUM A;  4IOQ A;  4QYL A;  5F60 A;  1EQF A;  5IG6 A;  5DBM A;  3IU5 A;  1F68 A;  5CFW A;  4Q0N A;  5LVR A;  5KHM A;  4QZS A;  5C85 A;  5A81 A;  5CUC A;  5C89 A;  2WP1 A;  4NYX A;  5II2 A;  4NQM A;  4O7B A;  4TTE A;  4O78 A;  5E74 A;  5FB0 A;  4BW3 A;  5I80 A;  3LQH A;  4QSV A;  5F61 A;  2E7O A;  3O35 A;  4LZ2 A;  5LKX A;  4OGJ A;  5F25 A;  5A5S A;  4YH3 A;  3O34 A;  5KTX A;  4HXP A;  5FFV A;  4XUB A;  4UYE A;  2WP2 A;  5DW1 A;  3D7C A;  4QSU A;  4O70 A;  5EWW A;  5JWM A;  5G4R A;  5A5N A;  5I7Y A;  3UVX A;  5CU8 A;  4PKL A;  5EM3 A;  5AD2 A;  5ENF A;  5AMF A;  4C66 A;  3LXJ A;  4YY6 A;  4UYF B;  2KTB B;  5KTW A;  5E73 A;  4NYV A;  5IGN A;  5HFR A;  4UIY A;  4UYF A;  5HFQ A;  3RCW A;  5FG5 A;  5LVQ A;  5HM0 A;  5FBX A;  4YBS A;  4IOR A;  4QUT A;  4TS8 A;  5F1H A;  4IOO A;  5D25 A;  4Q0O A;  4NRA A;  5F5Z A;  5ACY A;  5EWC A;  4QEU A;  4YAX A;  3I3J A;  3HME A;  4PY6 A;  5C8G A;  4O74 A;  5FDZ A;  5E9Y A;  2R0S A;  4KCX A;  4UIZ A;  4NR5 A;  5CUE A;  5F1L A;  5FE4 A;  5HRV A;  5F63 A;  5G4S A;  5DKD A;  5FE7 A;  5CUG A;  2OO1 A;  4J0S A;  4A9N A;  1N72 A;  4BW4 A;  5K29 A;  3O33 A;  3ZYU A;  4TT4 A;  3HMH A;  5L97 A;  4IR3 A;  3FKM X;  2FSA A;  5H1U A;  4CUS A;  5D3T A;  3MQM A;  5D3J A;  4UIX A;  3AAD A;  5H1V A;  2DKW A;  5E3G A;  4CUR A;  5AME A;  5D0C A;  5FG6 A;  5DY7 A;  3P1F A;  5DFB A;  4TYL A;  5L8T A;  5E3D A;  5ETB A;  5HEM A;  5C7N A;  4UYH A;  3ONI A;  3O37 A;  4HBW A;  4MEO A;  5E9V A;  5E7D A;  4TT2 A;  4UIV A;  4C67 A;  4CUU A;  4A9I A;  5KO4 A;  4N4I A;  4UIW A;  4TU4 A;  4QYD A;  4NR4 A;  5E0R A;  4PTB A;  5FH6 A;  4UIU A;  4NYW A;  4PCE A;  3O36 A;  5TCM A;  4OGI A;  4MEN A;  4ALH A;  4QUU A;  5ENJ A;  4N3W A;  2DWW A;  4YBT A;  4QC3 A;  4YYM A;  4O72 A;  3QZS A;  5CUD A;  5D3R A;  5IID A;  4BW2 A;  4BJX A;  2F6N A;  5FE5 A;  5FG4 A;  5DFD A;  4QSR A;  4YAD A;  4QSP A;  5EI4 A;  5DKC A;  3UVY A;  3G0L A;  5HQ6 A;  5JI8 A;  4A9M A;  4HXR A;  5I7X A;  5A5O A;  2YEM A;  5HRX A;  3UV2 A;  5L98 A;  4QSQ A;  2RI7 A;  4NS5 A;  4KV4 A;  4HBV A;  3QZT A;  5KU3 A;  4HXN A;  2D9E A;  4NRB A;  5IBN A;  4YYG A;  4LRG A;  3LJW A;  3JVM A;  5HLS A;  5FE2 A;  5CZG A;  5I29 A;  5EQ1 A;  5FE6 A;  4CL9 A;  5F62 A;  5EIC A;  5LJ0 A;  5D3L A;  5A5Q A;  4NUD A;  5C4Q A;  5D24 A;  5FFY A;  4HXL A;  4QSS A;  4QSX A;  5EIS A;  4PS5 A;  5BT5 A;  4YH4 A;  2D82 A;  2GRC A;  5FE8 A;  5EPR A;  5FFW A;  3DWY A;  5KTU A;  5ENH A;  3U5O A;  1ZS5 A;  5CRZ A;  5DLX A;  3SVF A;  3IU6 A;  4A9K A;  4ALG A;  5EK9 A;  5AD3 A;  4XUA A;  4J1P A;  3UV5 A;  5DYC A;  2DAT A;  4QBM A;  4YC9 A;  4CLB A;  5CPE A;  5CQ5 A;  5D3S A;  4QEV A;  5D7X A;  5DX4 A;  3DAI A;  4ZQL A;  3NXB A;  5CUB A;  3P5O A;  4X2I A;  4BHW A;  5LUU A;  4MR3 A;  4FLP A;  2DVV A;  5EGU A;  1JM4 B;  4J3I A;  5DYU A;  5IGM A;  2N9G A;  4WHW A;  5A82 A;  1JSP B;  5DYA A;  4LZS A;  4Z1Q A;  2I7K A;  5CQ3 A;  4J0R A;  2H60 A;  4O77 A;  4TQN A;  4YY4 A;  3LQJ A;  5I40 A;  3JVJ A;  5CQA A;  5HEL A;  5DYX A;  4O7F A;  5EWD A;  5FB1 A;  4QY4 A;  5ENE A;  1X0J A;  4UYG A;  2RS9 B;  4O76 A;  5CS8 A;  2YDW A;  5ENG A;  3MB3 A;  4MEQ A;  4WIV A;  3AQA A;  5CGP A;  3MB4 A;  5FE1 A;  5F36 A;  5EPB A;  4O7A A;  5I88 A;  4OUF A;  3U5K A;  4HXO A;  2RO1 A;  5FH7 A;  2I8N A;  2NXB A;  5CRM A;  4LZR A;  5A83 A;  3S91 A;  4XY8 A;  5C87 A;  5DKH A;  5HJC A;  5E9K A;  3SVG A;  4TZ2 A;  2RNX A;  4CFL A;  5E9L A;  5BT4 A;  5DW2 A;  5EVA A;  5II1 A;  5F3A A;  4ZW1 A;  3LQI A;  4WHU A;  4PCI A;  3SVH A;  3P1E A;  5CQ7 A;  4QSW A;  5HCL A;  5TB6 A;  4YYK A;  4HXS A;  5EWH A;  4NR9 A;  2LSP B;  2YW5 A;  4A9J A;  3Q2E A;  2E7N A;  5EV9 A;  5DFC A;  4CUQ A;  4MEP A;  5FE0 A;  5A5R A;  4YAB A;  4N4G A;  5BT3 A;  4LYI A;  3K2J A;  4NUC A;  4TZ8 A;  4TU6 A;  5ETD A;  5A5P A;  4N4F A;  3U5L A;  4F3I A;  4A9L A;  2R10 A;  4NR7 A;  3UW9 A;  4YYN A;  4QR4 A;  2YQD A;  5DLZ A;  4QR3 A;  5EPS A;  5CQ8 A;  5HEN A;  4MR4 A;  4AKN A;  4DON A;  4XY9 A;  4TT6 A;  4QC1 A;  5HQ5 A;  2E3K A;  3JVK A;  3U5P A;  5ENI A;  5EWV A;  4LDF A;  4NR6 A;  4Z6I A;  4MR6 A;  5H1T A;  4Z6H A;  3MUK A;  2DVQ A;  5I86 A;  4A9O A;  2YEK A;  4N4H A;  5EU1 A;  2OUO A;  2F6J A;  4QEW A;  4IR4 A;  4NUE A;  5HRW A;  4YYH A;  5A85 A;  3U5M A;  4QB3 A;  5ENC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...