3DAIA

Crystal structure of the bromodomain of the human atad2
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
130
structure length
130
Chain Sequence
SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICSNALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords ATPase family AAA domain-containing protein 2
publication title Histone recognition and large-scale structural analysis of the human bromodomain family.
pubmed doi rcsb
source organism Homo sapiens
total genus 52
structure length 130
sequence length 130
ec nomenclature ec 3.6.1.3: Adenosinetriphosphatase.
pdb deposition date 2008-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3daiA00
5FE1A 5D0CA 5FE7A 4PCIA 4LZ2A 5A82A 4TYLA 5BT5A 5ENEA 5DX4A 5H1VA 4HXNA 4NR7A 4UYDA 4QNSA 4BW4A 4CUQA 3IU6A 5LUUA 5F25A 1ZS5A 3JVKA 4QEVA 3DAIA 4O74A 4PKLA 4O7EA 5DYUA 3U5MA 4J3IA 5IG6A 3S91A 4CUSA 2R0VA 2YW5A 4QC1A 4LC2A 4UYFA 4UITA 4QR5A 5LKXA 2WP2A 4O71A 2E7OA 4QEUA 4A9LA 5IGKA 5HRVA 5F36A 4YH3A 2RNYA 4GPJA 4IORA 4MR3A 4IR6A 4F3IA 5A5RA 3LQHA 4NUEA 5K29A 5I80A 4MENA 5E3DA 3MUKA 5HELA 4WHWA 4MR6A 4UIWA 5L97A 4YBTA 3AADA 5DW1A 5C8GA 2YQDA 4YBMA 4ALGA 5AMFA 5D3NA 4LDFA 5CUDA 4QSTA 4QR3A 3JVMA 5C89A 4NR8A 5CQ6A 5D3HA 4MEOA 4HXLA 3JVLA 3P1FA 4TQNA 3U5JA 4N4GA 4NUCA 4J0SA 4YYHA 4QSSA 4HBWA 4QSVA 4TT6A 3TLPA 4XY9A 2OUOA 5TB6A 4YATA 5EICA 5A81A 5I88A 4O70A 5EWVA 3MB3A 5ENJA 5D7XA 4FLPA 1N72A 4N4FA 3U5LA 5CUEA 5E73A 4KV1A 5L98A 5COIA 5FE3A 2RNXA 3SVGA 3QZVA 3P1CA 4PCEA 2DWWA 5D3LA 4UIVA 5I83A 2RFJA 2DVQA 5FE2A 4NXJA 5JWMA 3U5OA 2DVVA 3QZTA 3ZYUA 4UIUA 4MEPA 3RCWA 5CPEA 4CUPA 5E9LA 3O36A 4UYEA 3UV2A 4BHWA 4QC3A 2YELA 5DKCA 4TU6A 5ENIA 5DFBA 5E9YA 5KTUA 4HXMA 5CRZA 5A5QA 4YYIA 3O35A 3HMEA 4CL9A 5HFQA 2L85A 4QYLA 4QSQA 5FFWA 5I29A 5CQ8A 2I7KA 5HQ7A 4LZRA 5H1UA 3I3JA 3UW9A 4YY4A 4IR4A 4KV4A 5DLZA 4A9MA 3UVWA 3U5PA 5ENFA 5BT3A 5HQ6A 2R10A 3O34A 2L5EA 5ACYA 5I1QA 5HJCA 2RO1A 2H60A 2YDWA 4LZSA 3D7CA 3UV5A 4PTBA 4DONA 5AD3A 5H1TA 4HBVA 5FE6A 3P1DA 4XYAA 5F1HA 5LKUA 5CU8A 5FE0A 5KTXA 4QSUA 3SVFA 4NR5A 5CUBA 4TTEA 5II2A 4QY4A 5FBXA 4UYHA 4TZ2A 3MULA 4YYMA 4YABA 5HLSA 4TT4A 5ETDA 2DVSA 4IOQA 2DVRA 5HEMA 5L8UA 4YYJA 5E9VA 5I40A 5DYAA 3LXJA 5DFCA 3LQJA 5FB0A 5CGPA 5C85A 5D3SA 3UVDA 5A5SA 4A9KA 4OGIA 5H85A 4PS5A 4LR6A 4NR9A 4A9EA 5D3PA 5KU3A 5HQ5A 4HXSA 4QSXA 4PY6A 4YADA 5F1LA 5EWDA 4BW1A 4NRCA 5KTWA 4YH4A 4A9HA 5F3AA 5HFRA 4UIXA 3G0JA 4NR4A 5A5PA 4XUAA 5FE5A 5ENGA 5E9IA 4O77A 5EPBA 4XUBA 5DKHA 4TS8A 5BT4A 4OUFA 5C7NA 3U5KA 5EU1A 4Z6HA 2YYNA 2R0SA 3ONIA 5FG5A 4O7AA 4O7CA 5F60A 5D24A 5E7DA 1X0JA 4IR3A 5F62A 3UVXA 5ETBA 5E74A 4J0RA 5DY7A 5HRXA 4N3WA 3S92A 4YYGA 4QUTA 2OSSA 4E96A 3IU5A 5FE4A 4HXKA 2E7NA 5I7XA 3Q2EA 4BW3A 5ENHA 5CUAA 4NYWA 5D26A 5A5NA 5IGNA 5F61A 5E0RA 5L8TA 5DLXA 2F6JA 5EM3A 3O37A 5CS8A 5FFVA 4CFLA 3UVYA 4YAXA 5D3RA 5CUGA 4C67A 5JI8A 4O75A 5A85A 5F5ZA 4QYDA 5CP5A 4ZQLA 4HXPA 2I8NA 3MQMA 4YYNA 5IGLA 5EP7A 4YBSA 4ALHA 5DYCA 5A83A 4CFKA 2NXBA 5EPRA 4AKNA 5FH8A 4O72A 5F2PA 3P5OA 2YEMA 5AMEA 4LYWA 4N4HA 4UIYA 2RI7A 4IR5A 5G4RA 2WP1A 3G0LA 3HMFA 4QBMA 4A9IA 4Z1SA 3SVHA 2RS9B 4HXRA 3AQAA 4KCXA 4QSWA 5FH7A 4CUUA 4X2IA 5KHMA 4NR6A 4QEWA 5D3TA 3K2JA 4YYKA 5I89A 4A9NA 5EGUA 5FB1A 4J1PA 2LSPB 5EV9A 4HBYA 5ENCA 1WUGA 5EVAA 4LYSA 2GRCA 2OO1A 4ZC9A 4LYIA 5DFDA 2E3KA 5LKTA 5FFYA 4TU4A 1E6IA 2DKWA 4YYDA 5DW2A 2L84A 4NQMA 4UIZA 5CQAA 4NS5A 5E9MA 3JVJA 3DWYA 5LJ0A 5CZGA 4UYFB 2G4AA 5CTLA 5C4QA 4YC9A 3FKMX 4LRGA 4QR4A 4QZSA 2N9GA 3LQIA 5EQ1A 4TZ8A 5FDZA 4OGJA 5EWCA 4CURA 5EI4A 4A9FA 4RVRA 5KO4A 5FE9A 4YY6A 5DBMA 3NXBA 5CUCA 4ZW1A 2YEKA 5E3GA 1F68A 4IOOA 4NYXA 4QSRA 4NRBA 4WIVA 4Z93A 5A5OA 5EWWA 5A7CA 5IGMA 4YK0A 2F6NA 4Y03A 5ENBA 4Q0NA 5LVRA 5TCMA 5HM0A 4BJXA 5CRMA 5EK9A 4CLBA 5II1A 3MXFA 2KTBB 4QB3A 4Z6IA 5L96A 4Z1QA 5I7YA 5F63A 4MR4A 5EWHA 5DKDA 5CQ5A 4O76A 1EQFA 3GG3A 2DATA 5G4SA 4NQNA 5LJ1A 5CQTA 4WHUA 4XY8A 5CQ3A 5EA1A 4C66A 3HMHA 2FSAA 4NRAA 2R0YA 3U5NA 5HENA 2D9EA 5D3JA 5EISA 3LJWA 5HRWA 5LKZA 2MJVB 4N4IA 4NUDA 3QZSA 5LVQA 2RNWA 1JSPB 4HXOA 4HBXA 4MR5A 5L99A 5AD2A 3P1EA 5C87A 5EPSA 4BW2A 1JM4B 2D82A 5D25A 3MB4A 3Q2FA 5J0DA 4QSPA 5I86A 5CY9A 5DYXA 5FG6A 4Q0OA 3UV4A 4O7BA 4MEQA 5IBNA 4O78A 5LJ2A 5FE8A 5HCLA 5IIDA 4NYVA 5FH6A 5E9KA 5CFWA 5FG4A 4A9JA 1WUMA 4UYGA 5CQ4A 4O7FA 4CUTA 4TT2A 4A9OA 5CQ7A 4QUUA 3O33A
chains in the Genus database with same CATH superfamily
5FE1A 5D0CA 5FE7A 4PCIA 4LZ2A 5A82A 4TYLA 5BT5A 5ENEA 5DX4A 5H1VA 3ERRA 4HXNA 4NR7A 4UYDA 4QNSA 4BW4A 4CUQA 3IU6A 5LUUA 5F25A 1ZS5A 3JVKA 4QEVA 3DAIA 4O74A 4PKLA 4O7EA 5DYUA 3U5MA 4J3IA 5IG6A 3S91A 4CUSA 2R0VA 2YW5A 4QC1A 4AKIA 4LC2A 4UYFA 4UITA 4QR5A 5LKXA 2WP2A 4O71A 2E7OA 4QEUA 4A9LA 5IGKA 5HRVA 5F36A 4YH3A 2RNYA 4GPJA 4IORA 4MR3A 4IR6A 4F3IA 5A5RA 3LQHA 4NUEA 5K29A 5I80A 4MENA 5E3DA 3MUKA 5HELA 4WHWA 4MR6A 4UIWA 5L97A 4YBTA 3AADA 5DW1A 5C8GA 2YQDA 4YBMA 4ALGA 5AMFA 5D3NA 4LDFA 5CUDA 4QSTA 4QR3A 3JVMA 5C89A 4NR8A 5CQ6A 5D3HA 4MEOA 4HXLA 3JVLA 3P1FA 4TQNA 3U5JA 4N4GA 4NUCA 4J0SA 4YYHA 4QSSA 4HBWA 4QSVA 4TT6A 3TLPA 4XY9A 2OUOA 5TB6A 4YATA 5EICA 5A81A 5I88A 4O70A 5EWVA 3MB3A 5ENJA 5D7XA 4FLPA 1N72A 4N4FA 3U5LA 5CUEA 5E73A 4KV1A 5L98A 5COIA 5FE3A 2RNXA 3SVGA 3QZVA 3P1CA 4PCEA 2DWWA 5D3LA 4UIVA 5I83A 2RFJA 2DVQA 5FE2A 4NXJA 5JWMA 3U5OA 2DVVA 3QZTA 3ZYUA 4UIUA 4MEPA 3RCWA 5CPEA 4CUPA 5E9LA 3O36A 4UYEA 3UV2A 4BHWA 2EJNA 4QC3A 2YELA 5DKCA 4TU6A 5ENIA 5DFBA 5E9YA 5KTUA 4HXMA 5CRZA 5A5QA 4YYIA 3O35A 3HMEA 4CL9A 5HFQA 2L85A 4QYLA 4QSQA 5FFWA 5I29A 5CQ8A 2I7KA 5HQ7A 4LZRA 5H1UA 3I3JA 3UW9A 4YY4A 4IR4A 4KV4A 5DLZA 4A9MA 3UVWA 3U5PA 5ENFA 5BT3A 5HQ6A 2R10A 3O34A 2L5EA 5ACYA 5I1QA 5HJCA 2RO1A 2H60A 2YDWA 4LZSA 3D7CA 3UV5A 4PTBA 4DONA 5AD3A 5H1TA 4HBVA 5FE6A 3P1DA 4XYAA 5F1HA 5LKUA 5CU8A 5FE0A 5KTXA 4QSUA 3SVFA 4NR5A 5CUBA 4TTEA 5II2A 4QY4A 5FBXA 4UYHA 4TZ2A 3MULA 4YYMA 4YABA 5HLSA 4TT4A 5ETDA 2DVSA 4IOQA 2DVRA 5HEMA 5L8UA 4YYJA 5E9VA 5I40A 5DYAA 3LXJA 5DFCA 3LQJA 5FB0A 5CGPA 5C85A 5D3SA 3UVDA 5A5SA 4A9KA 4OGIA 5H85A 4PS5A 4LR6A 4NR9A 4A9EA 5D3PA 5KU3A 5HQ5A 4HXSA 4QSXA 4PY6A 4YADA 5F1LA 5EWDA 4BW1A 4NRCA 5KTWA 4YH4A 4A9HA 5F3AA 5HFRA 4UIXA 3G0JA 4NR4A 5A5PA 4XUAA 5FE5A 5ENGA 5E9IA 4O77A 5EPBA 4XUBA 5DKHA 4TS8A 5BT4A 4OUFA 5C7NA 3VKGA 3U5KA 5EU1A 4Z6HA 2YYNA 2R0SA 3ONIA 5FG5A 4O7AA 4O7CA 5F60A 5D24A 5E7DA 1X0JA 4IR3A 5F62A 3UVXA 5ETBA 5E74A 4J0RA 5DY7A 5HRXA 4N3WA 3S92A 4YYGA 4AKHA 4QUTA 2OSSA 4E96A 3IU5A 5FE4A 4HXKA 2E7NA 5I7XA 3Q2EA 4BW3A 5ENHA 5CUAA 4NYWA 3D1DA 5D26A 5A5NA 5IGNA 5F61A 5E0RA 5L8TA 5DLXA 2F6JA 5EM3A 3O37A 5CS8A 5FFVA 4CFLA 3UVYA 4YAXA 5D3RA 5CUGA 4C67A 5JI8A 4O75A 5A85A 5F5ZA 4QYDA 5CP5A 4ZQLA 4HXPA 2I8NA 3MQMA 4YYNA 5IGLA 5EP7A 4YBSA 4ALHA 5DYCA 5A83A 4CFKA 2NXBA 5EPRA 4AKNA 5FH8A 4O72A 5F2PA 3P5OA 2YEMA 5AMEA 4LYWA 4N4HA 4UIYA 2RI7A 4IR5A 5G4RA 2WP1A 3G0LA 3HMFA 4QBMA 4A9IA 4Z1SA 3SVHA 2RS9B 4HXRA 3AQAA 4KCXA 4QSWA 5FH7A 4CUUA 4X2IA 5KHMA 4NR6A 4QEWA 5D3TA 3K2JA 4YYKA 5I89A 4A9NA 5EGUA 5FB1A 4J1PA 2LSPB 5EV9A 4HBYA 5ENCA 1WUGA 5EVAA 4LYSA 2GRCA 2OO1A 4ZC9A 4LYIA 5DFDA 2E3KA 5LKTA 5FFYA 4TU4A 1E6IA 2DKWA 4YYDA 5DW2A 2L84A 4NQMA 4UIZA 5CQAA 4NS5A 4AKGA 5E9MA 3JVJA 3DWYA 5LJ0A 5CZGA 4UYFB 2G4AA 5CTLA 5C4QA 4YC9A 3FKMX 4LRGA 4QR4A 4QZSA 2N9GA 3LQIA 5EQ1A 4TZ8A 5FDZA 4OGJA 5EWCA 4CURA 5EI4A 4A9FA 4RVRA 5KO4A 5FE9A 4YY6A 5DBMA 3NXBA 5CUCA 4ZW1A 2YEKA 5E3GA 1F68A 4IOOA 4NYXA 4QSRA 4NRBA 4WIVA 4Z93A 5A5OA 5EWWA 5A7CA 5IGMA 4YK0A 2F6NA 4Y03A 5ENBA 4Q0NA 5LVRA 5TCMA 5HM0A 4BJXA 5CRMA 5EK9A 4CLBA 5II1A 3MXFA 2KTBB 4QB3A 4Z6IA 5L96A 4Z1QA 5I7YA 5F63A 4MR4A 5EWHA 5DKDA 5CQ5A 4O76A 1EQFA 3GG3A 2DATA 5G4SA 4NQNA 5LJ1A 5CQTA 4WHUA 4XY8A 5CQ3A 5EA1A 4C66A 3HMHA 2FSAA 4NRAA 2R0YA 1ZKRA 5HENA 3U5NA 2D9EA 5D3JA 5EISA 3LJWA 5HRWA 3D1BA 5LKZA 2MJVB 4N4IA 4NUDA 3QZSA 5LVQA 2RNWA 1JSPB 4HXOA 4HBXA 4MR5A 5L99A 5AD2A 3P1EA 5C87A 5EPSA 4BW2A 1JM4B 2D82A 5D25A 3MB4A 3Q2FA 5J0DA 4QSPA 5I86A 5CY9A 5DYXA 5FG6A 4Q0OA 3UV4A 4O7BA 4MEQA 5IBNA 4O78A 5LJ2A 5FE8A 3VKHA 5HCLA 5IIDA 4NYVA 4AI6A 5FH6A 5E9KA 5CFWA 5FG4A 4A9JA 1WUMA 4UYGA 5CQ4A 4O7FA 4CUTA 1PUOA 4TT2A 4A9OA 5CQ7A 4QUUA 3O33A
chains in the Genus database with same CATH topology
5FE1A 5D0CA 5FE7A 4PCIA 4LZ2A 5A82A 4TYLA 5BT5A 5ENEA 5DX4A 5H1VA 4HXNA 4NR7A 4UYDA 4QNSA 4BW4A 4CUQA 3IU6A 5LUUA 5F25A 1ZS5A 3JVKA 4QEVA 3DAIA 4O74A 4PKLA 4O7EA 5DYUA 3U5MA 4J3IA 5IG6A 3S91A 4CUSA 2R0VA 2YW5A 4QC1A 4LC2A 4UYFA 4UITA 4QR5A 5LKXA 2WP2A 4O71A 2E7OA 4QEUA 4A9LA 5IGKA 5HRVA 5F36A 4YH3A 2RNYA 4GPJA 4IORA 4MR3A 4IR6A 4F3IA 5A5RA 3LQHA 4NUEA 5K29A 5I80A 4MENA 5E3DA 3MUKA 5HELA 4WHWA 4MR6A 4UIWA 5L97A 4YBTA 3AADA 5DW1A 5C8GA 2YQDA 4YBMA 4ALGA 5AMFA 5D3NA 4LDFA 5CUDA 4QSTA 4QR3A 3JVMA 5C89A 4NR8A 5CQ6A 5D3HA 4MEOA 4HXLA 3JVLA 3P1FA 4TQNA 3U5JA 4N4GA 4NUCA 4J0SA 4YYHA 4QSSA 4HBWA 4QSVA 4TT6A 3TLPA 4XY9A 2OUOA 5TB6A 4YATA 5EICA 5A81A 5I88A 4O70A 5EWVA 3MB3A 5ENJA 5D7XA 4FLPA 1N72A 4N4FA 3U5LA 5CUEA 5E73A 4KV1A 5L98A 5COIA 5FE3A 2RNXA 3SVGA 3QZVA 3P1CA 4PCEA 2DWWA 5D3LA 4UIVA 5I83A 2RFJA 2DVQA 5FE2A 4NXJA 5JWMA 3U5OA 2DVVA 3QZTA 3ZYUA 4UIUA 4MEPA 3RCWA 5CPEA 4CUPA 5E9LA 3O36A 4UYEA 3UV2A 4BHWA 4QC3A 2YELA 5DKCA 4TU6A 5ENIA 5DFBA 5E9YA 5KTUA 4HXMA 5CRZA 5A5QA 4YYIA 3O35A 3HMEA 4CL9A 5HFQA 2L85A 4QYLA 4QSQA 5FFWA 5I29A 5CQ8A 2I7KA 5HQ7A 4LZRA 5H1UA 3I3JA 3UW9A 4YY4A 4IR4A 4KV4A 5DLZA 4A9MA 3UVWA 3U5PA 5ENFA 5BT3A 5HQ6A 2R10A 3O34A 2L5EA 5ACYA 5I1QA 5HJCA 2RO1A 2H60A 2YDWA 4LZSA 3D7CA 3UV5A 4PTBA 4DONA 5AD3A 5H1TA 4HBVA 5FE6A 3P1DA 4XYAA 5F1HA 5LKUA 5CU8A 5FE0A 5KTXA 4QSUA 3SVFA 4NR5A 5CUBA 4TTEA 5II2A 4QY4A 5FBXA 4UYHA 4TZ2A 3MULA 4YYMA 4YABA 5HLSA 4TT4A 5ETDA 2DVSA 4IOQA 2DVRA 5HEMA 5L8UA 4YYJA 5E9VA 5I40A 5DYAA 3LXJA 5DFCA 3LQJA 5FB0A 5CGPA 5C85A 5D3SA 3UVDA 5A5SA 4A9KA 4OGIA 5H85A 4PS5A 4LR6A 4NR9A 4A9EA 5D3PA 5KU3A 5HQ5A 4HXSA 4QSXA 4PY6A 4YADA 5F1LA 5EWDA 4BW1A 4NRCA 5KTWA 4YH4A 4A9HA 5F3AA 5HFRA 4UIXA 3G0JA 4NR4A 5A5PA 4XUAA 5FE5A 5ENGA 5E9IA 4O77A 5EPBA 4XUBA 5DKHA 4TS8A 5BT4A 4OUFA 5C7NA 3U5KA 5EU1A 4Z6HA 2YYNA 2R0SA 3ONIA 5FG5A 4O7AA 4O7CA 5F60A 5D24A 5E7DA 1X0JA 4IR3A 5F62A 3UVXA 5ETBA 5E74A 4J0RA 5DY7A 5HRXA 4N3WA 3S92A 4YYGA 4QUTA 2OSSA 4E96A 3IU5A 5FE4A 4HXKA 2E7NA 5I7XA 3Q2EA 4BW3A 5ENHA 5CUAA 4NYWA 5D26A 5A5NA 5IGNA 5F61A 5E0RA 5L8TA 5DLXA 2F6JA 5EM3A 3O37A 5CS8A 5FFVA 4CFLA 3UVYA 4YAXA 5D3RA 5CUGA 4C67A 5JI8A 4O75A 5A85A 5F5ZA 4QYDA 5CP5A 4ZQLA 4HXPA 2I8NA 3MQMA 4YYNA 5IGLA 5EP7A 4YBSA 4ALHA 5DYCA 5A83A 4CFKA 2NXBA 5EPRA 4AKNA 5FH8A 4O72A 5F2PA 3P5OA 2YEMA 5AMEA 4LYWA 4N4HA 4UIYA 2RI7A 4IR5A 5G4RA 2WP1A 3G0LA 3HMFA 4QBMA 4A9IA 4Z1SA 3SVHA 2RS9B 4HXRA 3AQAA 4KCXA 4QSWA 5FH7A 4CUUA 4X2IA 5KHMA 4NR6A 4QEWA 5D3TA 3K2JA 4YYKA 5I89A 4A9NA 5EGUA 5FB1A 4J1PA 2LSPB 5EV9A 4HBYA 5ENCA 1WUGA 5EVAA 4LYSA 2GRCA 2OO1A 4ZC9A 4LYIA 5DFDA 2E3KA 5LKTA 5FFYA 4TU4A 1E6IA 2DKWA 4YYDA 5DW2A 2L84A 4NQMA 4UIZA 5CQAA 4NS5A 5E9MA 3JVJA 3DWYA 5LJ0A 5CZGA 4UYFB 2G4AA 5CTLA 5C4QA 4YC9A 3FKMX 4LRGA 4QR4A 4QZSA 2N9GA 3LQIA 5EQ1A 4TZ8A 5FDZA 4OGJA 5EWCA 4CURA 5EI4A 4A9FA 4RVRA 5KO4A 5FE9A 4YY6A 5DBMA 3NXBA 5CUCA 4ZW1A 2YEKA 5E3GA 1F68A 4IOOA 4NYXA 4QSRA 4NRBA 4WIVA 4Z93A 5A5OA 5EWWA 5A7CA 5IGMA 4YK0A 2F6NA 4Y03A 5ENBA 4Q0NA 5LVRA 5TCMA 5HM0A 4BJXA 5CRMA 5EK9A 4CLBA 5II1A 3MXFA 2KTBB 4QB3A 4Z6IA 5L96A 4Z1QA 5I7YA 5F63A 4MR4A 5EWHA 5DKDA 5CQ5A 4O76A 1EQFA 3GG3A 2DATA 5G4SA 4NQNA 5LJ1A 5CQTA 4WHUA 4XY8A 5CQ3A 5EA1A 4C66A 3HMHA 2FSAA 4NRAA 2R0YA 3U5NA 5HENA 2D9EA 5D3JA 5EISA 3LJWA 5HRWA 5LKZA 2MJVB 4N4IA 4NUDA 3QZSA 5LVQA 2RNWA 1JSPB 4HXOA 4HBXA 4MR5A 5L99A 5AD2A 3P1EA 5C87A 5EPSA 4BW2A 1JM4B 2D82A 5D25A 3MB4A 3Q2FA 5J0DA 4QSPA 5I86A 5CY9A 5DYXA 5FG6A 4Q0OA 3UV4A 4O7BA 4MEQA 5IBNA 4O78A 5LJ2A 5FE8A 5HCLA 5IIDA 4NYVA 5FH6A 5E9KA 5CFWA 5FG4A 4A9JA 1WUMA 4UYGA 5CQ4A 4O7FA 4CUTA 4TT2A 4A9OA 5CQ7A 4QUUA 3O33A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FE1 A;  5D0C A;  5FE7 A;  4PCI A;  4LZ2 A;  5A82 A;  4TYL A;  5BT5 A;  5ENE A;  5DX4 A;  5H1V A;  4HXN A;  4NR7 A;  4UYD A;  4QNS A;  4BW4 A;  4CUQ A;  3IU6 A;  5LUU A;  5F25 A;  1ZS5 A;  3JVK A;  4QEV A;  3DAI A;  4O74 A;  4PKL A;  4O7E A;  5DYU A;  3U5M A;  4J3I A;  5IG6 A;  3S91 A;  4CUS A;  2R0V A;  2YW5 A;  4QC1 A;  4LC2 A;  4UYF A;  4UIT A;  4QR5 A;  5LKX A;  2WP2 A;  4O71 A;  2E7O A;  4QEU A;  4A9L A;  5IGK A;  5HRV A;  5F36 A;  4YH3 A;  2RNY A;  4GPJ A;  4IOR A;  4MR3 A;  4IR6 A;  4F3I A;  5A5R A;  3LQH A;  4NUE A;  5K29 A;  5I80 A;  4MEN A;  5E3D A;  3MUK A;  5HEL A;  4WHW A;  4MR6 A;  4UIW A;  5L97 A;  4YBT A;  3AAD A;  5DW1 A;  5C8G A;  2YQD A;  4YBM A;  4ALG A;  5AMF A;  5D3N A;  4LDF A;  5CUD A;  4QST A;  4QR3 A;  3JVM A;  5C89 A;  4NR8 A;  5CQ6 A;  5D3H A;  4MEO A;  4HXL A;  3JVL A;  3P1F A;  4TQN A;  3U5J A;  4N4G A;  4NUC A;  4J0S A;  4YYH A;  4QSS A;  4HBW A;  4QSV A;  4TT6 A;  3TLP A;  4XY9 A;  2OUO A;  5TB6 A;  4YAT A;  5EIC A;  5A81 A;  5I88 A;  4O70 A;  5EWV A;  3MB3 A;  5ENJ A;  5D7X A;  4FLP A;  1N72 A;  4N4F A;  3U5L A;  5CUE A;  5E73 A;  4KV1 A;  5L98 A;  5COI A;  5FE3 A;  2RNX A;  3SVG A;  3QZV A;  3P1C A;  4PCE A;  2DWW A;  5D3L A;  4UIV A;  5I83 A;  2RFJ A;  2DVQ A;  5FE2 A;  4NXJ A;  5JWM A;  3U5O A;  2DVV A;  3QZT A;  3ZYU A;  4UIU A;  4MEP A;  3RCW A;  5CPE A;  4CUP A;  5E9L A;  3O36 A;  4UYE A;  3UV2 A;  4BHW A;  4QC3 A;  2YEL A;  5DKC A;  4TU6 A;  5ENI A;  5DFB A;  5E9Y A;  5KTU A;  4HXM A;  5CRZ A;  5A5Q A;  4YYI A;  3O35 A;  3HME A;  4CL9 A;  5HFQ A;  2L85 A;  4QYL A;  4QSQ A;  5FFW A;  5I29 A;  5CQ8 A;  2I7K A;  5HQ7 A;  4LZR A;  5H1U A;  3I3J A;  3UW9 A;  4YY4 A;  4IR4 A;  4KV4 A;  5DLZ A;  4A9M A;  3UVW A;  3U5P A;  5ENF A;  5BT3 A;  5HQ6 A;  2R10 A;  3O34 A;  2L5E A;  5ACY A;  5I1Q A;  5HJC A;  2RO1 A;  2H60 A;  2YDW A;  4LZS A;  3D7C A;  3UV5 A;  4PTB A;  4DON A;  5AD3 A;  5H1T A;  4HBV A;  5FE6 A;  3P1D A;  4XYA A;  5F1H A;  5LKU A;  5CU8 A;  5FE0 A;  5KTX A;  4QSU A;  3SVF A;  4NR5 A;  5CUB A;  4TTE A;  5II2 A;  4QY4 A;  5FBX A;  4UYH A;  4TZ2 A;  3MUL A;  4YYM A;  4YAB A;  5HLS A;  4TT4 A;  5ETD A;  2DVS A;  4IOQ A;  2DVR A;  5HEM A;  5L8U A;  4YYJ A;  5E9V A;  5I40 A;  5DYA A;  3LXJ A;  5DFC A;  3LQJ A;  5FB0 A;  5CGP A;  5C85 A;  5D3S A;  3UVD A;  5A5S A;  4A9K A;  4OGI A;  5H85 A;  4PS5 A;  4LR6 A;  4NR9 A;  4A9E A;  5D3P A;  5KU3 A;  5HQ5 A;  4HXS A;  4QSX A;  4PY6 A;  4YAD A;  5F1L A;  5EWD A;  4BW1 A;  4NRC A;  5KTW A;  4YH4 A;  4A9H A;  5F3A A;  5HFR A;  4UIX A;  3G0J A;  4NR4 A;  5A5P A;  4XUA A;  5FE5 A;  5ENG A;  5E9I A;  4O77 A;  5EPB A;  4XUB A;  5DKH A;  4TS8 A;  5BT4 A;  4OUF A;  5C7N A;  3U5K A;  5EU1 A;  4Z6H A;  2YYN A;  2R0S A;  3ONI A;  5FG5 A;  4O7A A;  4O7C A;  5F60 A;  5D24 A;  5E7D A;  1X0J A;  4IR3 A;  5F62 A;  3UVX A;  5ETB A;  5E74 A;  4J0R A;  5DY7 A;  5HRX A;  4N3W A;  3S92 A;  4YYG A;  4QUT A;  2OSS A;  4E96 A;  3IU5 A;  5FE4 A;  4HXK A;  2E7N A;  5I7X A;  3Q2E A;  4BW3 A;  5ENH A;  5CUA A;  4NYW A;  5D26 A;  5A5N A;  5IGN A;  5F61 A;  5E0R A;  5L8T A;  5DLX A;  2F6J A;  5EM3 A;  3O37 A;  5CS8 A;  5FFV A;  4CFL A;  3UVY A;  4YAX A;  5D3R A;  5CUG A;  4C67 A;  5JI8 A;  4O75 A;  5A85 A;  5F5Z A;  4QYD A;  5CP5 A;  4ZQL A;  4HXP A;  2I8N A;  3MQM A;  4YYN A;  5IGL A;  5EP7 A;  4YBS A;  4ALH A;  5DYC A;  5A83 A;  4CFK A;  2NXB A;  5EPR A;  4AKN A;  5FH8 A;  4O72 A;  5F2P A;  3P5O A;  2YEM A;  5AME A;  4LYW A;  4N4H A;  4UIY A;  2RI7 A;  4IR5 A;  5G4R A;  2WP1 A;  3G0L A;  3HMF A;  4QBM A;  4A9I A;  4Z1S A;  3SVH A;  2RS9 B;  4HXR A;  3AQA A;  4KCX A;  4QSW A;  5FH7 A;  4CUU A;  4X2I A;  5KHM A;  4NR6 A;  4QEW A;  5D3T A;  3K2J A;  4YYK A;  5I89 A;  4A9N A;  5EGU A;  5FB1 A;  4J1P A;  2LSP B;  5EV9 A;  4HBY A;  5ENC A;  1WUG A;  5EVA A;  4LYS A;  2GRC A;  2OO1 A;  4ZC9 A;  4LYI A;  5DFD A;  2E3K A;  5LKT A;  5FFY A;  4TU4 A;  1E6I A;  2DKW A;  4YYD A;  5DW2 A;  2L84 A;  4NQM A;  4UIZ A;  5CQA A;  4NS5 A;  5E9M A;  3JVJ A;  3DWY A;  5LJ0 A;  5CZG A;  4UYF B;  2G4A A;  5CTL A;  5C4Q A;  4YC9 A;  3FKM X;  4LRG A;  4QR4 A;  4QZS A;  2N9G A;  3LQI A;  5EQ1 A;  4TZ8 A;  5FDZ A;  4OGJ A;  5EWC A;  4CUR A;  5EI4 A;  4A9F A;  4RVR A;  5KO4 A;  5FE9 A;  4YY6 A;  5DBM A;  3NXB A;  5CUC A;  4ZW1 A;  2YEK A;  5E3G A;  1F68 A;  4IOO A;  4NYX A;  4QSR A;  4NRB A;  4WIV A;  4Z93 A;  5A5O A;  5EWW A;  5A7C A;  5IGM A;  4YK0 A;  2F6N A;  4Y03 A;  5ENB A;  4Q0N A;  5LVR A;  5TCM A;  5HM0 A;  4BJX A;  5CRM A;  5EK9 A;  4CLB A;  5II1 A;  3MXF A;  2KTB B;  4QB3 A;  4Z6I A;  5L96 A;  4Z1Q A;  5I7Y A;  5F63 A;  4MR4 A;  5EWH A;  5DKD A;  5CQ5 A;  4O76 A;  1EQF A;  3GG3 A;  2DAT A;  5G4S A;  4NQN A;  5LJ1 A;  5CQT A;  4WHU A;  4XY8 A;  5CQ3 A;  5EA1 A;  4C66 A;  3HMH A;  2FSA A;  4NRA A;  2R0Y A;  3U5N A;  5HEN A;  2D9E A;  5D3J A;  5EIS A;  3LJW A;  5HRW A;  5LKZ A;  2MJV B;  4N4I A;  4NUD A;  3QZS A;  5LVQ A;  2RNW A;  1JSP B;  4HXO A;  4HBX A;  4MR5 A;  5L99 A;  5AD2 A;  3P1E A;  5C87 A;  5EPS A;  4BW2 A;  1JM4 B;  2D82 A;  5D25 A;  3MB4 A;  3Q2F A;  5J0D A;  4QSP A;  5I86 A;  5CY9 A;  5DYX A;  5FG6 A;  4Q0O A;  3UV4 A;  4O7B A;  4MEQ A;  5IBN A;  4O78 A;  5LJ2 A;  5FE8 A;  5HCL A;  5IID A;  4NYV A;  5FH6 A;  5E9K A;  5CFW A;  5FG4 A;  4A9J A;  1WUM A;  4UYG A;  5CQ4 A;  4O7F A;  4CUT A;  4TT2 A;  4A9O A;  5CQ7 A;  4QUU A;  3O33 A; 
#chains in the Genus database with same CATH topology
 5FE1 A;  5D0C A;  5FE7 A;  4PCI A;  4LZ2 A;  5A82 A;  4TYL A;  5BT5 A;  5ENE A;  5DX4 A;  5H1V A;  3ERR A;  4HXN A;  4NR7 A;  4UYD A;  4QNS A;  4BW4 A;  4CUQ A;  3IU6 A;  5LUU A;  5F25 A;  1ZS5 A;  3JVK A;  4QEV A;  3DAI A;  4O74 A;  4PKL A;  4O7E A;  5DYU A;  3U5M A;  4J3I A;  5IG6 A;  3S91 A;  4CUS A;  2R0V A;  2YW5 A;  4QC1 A;  4AKI A;  4LC2 A;  4UYF A;  4UIT A;  4QR5 A;  5LKX A;  2WP2 A;  4O71 A;  2E7O A;  4QEU A;  4A9L A;  5IGK A;  5HRV A;  5F36 A;  4YH3 A;  2RNY A;  4GPJ A;  4IOR A;  4MR3 A;  4IR6 A;  4F3I A;  5A5R A;  3LQH A;  4NUE A;  5K29 A;  5I80 A;  4MEN A;  5E3D A;  3MUK A;  5HEL A;  4WHW A;  4MR6 A;  4UIW A;  5L97 A;  4YBT A;  3AAD A;  5DW1 A;  5C8G A;  2YQD A;  4YBM A;  4ALG A;  5AMF A;  5D3N A;  4LDF A;  5CUD A;  4QST A;  4QR3 A;  3JVM A;  5C89 A;  4NR8 A;  5CQ6 A;  5D3H A;  4MEO A;  4HXL A;  3JVL A;  3P1F A;  4TQN A;  3U5J A;  4N4G A;  4NUC A;  4J0S A;  4YYH A;  4QSS A;  4HBW A;  4QSV A;  4TT6 A;  3TLP A;  4XY9 A;  2OUO A;  5TB6 A;  4YAT A;  5EIC A;  5A81 A;  5I88 A;  4O70 A;  5EWV A;  3MB3 A;  5ENJ A;  5D7X A;  4FLP A;  1N72 A;  4N4F A;  3U5L A;  5CUE A;  5E73 A;  4KV1 A;  5L98 A;  5COI A;  5FE3 A;  2RNX A;  3SVG A;  3QZV A;  3P1C A;  4PCE A;  2DWW A;  5D3L A;  4UIV A;  5I83 A;  2RFJ A;  2DVQ A;  5FE2 A;  4NXJ A;  5JWM A;  3U5O A;  2DVV A;  3QZT A;  3ZYU A;  4UIU A;  4MEP A;  3RCW A;  5CPE A;  4CUP A;  5E9L A;  3O36 A;  4UYE A;  3UV2 A;  4BHW A;  2EJN A;  4QC3 A;  2YEL A;  5DKC A;  4TU6 A;  5ENI A;  5DFB A;  5E9Y A;  5KTU A;  4HXM A;  5CRZ A;  5A5Q A;  4YYI A;  3O35 A;  3HME A;  4CL9 A;  5HFQ A;  2L85 A;  4QYL A;  4QSQ A;  5FFW A;  5I29 A;  5CQ8 A;  2I7K A;  5HQ7 A;  4LZR A;  5H1U A;  3I3J A;  3UW9 A;  4YY4 A;  4IR4 A;  4KV4 A;  5DLZ A;  4A9M A;  3UVW A;  3U5P A;  5ENF A;  5BT3 A;  5HQ6 A;  2R10 A;  3O34 A;  2L5E A;  5ACY A;  5I1Q A;  5HJC A;  2RO1 A;  2H60 A;  2YDW A;  4LZS A;  3D7C A;  3UV5 A;  4PTB A;  4DON A;  5AD3 A;  5H1T A;  4HBV A;  5FE6 A;  3P1D A;  4XYA A;  5F1H A;  5LKU A;  5CU8 A;  5FE0 A;  5KTX A;  4QSU A;  3SVF A;  4NR5 A;  5CUB A;  4TTE A;  5II2 A;  4QY4 A;  5FBX A;  4UYH A;  4TZ2 A;  3MUL A;  4YYM A;  4YAB A;  5HLS A;  4TT4 A;  5ETD A;  2DVS A;  4IOQ A;  2DVR A;  5HEM A;  5L8U A;  4YYJ A;  5E9V A;  5I40 A;  5DYA A;  3LXJ A;  5DFC A;  3LQJ A;  5FB0 A;  5CGP A;  5C85 A;  5D3S A;  3UVD A;  5A5S A;  4A9K A;  4OGI A;  5H85 A;  4PS5 A;  4LR6 A;  4NR9 A;  4A9E A;  5D3P A;  5KU3 A;  5HQ5 A;  4HXS A;  4QSX A;  4PY6 A;  4YAD A;  5F1L A;  5EWD A;  4BW1 A;  4NRC A;  5KTW A;  4YH4 A;  4A9H A;  5F3A A;  5HFR A;  4UIX A;  3G0J A;  4NR4 A;  5A5P A;  4XUA A;  5FE5 A;  5ENG A;  5E9I A;  4O77 A;  5EPB A;  4XUB A;  5DKH A;  4TS8 A;  5BT4 A;  4OUF A;  5C7N A;  3VKG A;  3U5K A;  5EU1 A;  4Z6H A;  2YYN A;  2R0S A;  3ONI A;  5FG5 A;  4O7A A;  4O7C A;  5F60 A;  5D24 A;  5E7D A;  1X0J A;  4IR3 A;  5F62 A;  3UVX A;  5ETB A;  5E74 A;  4J0R A;  5DY7 A;  5HRX A;  4N3W A;  3S92 A;  4YYG A;  4AKH A;  4QUT A;  2OSS A;  4E96 A;  3IU5 A;  5FE4 A;  4HXK A;  2E7N A;  5I7X A;  3Q2E A;  4BW3 A;  5ENH A;  5CUA A;  4NYW A;  3D1D A;  5D26 A;  5A5N A;  5IGN A;  5F61 A;  5E0R A;  5L8T A;  5DLX A;  2F6J A;  5EM3 A;  3O37 A;  5CS8 A;  5FFV A;  4CFL A;  3UVY A;  4YAX A;  5D3R A;  5CUG A;  4C67 A;  5JI8 A;  4O75 A;  5A85 A;  5F5Z A;  4QYD A;  5CP5 A;  4ZQL A;  4HXP A;  2I8N A;  3MQM A;  4YYN A;  5IGL A;  5EP7 A;  4YBS A;  4ALH A;  5DYC A;  5A83 A;  4CFK A;  2NXB A;  5EPR A;  4AKN A;  5FH8 A;  4O72 A;  5F2P A;  3P5O A;  2YEM A;  5AME A;  4LYW A;  4N4H A;  4UIY A;  2RI7 A;  4IR5 A;  5G4R A;  2WP1 A;  3G0L A;  3HMF A;  4QBM A;  4A9I A;  4Z1S A;  3SVH A;  2RS9 B;  4HXR A;  3AQA A;  4KCX A;  4QSW A;  5FH7 A;  4CUU A;  4X2I A;  5KHM A;  4NR6 A;  4QEW A;  5D3T A;  3K2J A;  4YYK A;  5I89 A;  4A9N A;  5EGU A;  5FB1 A;  4J1P A;  2LSP B;  5EV9 A;  4HBY A;  5ENC A;  1WUG A;  5EVA A;  4LYS A;  2GRC A;  2OO1 A;  4ZC9 A;  4LYI A;  5DFD A;  2E3K A;  5LKT A;  5FFY A;  4TU4 A;  1E6I A;  2DKW A;  4YYD A;  5DW2 A;  2L84 A;  4NQM A;  4UIZ A;  5CQA A;  4NS5 A;  4AKG A;  5E9M A;  3JVJ A;  3DWY A;  5LJ0 A;  5CZG A;  4UYF B;  2G4A A;  5CTL A;  5C4Q A;  4YC9 A;  3FKM X;  4LRG A;  4QR4 A;  4QZS A;  2N9G A;  3LQI A;  5EQ1 A;  4TZ8 A;  5FDZ A;  4OGJ A;  5EWC A;  4CUR A;  5EI4 A;  4A9F A;  4RVR A;  5KO4 A;  5FE9 A;  4YY6 A;  5DBM A;  3NXB A;  5CUC A;  4ZW1 A;  2YEK A;  5E3G A;  1F68 A;  4IOO A;  4NYX A;  4QSR A;  4NRB A;  4WIV A;  4Z93 A;  5A5O A;  5EWW A;  5A7C A;  5IGM A;  4YK0 A;  2F6N A;  4Y03 A;  5ENB A;  4Q0N A;  5LVR A;  5TCM A;  5HM0 A;  4BJX A;  5CRM A;  5EK9 A;  4CLB A;  5II1 A;  3MXF A;  2KTB B;  4QB3 A;  4Z6I A;  5L96 A;  4Z1Q A;  5I7Y A;  5F63 A;  4MR4 A;  5EWH A;  5DKD A;  5CQ5 A;  4O76 A;  1EQF A;  3GG3 A;  2DAT A;  5G4S A;  4NQN A;  5LJ1 A;  5CQT A;  4WHU A;  4XY8 A;  5CQ3 A;  5EA1 A;  4C66 A;  3HMH A;  2FSA A;  4NRA A;  2R0Y A;  1ZKR A;  5HEN A;  3U5N A;  2D9E A;  5D3J A;  5EIS A;  3LJW A;  5HRW A;  3D1B A;  5LKZ A;  2MJV B;  4N4I A;  4NUD A;  3QZS A;  5LVQ A;  2RNW A;  1JSP B;  4HXO A;  4HBX A;  4MR5 A;  5L99 A;  5AD2 A;  3P1E A;  5C87 A;  5EPS A;  4BW2 A;  1JM4 B;  2D82 A;  5D25 A;  3MB4 A;  3Q2F A;  5J0D A;  4QSP A;  5I86 A;  5CY9 A;  5DYX A;  5FG6 A;  4Q0O A;  3UV4 A;  4O7B A;  4MEQ A;  5IBN A;  4O78 A;  5LJ2 A;  5FE8 A;  3VKH A;  5HCL A;  5IID A;  4NYV A;  4AI6 A;  5FH6 A;  5E9K A;  5CFW A;  5FG4 A;  4A9J A;  1WUM A;  4UYG A;  5CQ4 A;  4O7F A;  4CUT A;  1PUO A;  4TT2 A;  4A9O A;  5CQ7 A;  4QUU A;  3O33 A; 
#chains in the Genus database with same CATH homology
 5FE1 A;  5D0C A;  5FE7 A;  4PCI A;  4LZ2 A;  5A82 A;  4TYL A;  5BT5 A;  5ENE A;  5DX4 A;  5H1V A;  4HXN A;  4NR7 A;  4UYD A;  4QNS A;  4BW4 A;  4CUQ A;  3IU6 A;  5LUU A;  5F25 A;  1ZS5 A;  3JVK A;  4QEV A;  3DAI A;  4O74 A;  4PKL A;  4O7E A;  5DYU A;  3U5M A;  4J3I A;  5IG6 A;  3S91 A;  4CUS A;  2R0V A;  2YW5 A;  4QC1 A;  4LC2 A;  4UYF A;  4UIT A;  4QR5 A;  5LKX A;  2WP2 A;  4O71 A;  2E7O A;  4QEU A;  4A9L A;  5IGK A;  5HRV A;  5F36 A;  4YH3 A;  2RNY A;  4GPJ A;  4IOR A;  4MR3 A;  4IR6 A;  4F3I A;  5A5R A;  3LQH A;  4NUE A;  5K29 A;  5I80 A;  4MEN A;  5E3D A;  3MUK A;  5HEL A;  4WHW A;  4MR6 A;  4UIW A;  5L97 A;  4YBT A;  3AAD A;  5DW1 A;  5C8G A;  2YQD A;  4YBM A;  4ALG A;  5AMF A;  5D3N A;  4LDF A;  5CUD A;  4QST A;  4QR3 A;  3JVM A;  5C89 A;  4NR8 A;  5CQ6 A;  5D3H A;  4MEO A;  4HXL A;  3JVL A;  3P1F A;  4TQN A;  3U5J A;  4N4G A;  4NUC A;  4J0S A;  4YYH A;  4QSS A;  4HBW A;  4QSV A;  4TT6 A;  3TLP A;  4XY9 A;  2OUO A;  5TB6 A;  4YAT A;  5EIC A;  5A81 A;  5I88 A;  4O70 A;  5EWV A;  3MB3 A;  5ENJ A;  5D7X A;  4FLP A;  1N72 A;  4N4F A;  3U5L A;  5CUE A;  5E73 A;  4KV1 A;  5L98 A;  5COI A;  5FE3 A;  2RNX A;  3SVG A;  3QZV A;  3P1C A;  4PCE A;  2DWW A;  5D3L A;  4UIV A;  5I83 A;  2RFJ A;  2DVQ A;  5FE2 A;  4NXJ A;  5JWM A;  3U5O A;  2DVV A;  3QZT A;  3ZYU A;  4UIU A;  4MEP A;  3RCW A;  5CPE A;  4CUP A;  5E9L A;  3O36 A;  4UYE A;  3UV2 A;  4BHW A;  4QC3 A;  2YEL A;  5DKC A;  4TU6 A;  5ENI A;  5DFB A;  5E9Y A;  5KTU A;  4HXM A;  5CRZ A;  5A5Q A;  4YYI A;  3O35 A;  3HME A;  4CL9 A;  5HFQ A;  2L85 A;  4QYL A;  4QSQ A;  5FFW A;  5I29 A;  5CQ8 A;  2I7K A;  5HQ7 A;  4LZR A;  5H1U A;  3I3J A;  3UW9 A;  4YY4 A;  4IR4 A;  4KV4 A;  5DLZ A;  4A9M A;  3UVW A;  3U5P A;  5ENF A;  5BT3 A;  5HQ6 A;  2R10 A;  3O34 A;  2L5E A;  5ACY A;  5I1Q A;  5HJC A;  2RO1 A;  2H60 A;  2YDW A;  4LZS A;  3D7C A;  3UV5 A;  4PTB A;  4DON A;  5AD3 A;  5H1T A;  4HBV A;  5FE6 A;  3P1D A;  4XYA A;  5F1H A;  5LKU A;  5CU8 A;  5FE0 A;  5KTX A;  4QSU A;  3SVF A;  4NR5 A;  5CUB A;  4TTE A;  5II2 A;  4QY4 A;  5FBX A;  4UYH A;  4TZ2 A;  3MUL A;  4YYM A;  4YAB A;  5HLS A;  4TT4 A;  5ETD A;  2DVS A;  4IOQ A;  2DVR A;  5HEM A;  5L8U A;  4YYJ A;  5E9V A;  5I40 A;  5DYA A;  3LXJ A;  5DFC A;  3LQJ A;  5FB0 A;  5CGP A;  5C85 A;  5D3S A;  3UVD A;  5A5S A;  4A9K A;  4OGI A;  5H85 A;  4PS5 A;  4LR6 A;  4NR9 A;  4A9E A;  5D3P A;  5KU3 A;  5HQ5 A;  4HXS A;  4QSX A;  4PY6 A;  4YAD A;  5F1L A;  5EWD A;  4BW1 A;  4NRC A;  5KTW A;  4YH4 A;  4A9H A;  5F3A A;  5HFR A;  4UIX A;  3G0J A;  4NR4 A;  5A5P A;  4XUA A;  5FE5 A;  5ENG A;  5E9I A;  4O77 A;  5EPB A;  4XUB A;  5DKH A;  4TS8 A;  5BT4 A;  4OUF A;  5C7N A;  3U5K A;  5EU1 A;  4Z6H A;  2YYN A;  2R0S A;  3ONI A;  5FG5 A;  4O7A A;  4O7C A;  5F60 A;  5D24 A;  5E7D A;  1X0J A;  4IR3 A;  5F62 A;  3UVX A;  5ETB A;  5E74 A;  4J0R A;  5DY7 A;  5HRX A;  4N3W A;  3S92 A;  4YYG A;  4QUT A;  2OSS A;  4E96 A;  3IU5 A;  5FE4 A;  4HXK A;  2E7N A;  5I7X A;  3Q2E A;  4BW3 A;  5ENH A;  5CUA A;  4NYW A;  5D26 A;  5A5N A;  5IGN A;  5F61 A;  5E0R A;  5L8T A;  5DLX A;  2F6J A;  5EM3 A;  3O37 A;  5CS8 A;  5FFV A;  4CFL A;  3UVY A;  4YAX A;  5D3R A;  5CUG A;  4C67 A;  5JI8 A;  4O75 A;  5A85 A;  5F5Z A;  4QYD A;  5CP5 A;  4ZQL A;  4HXP A;  2I8N A;  3MQM A;  4YYN A;  5IGL A;  5EP7 A;  4YBS A;  4ALH A;  5DYC A;  5A83 A;  4CFK A;  2NXB A;  5EPR A;  4AKN A;  5FH8 A;  4O72 A;  5F2P A;  3P5O A;  2YEM A;  5AME A;  4LYW A;  4N4H A;  4UIY A;  2RI7 A;  4IR5 A;  5G4R A;  2WP1 A;  3G0L A;  3HMF A;  4QBM A;  4A9I A;  4Z1S A;  3SVH A;  2RS9 B;  4HXR A;  3AQA A;  4KCX A;  4QSW A;  5FH7 A;  4CUU A;  4X2I A;  5KHM A;  4NR6 A;  4QEW A;  5D3T A;  3K2J A;  4YYK A;  5I89 A;  4A9N A;  5EGU A;  5FB1 A;  4J1P A;  2LSP B;  5EV9 A;  4HBY A;  5ENC A;  1WUG A;  5EVA A;  4LYS A;  2GRC A;  2OO1 A;  4ZC9 A;  4LYI A;  5DFD A;  2E3K A;  5LKT A;  5FFY A;  4TU4 A;  1E6I A;  2DKW A;  4YYD A;  5DW2 A;  2L84 A;  4NQM A;  4UIZ A;  5CQA A;  4NS5 A;  5E9M A;  3JVJ A;  3DWY A;  5LJ0 A;  5CZG A;  4UYF B;  2G4A A;  5CTL A;  5C4Q A;  4YC9 A;  3FKM X;  4LRG A;  4QR4 A;  4QZS A;  2N9G A;  3LQI A;  5EQ1 A;  4TZ8 A;  5FDZ A;  4OGJ A;  5EWC A;  4CUR A;  5EI4 A;  4A9F A;  4RVR A;  5KO4 A;  5FE9 A;  4YY6 A;  5DBM A;  3NXB A;  5CUC A;  4ZW1 A;  2YEK A;  5E3G A;  1F68 A;  4IOO A;  4NYX A;  4QSR A;  4NRB A;  4WIV A;  4Z93 A;  5A5O A;  5EWW A;  5A7C A;  5IGM A;  4YK0 A;  2F6N A;  4Y03 A;  5ENB A;  4Q0N A;  5LVR A;  5TCM A;  5HM0 A;  4BJX A;  5CRM A;  5EK9 A;  4CLB A;  5II1 A;  3MXF A;  2KTB B;  4QB3 A;  4Z6I A;  5L96 A;  4Z1Q A;  5I7Y A;  5F63 A;  4MR4 A;  5EWH A;  5DKD A;  5CQ5 A;  4O76 A;  1EQF A;  3GG3 A;  2DAT A;  5G4S A;  4NQN A;  5LJ1 A;  5CQT A;  4WHU A;  4XY8 A;  5CQ3 A;  5EA1 A;  4C66 A;  3HMH A;  2FSA A;  4NRA A;  2R0Y A;  3U5N A;  5HEN A;  2D9E A;  5D3J A;  5EIS A;  3LJW A;  5HRW A;  5LKZ A;  2MJV B;  4N4I A;  4NUD A;  3QZS A;  5LVQ A;  2RNW A;  1JSP B;  4HXO A;  4HBX A;  4MR5 A;  5L99 A;  5AD2 A;  3P1E A;  5C87 A;  5EPS A;  4BW2 A;  1JM4 B;  2D82 A;  5D25 A;  3MB4 A;  3Q2F A;  5J0D A;  4QSP A;  5I86 A;  5CY9 A;  5DYX A;  5FG6 A;  4Q0O A;  3UV4 A;  4O7B A;  4MEQ A;  5IBN A;  4O78 A;  5LJ2 A;  5FE8 A;  5HCL A;  5IID A;  4NYV A;  5FH6 A;  5E9K A;  5CFW A;  5FG4 A;  4A9J A;  1WUM A;  4UYG A;  5CQ4 A;  4O7F A;  4CUT A;  4TT2 A;  4A9O A;  5CQ7 A;  4QUU A;  3O33 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...